LIPOSOMAL SPHERICAL NUCLEIC ACID (SNA) CONSTRUCTS PRESENTING ANTISENSE OLIGONUCLEOTIDES (ASO) FOR SPECIFIC KNOCKDOWN OF INTERLEUKIN 17 RECEPTOR MRNA

20200308579 ยท 2020-10-01

Assignee

Inventors

Cpc classification

International classification

Abstract

Aspects of the invention relate to antisense oligonucleotides directed to the interleukin 17 receptor (IL-17R), and other targets. Spherical nucleic acid formulations or compositions of antisense oligonucleotides and related methods of treatment are also provided.

Claims

1. A single-stranded modified oligonucleotide consisting of 10-30 linked nucleosides and having: a gap segment consisting of two to eight linked deoxynucleosides; a 5 wing segment consisting of linked nucleosides; and a 3 wing segment consisting of linked nucleosides; wherein the gap segment is positioned between the 5 wing segment and the 3 wing segment; wherein at least some nucleosides of each wing segment comprises a modified nucleotide; wherein the internucleoside linkages within the gap segment and the linkages connecting the gap segment to the 3 wing segments are all phosphorothioate linkages (*); and the internucleoside linkages connecting the rest of the nucleosides of both the 5 and 3 wing segments are phosphodiester linkages; and wherein the nucleobase sequence of the oligonucleotide consists of 10-30 contiguous nucleobases complementary to an equal length portion of SEQ ID NO.: 302, or a pharmaceutically acceptable salt thereof.

2. The oligonucleotide of claim 1, wherein the nucleobase sequence of the oligonucleotide is GCUUGGGCAGGTGGUGAA (SEQ ID NO: 225).

3. The oligonucleotide of claim 1, wherein the nucleobase sequence of the oligonucleotide is CCCACAGGGGCATGUAGU (SEQ ID NO: 288).

4. The oligonucleotide of claim 1, wherein the nucleobase sequence of the oligonucleotide is GUAGGGCGUGTGTGGGUC (SEQ ID NO: 291).

5. The oligonucleotide of claim 1, wherein the nucleobase sequence of the oligonucleotide is mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA (SEQ ID NO: 225).

6. The oligonucleotide of claim 1, wherein the nucleobase sequence of the oligonucleotide is mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU (SEQ ID NO: 288).

7. The oligonucleotide of claim 1, wherein the nucleobase sequence of the oligonucleotide is mGmUmAmGmGmGmCmGmUG*T*G*T*G*G*mGmUmC (SEQ ID NO: 291).

8. The oligonucleotide of any one of claims 1-7, wherein the compound is 20 nucleotides in length.

9. The oligonucleotide of any one of claims 1-7, further comprising a molecular species at one of the ends.

10. The oligonucleotide of any one of claims 1-7, wherein the compound further comprises a molecular species at both ends.

11. The oligonucleotide of any one of claims 9-10, wherein the molecular species is selected from the group consisting of a spacer, a lipid, a sterol, cholesterol, stearyl, C16 alkyl chain, bile acids, cholic acid, taurocholic acid, deoxycholate, oleyl litocholic acid, oleoyl cholenic acid, glycolipids, phospholipids, sphingolipids, isoprenoids, such as steroids, vitamins, such as vitamin E, saturated fatty acids, unsaturated fatty acids, fatty acid esters, such as triglycerides, pyrenes, porphyrines, Texaphyrine, adamantane, acridines, biotin, coumarin, fluorescein, rhodamine, Texas-Red, digoxygenin, dimethoxytrityl, t-butyldimethylsilyl, t-butyldiphenylsilyl, cyanine dyes (e.g. Cy3 or Cy5), Hoechst 33258 dye, psoralen, and ibuprofen.

12. The oligonucleotide of any one of claims 9-10, wherein the molecular species is a selected from the group consisting of a lipophilic moiety; a folic acid radical; a steroid radical; a carbohydrate radical; a vitamin A radical; a vitamin E radical; or a vitamin K radical.

13. The oligonucleotide of any one of claims 9-10, wherein the molecular species is connected directly to the compound through a linkage selected from the group consisting of phosphodiester, phosphorothioate, methylphosphonate, and amide linkages.

14. The oligonucleotide of any one of claims 9-10, wherein the molecular species is connected indirectly to the compound through a linker.

15. The oligonucleotide of claim 14, wherein the linker is a non-nucleotidic linker selected from the group consisting of abasic residues (dSpacer), oligoethyleneglycol, such as triethyleneglycol (spacer 9) or hexaethylenegylcol (spacer 18), and alkane-diol, such as butanediol.

16. The oligonucleotide of claim 15, wherein the 3 end of the oligonucleotide is connected to 2 consecutive linkers that are hexaethylenegylcol (spacer 18), the first hexaethylenegylcol connected to the 3 end of the oligonucleotide, the second hexaethylenegylcol connected to the first hexaethylenegylcol and the second hexaethylenegylcol is connected to a cholesterol.

17. The oligonucleotide of any one of claims 1 and 9-16, wherein the oligonucleotide consists of 17-21 linked nucleosides.

18. The oligonucleotide of any one of claims 1 and 9-17, wherein the olionucleotide has a gap segment consisting of six linked deoxynucleosides.

19. The oligonucleotide of any one of claims 1 and 9-18, wherein all of the nucleosides of each wing segment comprise a modified nucleotide.

20. The oligonucleotide of any one of claims 1 and 9-19, wherein each nucleoside of each wing segment comprises a 2O-methyl ribonucleoside (m).

21. The oligonucleotide of claim 20, wherein the oligonucleotide has up to 12 2O-methyl ribonucleosides.

22. The oligonucleotide of any one of claims 1 and 9-21, wherein the nucleobase sequence of the oligonucleotide consists of 17-21 contiguous nucleobases complementary to an equal length portion of SEQ ID NO: 302.

23. An oligonucleotide comprising mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA/isp18//isp18//3CholTEG/(SEQ ID NO: 225), wherein the oligonucleotide is 20 nucleotides in length, wherein m is a 2O methyl, and wherein * is a phosphorothioate modification.

24. An oligonucleotide comprising mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288), wherein the oligonucleotide is 20 nucleotides in length, wherein m is a 2O methyl, and wherein * is a phosphorothioate modification.

25. An oligonucleotide comprising mGmUmAmGmGmGmCmGmUG*T*G*T*G*G*mGmUmC/isp18//isp18//3CholTEG/(SEQ ID NO: 291), wherein the oligonucleotide is 20 nucleotides in length, wherein m is a 2O methyl, and wherein * is a phosphorothioate modification.

26. A stable self-assembling nanostructure, comprising a core having an oligonucleotide shell comprised of an antisense oligonucleotide 18 to 21 linked nucleosides in length targeted to Interleukin 17 receptor (IL-17RA) positioned on the exterior of the core.

27. The nanostructure of claim 20, wherein the antisense oligonucleotide is 18 nucleotides in length.

28. The nanostructure of claim 26 or 27, wherein IL-17RA has a sequence of SEQ ID NO: 302.

29. The nanostructure of claim 28, wherein less than all of the internucleoside linkages are phosphodiester.

30. The nanostructure of claim 26 or 27, wherein the antisense oligonucleotide has phosphorothioate internucleoside linkages.

31. The nanostructure of claim 30, wherein less than all of the internucleoside linkages are phosphorothioate.

32. The nanostructure of any one of claims 26-31, wherein the antisense oligonucleotide has 2O methyl modifications.

33. The nanostructure of claim 32, wherein less than all of the nucleotides include a 2O methyl modification.

34. The nanostructure of claim 26, wherein the antisense oligonucleotide has 17 internucleoside linkages and wherein 6 central internucleoside linkages are phosphorothioate.

35. The nanostructure of any one of claims 26-34, wherein the antisense oligonucleotide has a nucleobase sequence complementary to a sequence comprising at least 8 contiguous nucleobases of a sequence recited in SEQ ID NO: 302.

36. The nanostructure of claim 35, wherein the antisense oligonucleotide is selected from the group consisting of mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA/isp18//isp18//3CholTEG/(SEQ ID NO: 225); mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288); and mGmUmAmGmGmGmCmGmUG*T*G*T*G*G*mGmUmC/isp18//isp18//3CholTEG/(SEQ ID NO: 291) whereinrefers to a phosphodiester bond, * refers to a phosphorothioate bond, and m refers to a O methyl.

37. The nanostructure of any one of claims 26-36, wherein the nanostructure includes 2-1,000 copies of the antisense oligonucleotide.

38. The nanostructure of claim 37, wherein the nanostructure includes at least two different antisense oligonucleotides.

39. The nanostructure of any one of claims 26-38, wherein the core is a solid or hollow core.

40. The nanostructure of any one of claims 26-38, wherein the core is a solid core and further comprising a lipid bilayer surrounding the core.

41. The nanostructure of claim 40, wherein the solid core is comprised of noble metals, including gold and silver, transition metals including iron and cobalt, metal oxides including silica, polymers or combinations thereof.

42. The nanostructure of claim 40, wherein the core is a polymeric core and wherein the polymeric core is comprised of amphiphilic block copolymers, hydrophobic polymers including polystyrene, poly(lactic acid), poly(lactic co-glycolic acid), poly(glycolic acid), poly(caprolactone) and other biocompatible polymers.

43. The nanostructure of any one of claims 26-38, wherein the core is a liposomal core.

44. The nanostructure of claim 43, wherein the liposomal core is comprised of one or more lipids selected from: 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dimyristoyl-sn-phosphatidylcholine (DMPC), 1-palmitoyl-2-oleoyl-sn-phosphatidylcholine (POPC), 1,2-distearoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DSPG), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine (DOPE), and 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (DPPE), sphingolipids such as sphingosine, sphingosine phosphate, methylated sphingosines and sphinganines, ceramides, ceramide phosphates, 1-0 acyl ceramides, dihydroceramides, 2-hydroxy ceramides, sphingomyelin, glycosylated sphingolipids, sulfatides, gangliosides, phosphosphingolipids, and phytosphingosines of various lengths and saturation states and their derivatives, phospholipids such as phosphatidylcholines, lysophosphatidylcholines, phosphatidic acids, lysophosphatidic acids, cyclic LPA, phosphatidylethanolamines, lysophosphatidylethanolamines, phosphatidylglycerols, lysophosphatidylglycerols, phosphatidylserines, lysophosphatidylserines, phosphatidylinositols, inositol phosphates, LPI, cardiolipins, lysocardiolipins, bis(monoacylglycero) phosphates, (diacylglycero) phosphates, ether lipids, diphytanyl ether lipids, and plasmalogens of various lengths, saturation states, and their derivatives, sterols such as cholesterol, desmosterol, stigmasterol, lanosterol, lathosterol, diosgenin, sitosterol, zymosterol, zymostenol, 14-demethyl-lanosterol, cholesterol sulfate, DHEA, DHEA sulfate, 14-demethyl-14-dehydrlanosterol, sitostanol, campesterol, ether anionic lipids, ether cationic lipids, lanthanide chelating lipids, A-ring substituted oxysterols, B-ring substituted oxysterols, D-ring substituted oxysterols, side-chain substituted oxysterols, double substituted oxysterols, cholestanoic acid derivatives, fluorinated sterols, fluorescent sterols, sulfonated sterols, phosphorylated sterols, and polyunsaturated sterols of different lengths, saturation states, and derivatives thereof.

45. The nanostructure of any one of claims 26-38, wherein the core is a niosome.

46. A multiplex antisense oligonucleotide spherical nucleic acid (mASO-SNA), comprising a core having an oligonucleotide shell comprised of an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a first gene and an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a second gene, wherein the core is a solid surrounded by a lipid bilayer or a liposome or lipoplex complex core and the oligonucleotide shell is positioned on the exterior of the core.

47. The mASO-SNA of claim 46, wherein the first gene and the second gene are associated with a disease.

48. The mASO-SNA of claim 46 or 47, wherein the disease is an inflammatory disorder.

49. The mASO-SNA of claim 46 or 47, wherein the disease is psoriasis.

50. The mASO-SNA of any one of claims 46-49, wherein the first gene and the second gene are associated with a target pathway.

51. The mASO-SNA of any one of claims 46-50, further comprising an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a third gene.

52. The mASO-SNA of any one of claims 46-51, wherein the first gene is an Interleukin 17 receptor (IL-17RA).

53. The mASO-SNA of any one of claims 46-52, wherein the second gene is TNF.

54. The mASO-SNA of any one of claims 46-53, wherein the first gene and the second gene are present in an approximate equimolar amount in the oligonucleotide shell.

55. A method for treating a disorder, comprising: administering to a subject having a disorder a multiplex antisense oligonucleotide spherical nucleic acid (mASO-SNA), comprising a core having an oligonucleotide shell comprised of an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a first gene and an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a second gene, wherein the core is a solid surrounded by a lipid bilayer or a liposome or lipoplex complex core and the oligonucleotide shell is positioned on the exterior of the core in an effective amount to treat the disorder.

56. The method of claim 55, wherein the disorder is an inflammatory disorder.

57. The method of claim 55, wherein the mASO-SNA produces simultaneous mRNA knock-down of the first and second gene.

58. The method of claim 55, wherein the first gene and the second gene are associated with a target pathway.

59. The method of claim 58, wherein the mASO-SNA produces additive knock-down of the target pathway.

60. The method of any one of claims 55-59, wherein the disorder is psoriasis.

61. A method for treating an inflammatory disorder, comprising: administering to a subject having an inflammatory disorder a composition comprising the oligonucleotide of any one of claims 1-25 or the nanostructure of any one of claims 26-44 in an effective amount to treat the inflammatory disorder.

62. The method of claim 61, wherein the inflammatory disorder is selected from the group consisting of an autoimmune disease, an infectious disease, transplant rejection or graft-versus-host disease, malignancy, a pulmonary disorder, an intestinal disorder, a cardiac disorder, sepsis, a spondyloarthropathy, a metabolic disorder, anemia, pain, a hepatic disorder, a skin disorder, a nail disorder, rheumatoid arthritis, psoriasis, psoriasis in combination with psoriatic arthritis, ulcerative colitis, Crohn's disease, vasculitis, Behcet's disease, ankylosing spondylitis, asthma, chronic obstructive pulmonary disorder (COPD), idiopathic pulmonary fibrosis (IPF), restenosis, diabetes, anemia, pain, a Crohn's disease-related disorder, juvenile rheumatoid arthritis (JRA), a hepatitis C virus infection, psoriatic arthritis, and chronic plaque psoriasis.

63. The method of claim 61, wherein the inflammatory disorder is selected from the group consisting of rheumatoid arthritis, rheumatoid spondylitis, osteoarthritis, gouty arthritis, allergy, multiple sclerosis, autoimmune diabetes, autoimmune uveitis, and nephritic syndrome.

64. A method for reducing expression levels of IL-17 receptor in vivo, comprising: administering to a subject a composition comprising the oligonucleotide of any one of claims 1-25 or the nanostructure of any one of claims 26-44 in an effective amount to reduce IL-17 receptor levels in vivo.

65. The mASO-SNA of any one of claims 46-54, wherein the first gene, the second gene, and the third gene are associated with a target pathway.

66. The mASO-SNA of any one of claims 46-54, wherein the first gene and the second gene are associated with different target pathways.

67. The mASO-SNA of any one of claims 46-54, wherein the first gene, the second gene and the third gene are associated with different target pathways.

68. The mASO-SNA of any one of claims 46-51, wherein the first gene is an interleukin-4 receptor (IL-4R).

69. The mASO-SNA of any one of claims 46-53, wherein the second gene is interleukin-1 beta (IL-1).

70. The mASO-SNA of any one of claims 46-54, wherein the third gene is connective tissue growth factor (CTGF).

71. The mASO-SNA of any one of claims 46-54, wherein the first gene, the second gene, and the third gene are present in an approximate equimolar amount in the oligonucleotide shell.

72. A pharmaceutical composition, comprising a stable self-assembling nanostructure, wherein the self-assembling nanostructure comprises a core having an oligonucleotide shell comprised of an antisense oligonucleotide 18 to 21 linked nucleosides in length targeted to interleukin 17 receptor (IL-17R) positioned on the exterior of the core.

73. The pharmaceutical composition of claim 72, wherein the antisense oligonucleotide is 18 nucleotides in length.

74. The pharmaceutical composition of claim 72 or 73, wherein IL-17RA has a sequence of SEQ ID NO: 302.

75. The pharmaceutical composition of any one of claims 72-74, wherein less than all of the internucleoside linkages are phosphodiester.

76. The pharmaceutical composition of any one of claims 72-74, wherein the antisense oligonucleotide has phosphorothioate internucleoside linkages.

77. The pharmaceutical composition of claim 76, wherein less than all of the internucleoside linkages are phosphorothioate.

78. The pharmaceutical composition of any one of claims 72-77, wherein the antisense oligonucleotide has 2O methyl modifications.

79. The pharmaceutical composition of claim 78, wherein less than all of the nucleotides include a 2O methyl modification.

80. The pharmaceutical composition of claim 72, wherein the antisense oligonucleotide has 17 internucleoside linkages and wherein 6 central internucleoside linkages are phosphorothioate.

81. The pharmaceutical composition of any one of claims 72-80, wherein the antisense oligonucleotide has a nucleobase sequence complementary to a sequence comprising at least 8 contiguous nucleobases of a sequence recited in SEQ ID NO: 302.

82. The pharmaceutical composition of claim 81, wherein the antisense oligonucleotide is selected from the group consisting of mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA/isp18//isp18//3CholTEG/(SEQ ID NO: 225); mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288); and mGmUmAmGmGmGmCmGmUG*T*G*T*G*G*mGmUmC/isp18//isp18//3CholTEG/(SEQ ID NO: 291) whereinrefers to a phosphodiester bond, * refers to a phosphorothioate bond, and m refers to a 0 methyl.

83. The pharmaceutical composition of any one of claims 72-82, wherein the pharmaceutical composition comprises a gel vehicle.

84. The pharmaceutical composition of any one of claims 72-82, wherein the pharmaceutical composition comprises one or more of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), diethylene glycol monoethyl ether (Transcutol P), glycerin, hydroxyethyl cellulose, methylparaben, propylparaben, disodium EDTA, sodium metabisulfite and water.

85. The pharmaceutical composition of claim 84, wherein the pharmaceutical composition comprises at least 0.00007% mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288), at least 0.0003801% DOPC, at least 25% diethylene glycol monoethyl ether (Transcutol P), at least 5% glycerin, at least 1% hydroxyethyl cellulose, at least 0.15% methylparaben, at least 0.05% propylparaben, at least 0.1% disodium EDTA, at least 0.2% sodium metabisulfite, and at least 68.5% water.

86. The pharmaceutical composition of claim 84, wherein the pharmaceutical composition comprises at least 0.007% mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288), at least 0.03801% DOPC, at least 25% diethylene glycol monoethyl ether (Transcutol P), at least 5% glycerin, at least 1% hydroxyethyl cellulose, at least 0.15% methylparaben, at least 0.05% propylparaben, at least 0.1% disodium EDTA, at least 0.2% sodium metabisulfite, and at least 68.45% water.

87. The pharmaceutical composition of claim 84, wherein the pharmaceutical composition comprises at least 0.01419% mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288), at least 0.2655% DOPC, at least 25% diethylene glycol monoethyl ether (Transcutol P), at least 5% glycerin, at least 1% hydroxyethyl cellulose, at least 0.15% methylparaben, at least 0.05% propylparaben, at least 0.1% disodium EDTA, at least 0.2% sodium metabisulfite, and at least 68.2% water.

88. The pharmaceutical composition of claim 84, wherein the pharmaceutical composition comprises at least 0.1419% mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288), at least 2.655% DOPC, at least 25% diethylene glycol monoethyl ether (Transcutol P), at least 5% glycerin, at least 1% hydroxyethyl cellulose, at least 0.15% methylparaben, at least 0.05% propylparaben, at least 0.1% disodium EDTA, at least 0.2% sodium metabisulfite, and at least 65.7% water.

89. The pharmaceutical composition of claim 84, wherein the pharmaceutical composition comprises at least 1.419% mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288), at least 26.55% DOPC, at least 25% diethylene glycol monoethyl ether (Transcutol P), at least 5% glycerin, at least 1% hydroxyethyl cellulose, at least 0.15% methylparaben, at least 0.05% propylparaben, at least 0.1% disodium EDTA, at least 0.2% sodium metabisulfite, and at least 40.5% water.

90. A pharmaceutical composition, comprising the oligonucleotide of any one of claims 1-25.

91. The pharmaceutical composition of claim 90, wherein the pharmaceutical composition further comprises a gel vehicle.

92. The pharmaceutical composition of claim 90 or 91, wherein the pharmaceutical composition comprises one or more of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), diethylene glycol monoethyl ether (Transcutol P), glycerin, hydroxyethyl cellulose, methylparaben, propylparaben, disodium EDTA, sodium metabisulfite and water.

93. A pharmaceutical composition, comprising the mASO-SNA of any one of claims 46-54.

94. The pharmaceutical composition of claim 93, wherein the pharmaceutical composition further comprises a gel vehicle.

95. The pharmaceutical composition of claim 93 or 94, wherein the pharmaceutical composition comprises one or more of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), diethylene glycol monoethyl ether (Transcutol P), glycerin, hydroxyethyl cellulose, methylparaben, propylparaben, disodium EDTA, sodium metabisulfite and water.

96. A method for treating a disorder, comprising: administering to a subject having a disorder a pharmaceutical composition comprising a multiplex antisense oligonucleotide spherical nucleic acid (mASO-SNA), comprising a core having an oligonucleotide shell comprised of an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a first gene and an antisense oligonucleotide 10 to 30 linked nucleosides in length targeted to a second gene, wherein the core is a solid surrounded by a lipid bilayer or a liposome or lipoplex complex core and the oligonucleotide shell is positioned on the exterior of the core in an effective amount to treat the disorder.

97. The method of claim 96, wherein the pharmaceutical composition further comprises a gel vehicle.

98. The method of claim 96, wherein the pharmaceutical composition comprises one or more of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), diethylene glycol monoethyl ether (Transcutol P), glycerin, hydroxyethyl cellulose, methylparaben, propylparaben, disodium EDTA, sodium metabisulfite and water.

99. The method of any one of claims 96-98, wherein the disorder is an inflammatory disorder.

100. The method of any one of claims 96-99, wherein the mASO-SNA produces simultaneous mRNA knock-down of the first and second gene.

101. The method of any one of claims 96-100, wherein the first gene and the second gene are associated with a target pathway.

102. The method of claim 101, wherein the mASO-SNA produces additive knock-down of the target pathway.

103. The method of any one of claims 96-102, wherein the disorder is psoriasis.

104. A method for treating an inflammatory disorder, comprising: administering to a subject having an inflammatory disorder a pharmaceutical composition comprising the the oligonucleotide of any one of claims 1-25, the nanostructure of any one of claims 26-44, or the mASO-SNA of any one of claims 46-54 in an effective amount to treat the inflammatory disorder.

105. The method of claim 104, wherein the pharmaceutical composition further comprises a gel vehicle.

106. The method of claim 104, wherein the pharmaceutical composition comprises one or more of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), diethylene glycol monoethyl ether (Transcutol P), glycerin, hydroxyethyl cellulose, methylparaben, propylparaben, disodium EDTA, sodium metabisulfite and water.

107. The method of any one of claims 104-106, wherein the inflammatory disorder is selected from the group consisting of an autoimmune disease, an infectious disease, transplant rejection or graft-versus-host disease, malignancy, a pulmonary disorder, an intestinal disorder, a cardiac disorder, sepsis, a spondyloarthropathy, a metabolic disorder, anemia, pain, a hepatic disorder, a skin disorder, a nail disorder, rheumatoid arthritis, psoriasis, psoriasis in combination with psoriatic arthritis, ulcerative colitis, Crohn's disease, vasculitis, Behcet's disease, ankylosing spondylitis, asthma, chronic obstructive pulmonary disorder (COPD), idiopathic pulmonary fibrosis (IPF), restenosis, diabetes, anemia, pain, a Crohn's disease-related disorder, juvenile rheumatoid arthritis (JRA), a hepatitis C virus infection, psoriatic arthritis, and chronic plaque psoriasis.

108. The method of any one of claims 104-106, wherein the inflammatory disorder is selected from the group consisting of rheumatoid arthritis, rheumatoid spondylitis, osteoarthritis, gouty arthritis, allergy, multiple sclerosis, autoimmune diabetes, autoimmune uveitis, and nephritic syndrome.

109. A method for reducing expression levels of IL-17 receptor in vivo, comprising: administering to a subject a pharmaceutical composition comprising the oligonucleotide of any one of claims 1-25, the nanostructure of any one of claims 26-44, or the mASO-SNA of any one of claims 46-54 in an effective amount to reduce IL-17 receptor levels in vivo.

110. The method of claim 109, wherein the subject is a mammal.

111. The method of claim 109, wherein the subject is human.

112. The method of claims 109-111, wherein the pharmaceutical composition is in contact with a cell in the subject for at least 24 hours.

113. The method of any one of claims 109-112, wherein the pharmaceutical composition is a topical pharmaceutical composition.

114. A method for reducing expression levels of IL-17 receptor (IL-17R) in vitro, comprising: contacting a cell with the oligonucleotide of any one of claims 1-25, the nanostructure of any one of claims 26-44, or the mASO-SNA of any one of claims 46-54 in an effective amount to reduce IL-17R levels in vitro.

115. The method of claim 114, wherein the cell is a human foreskin keratinocyte (HFK).

116. The method of claim 114 or 115, wherein the cell is contacted with the oligonucleotide, the nanostructure, or the mASO-SNA at a concentration of 1 nM, 10 nM, 100 nM, or 1000 nM.

117. The method of any one of claims 114-116, wherein the cell is contacted with the oligonucleotide, the nanostructure, or the mASO-SNA for 24 hours.

Description

BRIEF DESCRIPTION OF DRAWINGS

[0077] The accompanying drawings are not intended to be drawn to scale. In the drawings, each identical or nearly identical component that is illustrated in various figures is represented by a like numeral. For purposes of clarity, not every component may be labeled in every drawing. In the drawings:

[0078] FIG. 1 depicts in vitro IL-17RA mRNA knockdown using targeted SNAs. IL-17RA mRNA expression is decreased in HFK cells treated with SNAs presenting an ASO sequence targeting IL-17RA. Cells treated with control SNAs do not demonstrate an appreciable decrease in IL-17RA mRNA expression.

[0079] FIG. 2 shows IL-17RA mRNA knockdown using topically applied targeted SNAs in the human skin equivalent, EpiDerm-FT. IL-17RA mRNA expression is decreased in human skin equivalent tissues treated topically with SNAs presenting either ASO IL17RA_219 or ASO IL17RA_282 for 48 hours. Tissues treated with SNAs presenting the control ASO do not demonstrate an appreciable decrease in IL-17RA mRNA expression as measured by qRT-PCR. Data shown are representative of two independent experiments performed.

[0080] FIG. 3 shows ex vivo IL-17RA mRNA knockdown using topically applied targeted SNAs in human skin explants. IL-17RA mRNA expression is decreased in human skin explant biopsies treated topically with SNAs presenting either ASO IL17RA_219 or ASO IL17RA_282 for 96 hours. Biopsies treated with SNAs presenting the control ASO do not demonstrate an appreciable decrease in IL-17RA mRNA expression as measured by qRT-PCR.

[0081] FIG. 4 shows TNF mRNA knockdown using a mixture of SNAs. TNF mRNA expression is decreased in HFK cells treated with a mixture of anti-TNF-SNAs and anti-IL17RA-SNAs. Cells treated with Control-SNAs do not demonstrate an appreciable decrease in TNF mRNA levels. Data shown are representative of two independent experiments performed.

[0082] FIG. 5 shows IL17RA mRNA knockdown using a mixture of SNAs. IL17RA mRNA expression is decreased in HFK cells treated with a mixture of anti-TNF-SNAs and anti-IL17RA-SNAs. Cells treated with Control-SNAs do not demonstrate an appreciable decrease in TNF mRNA levels. Data shown are representative of two independent experiments performed.

[0083] FIGS. 6A-6D show configurations of multiplexed SNAs. Liposomes were surface-functionalized in the following configurations: (FIG. 6A) 33% TNF-ASO (A) and 66% control (D); (FIG. 6B) 33% IL17RA-ASO (B) and 66% control (D); (FIG. 6C) 33% TNF-ASO (A), 33% IL17RA-ASO (B), and 33% control (D); (FIG. 6D) 100% control (D).

[0084] FIG. 7 shows a comparison of TNF mRNA knockdown using multiplexed SNAs. TNF mRNA expression is decreased in HFK cells treated with anti-TNF-SNAs and multiplexed SNAs containing anti-TNF and anti-IL17RA ASOs. Cells treated with anti-IL17RA-SNAs do not demonstrate an appreciable decrease in TNF mRNA levels. Data shown are representative of two independent experiments performed.

[0085] FIG. 8 shows a comparison of IL17RA mRNA knockdown using multiplexed SNAs demonstrate additive knockdown effects. IL17RA mRNA expression is decreased in HFK cells treated with anti-IL17RA-SNAs and multiplexed SNAs containing anti-TNF and anti-IL17RA ASOs. Cells treated with anti-TNF-SNAs demonstrate a slight decrease potentially due to the related biological signaling pathways of TNF and IL17RA. Greater IL17RA mRNA knockdown is observed when cells are treated with anti-IL17RA-SNAs. Multiplexed SNAs targeting both TNF and IL17RA have an additive effect and show greater knockdown of IL17RA mRNA than when SNAs targeting only anti-TNF or anti-IL17RA are used alone. Data shown are representative of at least two independent experiments performed.

[0086] FIG. 9 depicts inhibition of IL-17RA mRNA expression. The graph shows IL-17RA mRNA expression in healthy human skin explants after 24 hours treatment, as measured by qRT-PCR (percent of untreated SEM). Each drug product treatment group, n=9 samples. Untreated group, n=8 samples. One-way ANOVA, 31 DF, p=0.0011 (0.007% versus untreated) and **** p<0.0001 versus 0% gel.

[0087] FIG. 10 depicts inhibition of IL-17RA protein expression. The graph shows IL-17RA protein expression in healthy human skin explants after 24 hours treatment with IL17RA_282 in formulation described in Table 3, as measured by western blot (percent of untreated). Pooled samples for each group.

[0088] FIG. 11 shows inhibition of IL-17RA mRNA expression. * p<0.05; ** p<0.01; **** p<0.0001 compared to vehicle. A one sample t-test was used.

[0089] FIGS. 12A-12D show configurations of multiplexed SNAs. Liposome were surface functionalized in the following configurations: monoplex SNA (FIG. 12A); multiplex SNA containing two targeted antisense oligonucleotides (FIG. 12B); multiplex SNA containing three targeted antisense oligonucleotides (FIG. 12C); non-targeted control SNA (FIG. 12D).

[0090] FIG. 13 shows inhibition of IL4R mRNA in cells treated with various multiplex SNA configurations. Liposome were surface functionalized various targeted antisense oligonucleotide(s) or control oligonucleotide. The expression of IL4R mRNA is reduced noticeably when cells are treated with SNAs that target IL4R. Control SNA and SNAs functionalized with non-targeting oligonucleotides do not reduce IL4R mRNA expression to the same extent.

[0091] FIG. 14 shows inhibition of IL1b mRNA in cells treated with various multiplex SNA configurations. Liposome were surface functionalized various targeted antisense oligonucleotide(s) or control oligonucleotide. The expression of IL1b mRNA is reduced noticeably when cells are treated with SNAs that target IL1b. Control SNA and SNAs functionalized with non-targeting oligonucleotides do not reduce IL1b mRNA expression to the same extent.

[0092] FIG. 15 shows inhibition of CTGF mRNA in cells treated with various multiplex SNA configurations. Liposome were surface functionalized with various targeted antisense oligonucleotide(s) or control oligonucleotide. The expression of CTGF mRNA is reduced noticeably when cells are treated with SNAs that target CTGF. Control SNA and SNAs functionalized with non-targeting oligonucleotides do not reduce CTGF mRNA expression to the same extent.

DETAILED DESCRIPTION

[0093] The invention in some aspects relates to antisense inhibitors of a cell signaling protein receptor involved in systemic inflammation, Interleukin 17 receptor (IL-17RA). IL-17 and its target receptor IL-17RA play an important role in psoriasis. IL-17 elicits its effects by binding IL-17RA, the latter of which is expressed almost exclusively in keratinocytes within the epidermis. Antisense technology is a useful means for reducing the expression of specific gene products by targeting a messenger RNA (mRNA) and preventing translation of the mRNA. However, the selection of specific therapeutically functional antisense oligonucleotides (ASOs) can be challenging. Further, ASO that are therapeutically active in a linear form do not necessarily retain activity when formulated as a nanoparticle or other type of three dimensional presentation format.

[0094] It has been discovered in aspects of the invention that Spherical Nucleic Acids (SNAs) surface functionalized with antisense oligonucleotides (ASOs) having appropriate structural properties can mediate highly effective gene knockdown of the intended target mRNA. For example, it is demonstrated herein that IL-17RA expression can be inhibited through the use of SNAs targeting human IL-17RA (anti-IL17RA-SNAs) (see for instance GeneBank accession number NM_014339.6) mRNA in primary human foreskin keratinocytes (HFK) with no associated toxicity or immune-stimulatory effects. Further, it is shown that anti-IL-17RA SNAs inhibit mRNA expression in a human skin equivalent model and human skin explants. In some embodiments, the response the anti-IL-17RA SNAs inhibit IL-17RA mRNA expression in a dose-dependent manner. As described herein, the oligonucleotides arranged in an SNA geometry exhibit enhanced penetration and increased cellular uptake.

[0095] It has also been discovered that multiplex SNAs having different ASOs directed at different therapeutic targets can produce significant target knockdown and therapeutic effects. The ability to load specific amounts of different ASOs on the surface of an SNA in a way such that they do not interfere with the activity of the other ASOs was unexpected. As shown in the Examples, when anti-IL-17RA-SNAs were mixed with anti-TNF-SNAs and co-administered to cells, simultaneous mRNA knockdown of each targeted gene was achieved. Additionally when SNAs presenting two or more ASO sequences each targeting different mRNAs on the same particle were administered to cells the simultaneous mRNA knockdown of each gene targeted using a single particle in the same cell was achieved. These SNAs are referred to as multiplexed ASO-SNAs (mASO-SNA). Furthermore, when mASO-SNAs were multiplexed with ASOs targeting two mRNAs of genes involved in a related biological pathway, additive knockdown effects were observed. Not only did the co-presentation of the two ASOs not interfere with the activity of the other co-presented ASO but when targeting a common pathway the therapeutic effect observed with the mASO-SNAs was greater than that observed with either ASO-SNA alone.

[0096] The invention in some aspects relates to compositions for reducing IL-17RA and methods for treating an inflammatory disorder using those compositions. Highly effective IL-17RA inhibitors have been identified according to aspects of the invention. The IL-17RA inhibitors are nucleic acid based antisense compositions. The term IL-17RA refers to a receptor for the cytokine IL-17.

[0097] An IL-17RA inhibitor as used herein refers to a nucleic acid based agent which interferes with IL-17RA activity. In particular, the IL-17RA antisense inhibitors or IL-17RA antisense oligonucleotides of the invention reduce the expression of the IL-17RA gene. By reducing expression of the IL-17RA gene the endogenous IL-17 is not able to promote cell signaling through its interaction with the receptor. When IL-17RA is available for binding to IL-17, IL17RA is activated leading to induction of expression of inflammatory chemokines and cytokines such as CXCL1, CXCL8/IL8 and IL6. These signaling cascades can be blocked using the ASO-SNA of the invention.

[0098] The IL17RA inhibitors of the invention are antisense nucleic acids. Antisense nucleic acids typically include modified or unmodified RNA, DNA, or mixed polymer nucleic acids, and primarily function by specifically binding to matching sequences resulting in modulation of peptide synthesis. Antisense nucleic acids bind to target RNA by Watson Crick base-pairing and block gene expression by preventing ribosomal translation of the bound sequences either by steric blocking or by activating RNase H enzyme. Antisense molecules may also alter protein synthesis by interfering with RNA processing or transport from the nucleus into the cytoplasm.

[0099] In some embodiments, the invention relates to compositions for reducing interleukin-4 receptor (IL-4R) (see e.g., GenBank: NM_000418 (SEQ ID NO: 306)) and methods for treating an inflammatory disorder using those compositions. Highly effective IL-4R inhibitors have been identified according to aspects of the invention. The IL-4R inhibitors are nucleic acid based antisense compositions. The term IL-4R refers to a receptor for the cytokine IL-4 or IL-13.

[0100] An IL-4R inhibitor as used herein refers to a nucleic acid based agent which interferes with IL-4R activity. In particular, the IL-4R antisense inhibitors or IL-4R antisense oligonucleotides of the invention reduce the expression of the IL-4R gene. In some embodiments, the antisense oligonucleotide is 18 nucleotides in length. In other embodiments, IL-17RA has a sequence of SEQ ID NO: 302. By reducing expression of the IL-4R gene the endogenous IL-4 or IL-13 is not able to promote cell signaling through its interaction with the receptor. When IL-4R is available for binding to IL-4 or IL-13, IL-4R is activated leading to coupling to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells (Keegan et al., Cell (1994) 76:811-820). These signaling cascades can be blocked using the ASO-SNA of the invention.

[0101] The IL-4R inhibitors of the invention are antisense nucleic acids. Antisense nucleic acids typically include modified or unmodified RNA, DNA, or mixed polymer nucleic acids, and primarily function by specifically binding to matching sequences resulting in modulation of peptide synthesis. Antisense nucleic acids bind to target RNA by Watson Crick base-pairing and block gene expression by preventing ribosomal translation of the bound sequences either by steric blocking or by activating RNase H enzyme. Antisense molecules may also alter protein synthesis by interfering with RNA processing or transport from the nucleus into the cytoplasm.

[0102] In some embodiments, the invention relates to compositions for reducing interleukin-1 beta (IL-1) (see e.g., GenBank: NM_000576 (SEQ ID NO: 307)) and methods for treating an inflammatory disorder using those compositions. Highly effective IL-1 inhibitors have been identified according to aspects of the invention. The IL-1 inhibitors are nucleic acid based antisense compositions. The term IL-1 refers to a proinflammatory cytokine that was initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.

[0103] An IL-1 inhibitor as used herein refers to a nucleic acid based agent which interferes with IL-1 activity. In particular, the IL-1 antisense inhibitors or IL-1 antisense oligonucleotides of the invention reduce the expression of the IL-1 gene. By reducing expression of the IL-1 gene, signaling is reduced or not carried out (Van Damme et al., Nature (1985) 314:266-268; Piccioli et al., Semin Immunol (2013) 25(6):425-9). The signaling cascades that involve IL-1 can be blocked using the ASO-SNA of the invention.

[0104] The IL-1 inhibitors of the invention are antisense nucleic acids. Antisense nucleic acids typically include modified or unmodified RNA, DNA, or mixed polymer nucleic acids, and primarily function by specifically binding to matching sequences resulting in modulation of peptide synthesis. Antisense nucleic acids bind to target RNA by Watson Crick base-pairing and block gene expression by preventing ribosomal translation of the bound sequences either by steric blocking or by activating RNase H enzyme. Antisense molecules may also alter protein synthesis by interfering with RNA processing or transport from the nucleus into the cytoplasm.

[0105] In some embodiments, the invention relates to compositions for reducing connective tissue growth factor (CTGF) (see e.g., GenBank: NM_001901 (SEQ ID NO: 308)) and methods for treating a disorder (e.g., atherosclerosis, pulmonary and renal fibrotic disorders and cancer) using those compositions. Highly effective CTGF inhibitors have been identified according to aspects of the invention. The CTGF inhibitors are nucleic acid based antisense compositions. The term CTGF refers to a connective tissue mitoattractant secreted by cells (e.g., vascular endothelial cells) that, among other things, promotes proliferation and differentiation of chondrocytes; mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells; and enhances fibroblast growth factor-induced DNA synthesis.

[0106] An CTGF inhibitor as used herein refers to a nucleic acid based agent which interferes with CTGF activity. In particular, the CTGF antisense inhibitors or CTGF antisense oligonucleotides of the invention reduce the expression of the CTGF gene. By reducing expression of the CTGF gene, cell signaling is not promoted. For instance, CTGF interacts with growth factors, surface receptors and matrix components, with important roles in embryonic development and the maintenance of normal cell and connective tissue function, due to its widespread expression. CTGF is also important for tissue repair following injury, and has been implicated in common diseases including atherosclerosis, pulmonary and renal fibrotic disorders and cancer (de Winter et al., Growth Factors (2008) 26(2):80-91). The signaling cascades that CTGF is involved in can be blocked using the ASO-SNA of the invention.

[0107] The CTGF inhibitors of the invention are antisense nucleic acids. Antisense nucleic acids typically include modified or unmodified RNA, DNA, or mixed polymer nucleic acids, and primarily function by specifically binding to matching sequences resulting in modulation of peptide synthesis. Antisense nucleic acids bind to target RNA by Watson Crick base-pairing and block gene expression by preventing ribosomal translation of the bound sequences either by steric blocking or by activating RNase H enzyme. Antisense molecules may also alter protein synthesis by interfering with RNA processing or transport from the nucleus into the cytoplasm.

[0108] As used herein, the term antisense nucleic acid or antisense oligonucleotide describes a nucleic acid that hybridizes under physiological conditions to DNA comprising a particular gene or to an mRNA transcript of that gene in this case IL17RA and, thereby, inhibits the transcription of that gene and/or the translation of that mRNA. The antisense molecules are designed so as to interfere with transcription or translation of a target gene upon hybridization with the target gene or transcript. Those skilled in the art will recognize that the exact length of the antisense oligonucleotide and its degree of complementarity with its target will depend upon the specific target selected, including the sequence of the target and the particular bases which comprise that sequence.

[0109] Inhibition of gene expression refers to the absence or observable decrease in the level of protein and/or mRNA product from a target gene, such as the IL17RA gene. Specificity refers to the ability to inhibit the target gene without manifest effects on other genes of the cell. The consequences of inhibition can be confirmed by examination of the outward properties of the cell or organism or by biochemical techniques such as RNA solution hybridization, nuclease protection, Northern hybridization, reverse transcription, gene expression monitoring with a microarray, antibody binding, enzyme linked immunosorbent assay (ELISA), Western blotting, radioimmunoassay (RIA), other immunoassays, and fluorescence activated cell analysis (FACS).

[0110] The antisense oligonucleotides of the invention inhibit IL17RA expression. Depending on the assay, quantitation of the amount of gene expression allows one to determine a degree of inhibition which is greater than 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% as compared to a cell not treated according to the present invention. As an example, the efficiency of inhibition may be determined by assessing the amount of gene product in the cell.

[0111] The ASOs described herein include bioequivalent compounds, salts and prodrugs thereof. The term bioequivalent compounds, including pharmaceutically acceptable salts and prodrugs as used herein refers to antisense oligonucleotides having the same primary structure as the antisense oligonucleotide of interest, but including salt forms or structures which can be cleaved or modified to have the same type of biological effect as the antisense oligonucleotide of interest. This is intended to encompass any pharmaceutically acceptable salts, esters, or salts of such esters, or any other compound which, upon administration to an animal including a human, is capable of providing (directly or indirectly) the biologically active metabolite or residue thereof.

[0112] Pharmaceutically acceptable salts are physiologically and pharmaceutically acceptable salts of the nucleic acids of the invention: i.e., salts that retain the desired biological activity of the compound of interest and do not impart undesired toxicological effects thereto. Pharmaceutically acceptable salts include but are not limited to (a) salts formed with cations such as sodium, potassium, ammonium, magnesium, calcium, polyamines such as spermine and spermidine, etc.; (b) acid addition salts formed with inorganic acids, for example hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid and the like; (c) salts formed with organic acids such as, for example, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, palmitic acid, alginic acid, polyglutamic acid, naphthalenesulfonic acid, methanesulfonic acid, p-toluenesulfonic acid, naphthalenedisulfonic acid, polygalacturonic acid, and the like; and (d) salts formed from elemental anions such as chlorine, bromine, and iodine.

[0113] The compounds of the invention may also be prepared to be delivered in a prodrug form. A prodrug is a therapeutic agent that is prepared in an inactive form that is converted to an active form (i.e., drug) within the body or cells thereof by the action of endogenous enzymes or other chemicals and/or conditions.

[0114] The antisense oligonucleotides of the invention are IL17RA antisense oligonucleotides. An antisense IL17RA oligonucleotide refers to a compound having a sequence of nucleotide bases and a subunit-to-subunit backbone that allows the antisense oligonucleotide to hybridize to a IL17RA target mRNA sequence typically by Watson-Crick base pairing, to form an RNA:oligomer heteroduplex within the target sequence.

[0115] The specific hybridization of an antisense oligonucleotide with its target nucleic acid, IL17RA mRNA, interferes with the normal function of the IL17RA mRNA. This modulation of function of a target nucleic acid by compounds which specifically hybridize to it is generally referred to as antisense. The functions of DNA to be interfered with include replication and transcription. The functions of RNA to be interfered with include all vital functions such as, for example, translocation of the RNA to the site of protein translation, translation of protein from the RNA, splicing of the RNA to yield one or more mRNA species, and catalytic activity which may be engaged in or facilitated by the RNA. The overall effect of such interference with target nucleic acid function is modulation of the expression of IL17RA protein. In the context of the present invention, modulation means a decrease or inhibition in the expression of a gene.

[0116] An antisense oligonucleotide specifically hybridizes to a target polynucleotide if the oligonucleotide hybridizes to the IL17RA target under physiological conditions, with a thermal melting temperature (Tm) substantially greater than 37 C., preferably at least 45 C., and typically 50 C.-80 C. or higher. Such hybridization preferably corresponds to stringent hybridization conditions, selected to be about 10 C., and preferably about 50 C. lower than the Tm for the specific sequence at a defined ionic strength and pH. At a given ionic strength and pH, the Tm is the temperature at which 50% of a target sequence hybridizes to a complementary polynucleotide.

[0117] Polynucleotides are described as complementary to one another when hybridization occurs in an antiparallel configuration between two single-stranded polynucleotides. A double-stranded polynucleotide can be complementary to another polynucleotide, if hybridization can occur between one of the strands of the first polynucleotide and the second. Complementarity (the degree that one polynucleotide is complementary with another) is quantifiable in terms of the proportion of bases in opposing strands that are expected to form hydrogen bonds with each other, according to generally accepted base-pairing rules. An antisense compound may be complementary to a target region of a target transcript even if the two bases sequences are not 100% complementary, as long as the heteroduplex structure formed between the compound and transcript has the desired Tm stability.

[0118] Identifying an antisense oligonucleotide that targets a particular nucleic acid may be a multistep process. The process usually begins with the identification of a nucleic acid sequence whose function is to be modulated. This may be, for example, a cellular gene (or mRNA transcribed from the gene) whose expression is associated with a particular inflammatory disorder or disease state. The targeting process also includes determination of a site or sites within this IL17RA gene for the antisense interaction to occur such that the desired effect, e.g., detection or modulation of expression of the protein, will result.

[0119] In some embodiments, antisense oligonucleotides are designed to target human Interleukin 17 receptor (IL-17RA), for instance, the nucleotide sequence of SEQ ID NO: 302, corresponding to interleukin 17 receptor A (IL-17RA), set forth below. Human IL-17RA cDNA sequence has been disclosed in Genbank accession number NM_014339.

TABLE-US-00002 (SEQIDNO:302) 1 ctgggcccgggctggaagccggaagcgagcaaagtggagccgactcgaactccaccgcgg 61 aaaagaaagcctcagaacgttcgttcgctgcgtccccagccggggccgagccctccgcga 121 cgccagccgggccatgggggccgcacgcagcccgccgtccgctgtcccggggcccctgct 181 ggggctgctcctgctgctcctgggcgtgctggccccgggtggcgcctccctgcgactcct 241 ggaccaccgggcgctggtctgctcccagccggggctaaactgcacggtcaagaatagtac 301 ctgcctggatgacagctggattcaccctcgaaacctgaccccctcctccccaaaggacct 361 gcagatccagctgcactttgcccacacccaacaaggagacctgttccccgtggctcacat 421 cgaatggacactgcagacagacgccagcatcctgtacctcgagggtgcagagttatctgt 481 cctgcagctgaacaccaatgaacgtttgtgcgtcaggtttgagtttctgtccaaactgag 541 gcatcaccacaggcggtggcgttttaccttcagccactttgtggttgaccctgaccagga 601 atatgaggtgaccgttcaccacctgcccaagcccatccctgatggggacccaaaccacca 661 gtccaagaatttccttgtgcctgactgtgagcacgccaggatgaaggtaaccacgccatg 721 catgagctcaggcagcctgtgggaccccaacatcaccgtggagaccctggaggcccacca 781 gctgcgtgtgagcttcaccctgtggaacgaatctacccattaccagatcctgctgaccag 841 ttttccgcacatggagaaccacagttgctttgagcacatgcaccacatacctgcgcccag 901 accagaagagttccaccagcgatccaacgtcacactcactctacgcaaccttaaagggtg 961 ctgtcgccaccaagtgcagatccagcccttcttcagcagctgcctcaatgactgcctcag 1021 acactccgcgactgtttcctgcccagaaatgccagacactccagaaccaattccggacta 1081 catgcccctgtgggtgtactggttcatcacgggcatctccatcctgctggtgggctccgt 1141 catcctgctcatcgtctgcatgacctggaggctagctgggcctggaagtgaaaaatacag 1201 tgatgacaccaaatacaccgatggcctgcctgcggctgacctgatccccccaccgctgaa 1261 gcccaggaaggtctggatcatctactcagccgaccaccccctctacgtggacgtggtcct 1321 gaaattcgcccagttcctgctcaccgcctgcggcacggaagtggccctggacctgctgga 1381 agagcaggccatctcggaggcaggagtcatgacctgggtgggccgtcagaagcaggagat 1441 ggtggagagcaactctaagatcatcgtcctgtgctcccgcggcacgcgcgccaagtggca 1501 ggcgctcctgggccggggggcgcctgtgcggctgcgctgcgaccacggaaagcccgtggg 1561 ggacctgttcactgcagccatgaacatgatcctcccggacttcaagaggccagcctgctt 1621 cggcacctacgtagtctgctacttcagcgaggtcagctgtgacggcgacgtccccgacct 1681 gttcggcgcggcgccgcggtacccgctcatggacaggttcgaggaggtgtacttccgcat 1741 ccaggacctggagatgttccagccgggccgcatgcaccgcgtaggggagctgtcggggga 1801 caactacctgcggagcccgggcggcaggcagctccgcgccgccctggacaggttccggga 1861 ctggcaggtccgctgtcccgactggttcgaatgtgagaacctctactcagcagatgacca 1921 ggatgccccgtccctggacgaagaggtgtttgaggagccactgctgcctccgggaaccgg 1981 catcgtgaagcgggcgcccctggtgcgcgagcctggctcccaggcctgcctggccataga 2041 cccgctggtcggggaggaaggaggagcagcagtggcaaagctggaacctcacctgcagcc 2101 ccggggtcagccagcgccgcagcccctccacaccctggtgctcgccgcagaggagggggc 2161 cctggtggccgcggtggagcctgggcccctggctgacggtgccgcagtccggctggcact 2221 ggcgggggagggcgaggcctgcccgctgctgggcagcccgggcgctgggcgaaatagcgt 2281 cctcttcctccccgtggaccccgaggactcgccccttggcagcagcacccccatggcgtc 2341 tcctgacctccttccagaggacgtgagggagcacctcgaaggcttgatgctctcgctctt 2401 cgagcagagtctgagctgccaggcccaggggggctgcagtagacccgccatggtcctcac 2461 agacccacacacgccctacgaggaggagcagcggcagtcagtgcagtctgaccagggcta 2521 catctccaggagctccccgcagccccccgagggactcacggaaatggaggaagaggagga 2581 agaggagcaggacccagggaagccggccctgccactctctcccgaggacctggagagcct 2641 gaggagcctccagcggcagctgcttttccgccagctgcagaagaactcgggctgggacac 2701 gatggggtcagagtcagaggggcccagtgcatgagggcggctccccagggaccgcccaga 2761 tcccagctttgagagaggagtgtgtgtgcacgtattcatctgtgtgtacatgtctgcatg 2821 tgtatatgttcgtgtgtgaaatgtaggctttaaaatgtaaatgtctggattttaatccca 2881 ggcatccctcctaacttttctttgtgcagcggtctggttatcgtctatccccaggggaat 2941 ccacacagcccgctcccaggagctaatggtagagcgtccttgaggctccattattcgttc 3001 attcagcatttattgtgcacctactatgtggcgggcatttgggataccaagataaattgc 3061 atgcggcatggccccagccatgaaggaacttaaccgctagtgccgaggacacgttaaacg 3121 aacaggatgggccgggcacggtggctcacgcctgtaatcccagcacactgggaggccgag 3181 gcaggtggatcactctgaggtcaggagtttgagccagcctggccaacatggtgaaacccc 3241 atctccactaaaaatagaaaaattagccgggcatggtgacacatgcctgtagtcctagct 3301 acttgggaggctgaggcaggagaattgcttgaatctgggaggcagaggttgcagtgagcc 3361 gagattgtgccattgcactgcagcctggatgacagagcgagactctatctcaaaaaaaaa 3421 aaaaaaaaaagatggtcacgcgggatgtaaacgctgaatgggccaggtgcagtggctcat 3481 gcttgtaatcccagcactttgggaaggcgaggcaggtggattgcttgagctcaggagttc 3541 aagaccagcctgggcgacatagtgagacctcatctctacctaaatttttttttagtcagt 3601 catggtggcacatgcctgtagtcccagctactcgggaggctgatgccagatgatcacttg 3661 agcccaggaggtagaggctgcagtgagctataatggtaccattgcaatccagcctgggca 3721 gcagagtgagaccctgtctcaaaaaaaataaaaaagtagaaagatggagtggaagcctgc 3781 ccagggttgtgagcatgcacgggaaaggcacccaggtcaggggggatccccgaggagatg 3841 cctgagctgaaggattgtggttggggaaagcgtagtcccagcaaggaagcagtttgtggg 3901 taagtgctgggaggtgagtggagtgagcttgtcagggagctgctggtggagcctggaggg 3961 gaaggagggaggcagtgagagagatcggggtggggggtggggggatgtcgccagagctca 4021 ggggtggggacagccttgtgcgcatcagtcctgaggcctggggcacctttcgtctgatga 4081 gcctctgcatggagagaggctgagggctaaacacagctggatgtcacctgagttcattta 4141 taggaagagagaaatgtcgaggtgaaacgtaaaagcatctggcaggaaggtgagtctgaa 4201 gccctgcacccgcgttccgactatcagtggggagctgttagcacgtaggattcttcagag 4261 cagctgggctggagctcccctgagctcaggaagccccagggtgcaagggcaaggaaatga 4321 ggggtggtgggtcagtgaagatctgggcagaccttgtgtggggaaggggtgctgctgtga 4381 cttcagggtctgaggtccaaagacagcatttgaaaagaggctctgaagccagtgtttgaa 4441 gaatttgttcctgaagtacctcctgggggtaggctagaggcttctggcttcagggtcctg 4501 aagaacacattgaggtgccgtctgacactggaatagggtgcccttcattcctatgcctga 4561 gtccttaactatatttccaacctccagtgaggaggagaagattcggaaatgtgacaggag 4621 agcaaacaggacagtttgcatgtgtgtgtgcgcacacatacatgtgcgtgaaagattatc 4681 aataaaagtgcataaatttgttgatctggtaagagtttctagcaggaaggtcgagccact 4741 tactgtaggtcaagaagttgctagttgcggagttttttcttgcagttagactttacctag 4801 tggtagcagggccaccaaagctctgtgtcccagatggtgtatggcccataatccacccaa 4861 cagcagcaaaggaccaggcaaaggagaacaggagcagaagcctcccagccactagccttt 4921 tgggctcagtctctccaataatcctggagaggggcttcgttgggtctggacacctaccat 4981 gcattctgtgacctttccctagcttccaataaataactgtttgacgcccagagtacagga 5041 taccacaatgcactcttcctgcgtagagcacatgttcccatctgctcccattcctcagga 5101 accttgaattctagctctgctggcctttgagcccatgccagtaaatgtcctgatgggcat 5161 tgcctactatctccagggcagctgcctttgtcctcctaacagctttattggagtacagtt 5221 cacttaccatacaatccacaattgaccctgcacaatttgatgccggtttagtatagtcac 5281 agttcagcagccatcagcacagtcagtcttagagtttactacccccaaaagaaatccagc 5341 cccccttagtcaccaccccaacctccccatccctaggcacccctaggctactttgatctc 5401 tgtagacttgcctcttctggacatgacatagagaaaggagtcataaattctccaaggtgt 5461 ctgtttcttctttaatgtcattccctgtttctcctcacattccctccccatttcctgggc 5521 ccagtctcacactggtccttgcttaccctaaatgctattaattccatcactctgagtatg 5581 gtgtttgctgtccgctgaatgccaagagcttcaagagtgtgtgtaaataaagccacacct 5641 ttatttttgtattattctgaaccatggctaataaattgtttcaccaagaaatgtctctct 5701 aagaacaggtgccctccacgctgtgcccctcccacctcttcagctcgtctcctgagtgtg 5761 cagaggtggttccggttgggaaagaagcagcggagcatctaaccatgcctgtgtccaggc 5821 cgattatgcacgcagccaccaacaagctcccaactcccgcgtagagtttcatgacttttt 5881 cctgcctactatcttgatcctagttttttttttgttttttttttttttaaggaataatta 5941 ctttgattcaaaaccagtttctcttttctgcataggaaggtccttgaaggtgtttagggt 6001 ctaaaaagggtggtgttcggtctctgaaacatccattcagcagtttgagctgggatctct 6061 gaatgcaagggtatgatggatatacttctttcttgcttttgttgtgttttggttttttgt 6121 ttgtttttaagtcagggtctctctgtcaccaggctgtattacagtggtgcaatcatggct 6181 cactgcagcctcgacctcccaggctcaagccatctttccacctcagcctgccagtggcta 6241 gaactacaggcgtgcaccactgtgcccggctaatttgtgtgtatatattttgtagaaatg 6301 gggtttcaccatgttgtccaggctggtcacgaactcctgggctcaagccatctgcccgcc 6361 tcatcctcccaaagtgctgggattataggcctgagcccaccgtgcctggcctttcctgtt 6421 tatctttgaaaattaaatagggcataagagagaagaagatgtacttacaatgcagtgggt 6481 ggttttaactctatagcctttgggctctgtggttggtgctccccttcctaaataaatgag 6541 gtgtatgcagggccctcttctgccttagcgccctgccagctgggactccagcaaggcccg 6601 gggcacctgaggacagagtgagatggagggccgctgctccagcagccgggcctgcatccc 6661 acaagtcaactgtgtcggacagaggatccttacaaagaagaggcagcagggttgggggct 6721 ggccagctgctcgtccgccctaggtagcttgctcatctgtaaagtgggtggggcaggagt 6781 tcccacctcatggggtcctggcaagcctgcagtatccccgagtggcaccagcctgcttct 6841 ggggcagagcagtttgtgccccctgaggtaccactgatcctctttccctgctattaggta 6901 ttgctctcttcctccggtgtttgccttttcagattatagaagtaatatgtgttcccatat 6961 ttggcgtctctcaggagctcaggaagtacttggctgagtgaacatgtccattgtggaaaa 7021 atggcaacaatatggattccatgggtatattttatagaagaatatgaagaaaagcagcta 7081 cccctaaacccattgcacaagctgttcatgttaattctgtacccgacgctttccccacgg 7141 ggcctcccctcactctgaaatggcatccaggtccatcttgccctccacctctgcatggct 7201 ctccatgccccatcgcctctcccagatcctagcactgggtccacactctcgccctgtcca 7261 tttaggttgatgaaagcaggcagtcacccgggtgggccagtcttgcctgtgggaggaaca 7321 tgcagtctcctgtctcatggtttgaagtgtgccaggaagcctggcccagcccacctcccc 7381 ctggagtccttcccaggaggaataaccccttaggtcattgactataagatgagttcgctc 7441 actggatccttcctctctgatgagacaggaagaaggtacacagtgaccaggtaggaggag 7501 gagagggagtagaaaggagggatgcgggtggctggtccctgcatttgcctgcttccctgc 7561 acgggtgtcccactggccgcctctgctcaccagtgtcatgggattctctcagaagatgaa 7621 aacagcccctgcttttttgctagaatggctgagctttcatggaaaggaagctggacccaa 7681 gcaacagccgactaccgaaggttgcctggagcagtgcagatgtgggaggaagaagggcct 7741 tggtgcacactggcttttcttcctgactgcaatgtggcattgtgccagctacctcctctt 7801 tctcggcctcaggaaaatggagagaaagcagccctgaaggtggctgtgacgagggaaggg 7861 gcagagggcctgacagtcaaccacgcgctatattttcctgttcttccttagggcaagaac 7921 tgcatggccagactcaggcaaggcctaggtgtgggctgggcattgcctacacgtgaagag 7981 atcactccgcgtccctactgcacctgtcacaaagtgccttctgatatgcctggcaaacca 8041 aaatcggtgagcgccagcttgcttccctagaagacatttctaaatattcataacatgctt 8101 gctcaaatcaatcaccttattttacatccgctccagggagaaatgaagacatggtcctac 8161 gttgttctgtaattattttctatgtaaattttgttccttgttacaattatatatgtctta 8221 ggggaaaggaccatttcacatgtgtcacctcatgtgattctcaccacagccctgtgattg 8281 ctcctgttttataaataatgacatagttccagttgatggccaaagccacagctaacgaga 8341 ggcagagagagctcaggctcccaggagcttccactctcagaccttgcctcccgggctgcc 8401 ctgagtgaaacgcctgcttagcatttggcacagccagaagcagcaagctagggtcacaac 8461 acagagaggggctgtgtaatactggctgcctctgtgctaagaaaaaaaaaaaatcactgt 8521 gtgtttgtttattttggtgcaggcccagtgttcttgcttagacttaatactacccttcat 8581 gttaaaataaaaccaaacaaaaacccat

[0120] In some embodiments the IL-17RA ASO is complementary to a nucleic acid encoding the following protein sequence:

TABLE-US-00003 (SEQIDNO:305) MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNC TVKNSTCLDDSWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTL QTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHRRWRFTFSHFV VDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSG SLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMH HIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGP GSEKYSDDTKYTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQ FLLTACGTEVALDLLEEQAISEAGVMTWVGRQKQEMVESNSKIIVLCSRG TRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDFKRPACFGTYV VCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRV GELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKL EPHLQPRGQPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEG EACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEG LMLSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRS SPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQK NSGWDTMGSESEGPSA.

[0121] In some embodiments the ASOs used herein include any one or more of the following IL-17RA ASOs: mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA/isp18//isp18//3CholTEG/(SEQ ID NO: 225); mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU/isp18//isp18//3CholTEG/(SEQ ID NO: 288); mGmUmAmGmGmGmCmGmUG*T*G*T*G*G*mGmUmC/isp18//isp18//3CholTEG/(SEQ ID NO: 291); mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA (SEQ ID NO: 225); mCmCmCmAmCmAmGG*G*G*C*A*T*mGmUmAmGmU (SEQ ID NO: 288); mGmUmAmGmGmGmCmGmUG*T*G*T*G*G*mGmUmC (SEQ ID NO: 291); GCUUGGGCAGGTGGUGAA (SEQ ID NO: 225); CCCACAGGGGCATGUAGU (SEQ ID NO: 288); or GUAGGGCGUGTGTGGGUC (SEQ ID NO: 291) or salts thereof.

[0122] In some embodiments antisense oligonucleotides are designed to target the nucleotide sequence corresponding to IL-4R, set forth below. Human IL-4R cDNA sequence has been disclosed in Genbank accession number NM_000418.

TABLE-US-00004 (SEQIDNO:306) 1 gggtctccgcgcccaggaaagccccgcgcggcgcgggccagggaagggccacccaggggt 61 cccccacttcccgcttgggcgcccggacggcgaatggagcaggggcgcgcagataattaa 121 agatttacacacagctggaagaaatcatagagaagccgggcgtggtggctcatgcctata 181 atcccagcacttttggaggctgaggcgggcagatcacttgagatcaggagttcgagacca 241 gcctggtgccttggcatctcccaatggggtggctttgctctgggctcctgttccctgtga 301 gctgcctggtcctgctgcaggtggcaagctctgggaacatgaaggtcttgcaggagccca 361 cctgcgtctccgactacatgagcatctctacttgcgagtggaagatgaatggtcccacca 421 attgcagcaccgagctccgcctgttgtaccagctggtttttctgctctccgaagcccaca 481 cgtgtatccctgagaacaacggaggcgcggggtgcgtgtgccacctgctcatggatgacg 541 tggtcagtgcggataactatacactggacctgtgggctgggcagcagctgctgtggaagg 601 gctccttcaagcccagcgagcatgtgaaacccagggccccaggaaacctgacagttcaca 661 ccaatgtctccgacactctgctgctgacctggagcaacccgtatccccctgacaattacc 721 tgtataatcatctcacctatgcagtcaacatttggagtgaaaacgacccggcagatttca 781 gaatctataacgtgacctacctagaaccctccctccgcatcgcagccagcaccctgaagt 841 ctgggatttcctacagggcacgggtgagggcctgggctcagtgctataacaccacctgga 901 gtgagtggagccccagcaccaagtggcacaactcctacagggagcccttcgagcagcacc 961 tcctgctgggcgtcagcgtttcctgcattgtcatcctggccgtctgcctgttgtgctatg 1021 tcagcatcaccaagattaagaaagaatggtgggatcagattcccaacccagcccgcagcc 1081 gcctcgtggctataataatccaggatgctcaggggtcacagtgggagaagcggtcccgag 1141 gccaggaaccagccaagtgcccacactggaagaattgtcttaccaagctcttgccctgtt 1201 ttctggagcacaacatgaaaagggatgaagatcctcacaaggctgccaaagagatgcctt 1261 tccagggctctggaaaatcagcatggtgcccagtggagatcagcaagacagtcctctggc 1321 cagagagcatcagcgtggtgcgatgtgtggagttgtttgaggccccggtggagtgtgagg 1381 aggaggaggaggtagaggaagaaaaagggagcttctgtgcatcgcctgagagcagcaggg 1441 atgacttccaggagggaagggagggcattgtggcccggctaacagagagcctgttcctgg 1501 acctgctcggagaggagaatgggggcttttgccagcaggacatgggggagtcatgccttc 1561 ttccaccttcgggaagtacgagtgctcacatgccctgggatgagttcccaagtgcagggc 1621 ccaaggaggcacctccctggggcaaggagcagcctctccacctggagccaagtcctcctg 1681 ccagcccgacccagagtccagacaacctgacttgcacagagacgcccctcgtcatcgcag 1741 gcaaccctgcttaccgcagcttcagcaactccctgagccagtcaccgtgtcccagagagc 1801 tgggtccagacccactgctggccagacacctggaggaagtagaacccgagatgccctgtg 1861 tcccccagctctctgagccaaccactgtgccccaacctgagccagaaacctgggagcaga 1921 tcctccgccgaaatgtcctccagcatggggcagctgcagcccccgtctcggcccccacca 1981 gtggctatcaggagtttgtacatgcggtggagcagggtggcacccaggccagtgcggtgg 2041 tgggcttgggtcccccaggagaggctggttacaaggccttctcaagcctgcttgccagca 2101 gtgctgtgtccccagagaaatgtgggtttggggctagcagtggggaagaggggtataagc 2161 ctttccaagacctcattcctggctgccctggggaccctgccccagtccctgtccccttgt 2221 tcacctttggactggacagggagccacctcgcagtccgcagagctcacatctcccaagca 2281 gctccccagagcacctgggtctggagccgggggaaaaggtagaggacatgccaaagcccc 2341 cacttccccaggagcaggccacagacccccttgtggacagcctgggcagtggcattgtct 2401 actcagcccttacctgccacctgtgcggccacctgaaacagtgtcatggccaggaggatg 2461 gtggccagacccctgtcatggccagtccttgctgtggctgctgctgtggagacaggtcct 2521 cgccccctacaacccccctgagggccccagacccctctccaggtggggttccactggagg 2581 ccagtctgtgtccggcctccctggcaccctcgggcatctcagagaagagtaaatcctcat 2641 catccttccatcctgcccctggcaatgctcagagctcaagccagacccccaaaatcgtga 2701 actttgtctccgtgggacccacatacatgagggtctcttaggtgcatgtcctcttgttgc 2761 tgagtctgcagatgaggactagggcttatccatgcctgggaaatgccacctcctggaagg 2821 cagccaggctggcagatttccaaaagacttgaagaaccatggtatgaaggtgattggccc 2881 cactgacgttggcctaacactgggctgcagagactggaccccgcccagcattgggctggg 2941 ctcgccacatcccatgagagtagagggcactgggtcgccgtgccccacggcaggcccctg 3001 caggaaaactgaggcccttgggcacctcgacttgtgaacgagttgttggctgctccctcc 3061 acagcttctgcagcagactgtccctgttgtaactgcccaaggcatgttttgcccaccaga 3121 tcatggcccacgtggaggcccacctgcctctgtctcactgaactagaagccgagcctaga 3181 aactaacacagccatcaagggaatgacttgggcggccttgggaaatcgatgagaaattga 3241 acttcagggagggtggtcattgcctagaggtgctcattcatttaacagagcttccttagg 3301 ttgatgctggaggcagaatcccggctgtcaaggggtgttcagttaaggggagcaacagag 3361 gacatgaaaaattgctatgactaaagcagggacaatttgctgccaaacacccatgcccag 3421 ctgtatggctgggggctcctcgtatgcatggaacccccagaataaatatgctcagccacc 3481 ctgtgggccgggcaatccagacagcaggcataaggcaccagttaccctgcatgttggccc 3541 agacctcaggtgctagggaaggcgggaaccttgggttgagtaatgctcgtctgtgtgttt 3601 tagtttcatcacctgttatctgtgtttgctgaggagagtggaacagaaggggtggagttt 3661 tgtataaataaagtttctttgtctctttaaaaaaaaaaaaaaaaaaaaaa

[0123] In some embodiments the IL-4R ASO is complementary to a nucleic acid encoding the following protein sequence:

TABLE-US-00005 (SEQIDNO:309) MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMS ISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNG GAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYA VNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRAR VRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQ DAQGSQWEKRSRGQEPAKCPHWKNCLTKLLPCFLEHNMKR DEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGRE GIVARLTESLFLDLLGEENGGFCQQDMGESCLLPPSGSTS AHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLA RHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQ HGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPG CPGDPAPVPVPLFTFGLDREPPRSPQSSHLPSSSPEHLGL EPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLR APDPSPGGVPLEASLCPASLAPSGISEKSKSSSSFHPAPG NAQSSSQTPKIVNEVSVGPTYMRVS

[0124] In some embodiments antisense oligonucleotides are designed to target the nucleotide sequence corresponding to IL-1, set forth below. Human IL-1 cDNA sequence has been disclosed in Genbank accession number NM_000576.

TABLE-US-00006 (SEQIDNO:307) 1 accaaacctcttcgaggcacaaggcacaacaggctgctct gggattctcttcagccaatc 61 ttcattgctcaagtgtctgaagcagccatggcagaagtac ctgagctcgccagtgaaatg 121 atggcttattacagtggcaatgaggatgacttgttctttg aagctgatggccctaaacag 181 atgaagtgctccttccaggacctggacctctgccctctgg atggcggcatccagctacga 241 atctccgaccaccactacagcaagggcttcaggcaggccg cgtcagttgttgtggccatg 301 gacaagctgaggaagatgctggttccctgcccacagacct tccaggagaatgacctgagc 361 accttctttcccttcatctttgaagaagaacctatcttct tcgacacatgggataacgag 421 gcttatgtgcacgatgcacctgtacgatcactgaactgca cgctccgggactcacagcaa 481 aaaagcttggtgatgtctggtccatatgaactgaaagctc tccacctccagggacaggat 541 atggagcaacaagtggtgttctccatgtcctttgtacaag gagaagaaagtaatgacaaa 601 atacctgtggccttgggcctcaaggaaaagaatctgtacc tgtcctgcgtgttgaaagat 661 gataagcccactctacagctggagagtgtagatcccaaaa attacccaaagaagaagatg 721 gaaaagcgatttgtcttcaacaagatagaaatcaataaca agctggaatttgagtctgcc 781 cagttccccaactggtacatcagcacctctcaagcagaaa acatgcccgtcttcctggga 841 gggaccaaaggcggccaggatataactgacttcaccatgc aatttgtgtcttcctaaaga 901 gagctgtacccagagagtcctgtgctgaatgtggactcaa tccctagggctggcagaaag 961 ggaacagaaaggtttttgagtacggctatagcctggactt tcctgttgtctacaccaatg 1021 cccaactgcctgccttagggtagtgctaagaggatctcct gtccatcagccaggacagtc 1081 agctctctcctttcagggccaatccccagcccttttgttg agccaggcctctctcacctc 1141 tcctactcacttaaagcccgcctgacagaaaccacggcca catttggttctaagaaaccc 1201 tctgtcattcgctcccacattctgatgagcaaccgcttcc ctatttatttatttatttgt 1261 ttgtttgttttattcattggtctaatttattcaaaggggg caagaagtagcagtgtctgt 1321 aaaagagcctagtttttaatagctatggaatcaattcaat ttggactggtgtgctctctt 1381 taaatcaagtcctttaattaagactgaaaatatataagct cagattatttaaatgggaat 1441 atttataaatgagcaaatatcatactgttcaatggttctg aaataaacttcactgaag

[0125] In some embodiments the IL-1 ASO is complementary to a nucleic acid encoding the following protein sequence:

TABLE-US-00007 (SEQIDNO:310) MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLD LCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVP CPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSM SFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLES VDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS

[0126] In some embodiments antisense oligonucleotides are designed to target the nucleotide sequence corresponding to CTGF, set forth below. Human CTGF cDNA sequence has been disclosed in Genbank accession number NM_001901.

TABLE-US-00008 (SEQIDNO:308) 1 aaactcacacaacaactcttccccgctgagaggagacagc cagtgcgactccaccctcca 61 gctcgacggcagccgccccggccgacagccccgagacgac agcccggcgcgtcccggtcc 121 ccacctccgaccaccgccagcgctccaggccccgccgctc cccgctcgccgccaccgcgc 181 cctccgctccgcccgcagtgccaaccatgaccgccgccag tatgggccccgtccgcgtcg 241 ccttcgtggtcctcctcgccctctgcagccggccggccgt cggccagaactgcagcgggc 301 cgtgccggtgcccggacgagccggcgccgcgctgcccggc gggcgtgagcctcgtgctgg 361 acggctgcggctgctgccgcgtctgcgccaagcagctggg cgagctgtgcaccgagcgcg 421 acccctgcgacccgcacaagggcctcttctgtgacttcgg ctccccggccaaccgcaaga 481 tcggcgtgtgcaccgccaaagatggtgctccctgcatctt cggtggtacggtgtaccgca 541 gcggagagtccttccagagcagctgcaagtaccagtgcac gtgcctggacggggcggtgg 601 gctgcatgcccctgtgcagcatggacgttcgtctgcccag ccctgactgccccttcccga 661 ggagggtcaagctgcccgggaaatgctgcgaggagtgggt gtgtgacgagcccaaggacc 721 aaaccgtggttgggcctgccctcgcggcttaccgactgga agacacgtttggcccagacc 781 caactatgattagagccaactgcctggtccagaccacaga gtggagcgcctgttccaaga 841 cctgtgggatgggcatctccacccgggttaccaatgacaa cgcctcctgcaggctagaga 901 agcagagccgcctgtgcatggtcaggccttgcgaagctga cctggaagagaacattaaga 961 agggcaaaaagtgcatccgtactcccaaaatctccaagcc tatcaagtttgagctttctg 1021 gctgcaccagcatgaagacataccgagctaaattctgtgg agtatgtaccgacggccgat 1081 gctgcaccccccacagaaccaccaccctgccggtggagtt caagtgccctgacggcgagg 1141 tcatgaagaagaacatgatgttcatcaagacctgtgcctg ccattacaactgtcccggag 1201 acaatgacatctttgaatcgctgtactacaggaagatgta cggagacatggcatgaagcc 1261 agagagtgagagacattaactcattagactggaacttgaa ctgattcacatctcattttt 1321 ccgtaaaaatgatttcagtagcacaagttatttaaatctg tttttctaactgggggaaaa 1381 gattcccacccaattcaaaacattgtgccatgtcaaacaa atagtctatcaaccccagac 1441 actggtttgaagaatgttaagacttgacagtggaactaca ttagtacacagcaccagaat 1501 gtatattaaggtgtggctttaggagcagtgggagggtacc agcagaaaggttagtatcat 1561 cagatagcatcttatacgagtaatatgcctgctatttgaa gtgtaattgagaaggaaaat 1621 tttagcgtgctcactgacctgcctgtagccccagtgacag ctaggatgtgcattctccag 1681 ccatcaagagactgagtcaagttgttccttaagtcagaac agcagactcagctctgacat 1741 tctgattcgaatgacactgttcaggaatcggaatcctgtc gattagactggacagcttgt 1801 ggcaagtgaatttgcctgtaacaagccagattttttaaaa tttatattgtaaatattgtg 1861 tgtgtgtgtgtgtgtgtatatatatatatatgtacagtta tctaagttaatttaaagttg 1921 tttgtgcctttttatttttgtttttaatgctttgatattt caatgttagcctcaatttct 1981 gaacaccataggtagaatgtaaagcttgtctgatcgttca aagcatgaaatggatactta 2041 tatggaaattctgctcagatagaatgacagtccgtcaaaa cagattgtttgcaaagggga 2101 ggcatcagtgtccttggcaggctgatttctaggtaggaaa tgtggtagcctcacttttaa 2161 tgaacaaatggcctttattaaaaactgagtgactctatat agctgatcagttttttcacc 2221 tggaagcatttgtttctactttgatatgactgtttttcgg acagtttatttgttgagagt 2281 gtgaccaaaagttacatgtttgcacctttctagttgaaaa taaagtgtatattttttcta 2341 taaaaaaaaaaaaaaaaa

[0127] In some embodiments the CTGF ASO is complementary to a nucleic acid encoding the following protein sequence:

TABLE-US-00009 (SEQIDNO:311) MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPA PRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGL FCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKC CEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCL VQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYR AKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFI KTCACHYNCPGDNDIFESLYYRKMYGDMA

[0128] The invention in some aspects relates to multiplex ASO-SNAs for reducing the expression of multiple gene targets. In some embodiments the mASO-SNAs include ASOs that target IL-17RA and TNF. These particular mASOs-SNAs are particularly useful for treating inflammatory disorders. A TNF antisense oligonucleotide or TNF- ASO as used herein refers to a nucleic acid based agent which interferes with TNF activity. In particular, the TNF antisense inhibitors or TNF antisense oligonucleotides of the invention reduce the expression of the TNF gene.

[0129] TNF- (tumor necrosis factor-alpha) is a pleiotropic cytokine produced by activated macrophages/monocytes and lymphocytes which often promotes inflammatory responses leading to a variety of diseases. TNF- is released from macrophages, monocytes and natural killer cells and play an important role in inflammatory and immune responses, including the recruitment of leukocytes to injured tissues during bacterial and other microbial infections, and following stimulation with inflammatory substances. When present in excessive quantities, TNF- is known to cause tissue injury, and has been implicated in the pathology associated with inflammatory and autoimmune diseases.

[0130] TNF- mediates biological effects through two distinct membrane-protein receptors, TNF-RI and TNF-RII, which differ in sequence and molecular mass. TNF-RI is reported to be present at low levels in most, if not all, human cell types, and expression of the TNF-RI gene in humans can be upregulated by infection, interferons, and modulators of second messengers, such as phorbol esters. The extracellular portions of both TNF receptors also exist in soluble forms, which are derived from membrane-bound forms of the receptors by proteolytic cleavage at the cell surface. The soluble TNF receptors retain the ability to bind TNF- in solution. Soluble TNF receptors have been identified in urine and sera from healthy individuals, and have been shown to be elevated in some chronic diseases and following inoculation with agents that induce TNF-.

[0131] In some embodiments, antisense oligonucleotides are designed to target human TNF, for instance, the nucleotide sequence of SEQ ID NO: 304, set forth below. Human TNF- cDNA sequence has been published by Nedwin, G. E. et al. (Nucleic Acids Res. 1985, 13, 6361-6373); and is disclosed in Genbank accession number X02910 and NM_000594.

TABLE-US-00010 (SEQIDNO:304) 1 gaattccgggtgatttcactcccggctgtccaggcttgtcctgctaccccacccagcctt 61 tcctgaggcctcaagcctgccaccaagcccccagctccttctccccgcaggacccaaaca 121 caggcctcaggactcaacacagcttttccctccaacccgttttctctccctcaacggact 181 cagctttctgaagcccctcccagttctagttctatctttttcctgcatcctgtctggaag 241 ttagaaggaaacagaccacagacctggtccccaaaagaaatggaggcaataggttttgag 301 gggcatggggacggggttcagcctccagggtcctacacacaaatcagtcagtggcccaga 361 agacccccctcggaatcggagcagggaggatggggagtgtgaggggtatccttgatgctt 421 gtgtgtccccaactttccaaatccccgcccccgcgatggagaagaaaccgagacagaagg 481 tgcagggcccactaccgcttcctccagatgagctcatgggtttctccaccaaggaagttt 541 tccgctggttgaatgattctttccccgccctcctctcgccccagggacatataaaggcag 601 ttgttggcacacccagccagcagacgctccctcagcaaggacagcagaggaccagctaag 661 agggagagaagcaactacagaccccccctgaaaacaaccctcagacgccacatcccctga 721 caagctgccaggcaggttctcttcctctcacatactgacccacggcttcaccctctctcc 781 cctggaaaggacaccatgagcactgaaagcatgatccgggacgtggagctggccgaggag 841 gcgctccccaagaagacaggggggccccagggctccaggcggtgcttgttcctcagcctc 901 ttctccttcctgatcgtggcaggcgccaccacgctcttctgcctgctgcactttggagtg 961 atcggcccccagagggaagaggtgagtgcctggccagccttcatccactctcccacccaa 1021 ggggaaatgagagacgcaagagagggagagagatgggatgggtgaaagatgtgcgctgat 1081 agggagggatgagagagaaaaaaacatggagaaagacggggatgcagaaagagatgtggc 1141 aagagatggggaagagagagagagaaagatggagagacaggatgtctggcacatggaagg 1201 tgctcactaagtgtgtatggagtgaatgaatgaatgaatgaatgaacaagcagatatata 1261 aataagatatggagacagatgtggggtgtgagaagagagatgggggaagaaacaagtgat 1321 atgaataaagatggtgagacagaaagagcgggaaatatgacagctaaggagagagatggg 1381 ggagataaggagagaagaagatagggtgtctggcacacagaagacactcagggaaagagc 1441 tgttgaatgctggaaggtgaatacacagatgaatggagagagaaaaccagacacctcagg 1501 gctaagagcgcaggccagacaggcagccagctgttcctcctttaagggtgactccctcga 1561 tgttaaccattctccttctccccaacagttccccagggacctctctctaatcagccctct 1621 ggcccaggcagtcagtaagtgtctccaaacctctttcctaattctgggtttgggtttggg 1681 ggtagggttagtaccggtatggaagcagtgggggaaatttaaagttttggtcttggggga 1741 ggatggatggaggtgaaagtaggggggtattttctaggaagtttaagggtctcagctttt 1801 tcttttctctctcctcttcaggatcatcttctcgaaccccgagtgacaagcctgtagccc 1861 atgttgtaggtaagagctctgaggatgtgtcttggaacttggagggctaggatttgggga 1921 ttgaagcccggctgatggtaggcagaacttggagacaatgtgagaaggactcgctgagct 1981 caagggaagggtggaggaacagcacaggccttagtgggatactcagaacgtcatggccag 2041 gtgggatgtgggatgacagacagagaggacaggaaccggatgtggggtgggcagagctcg 2101 agggccaggatgtggagagtgaaccgacatggccacactgactctcctctccctctctcc 2161 ctccctccagcaaaccctcaagctgaggggcagctccagtggctgaaccgccgggccaat 2221 gccctcctggccaatggcgtggagctgagagataaccagctggtggtgccatcagagggc 2281 ctgtacctcatctactcccaggtcctcttcaagggccaaggctgcccctccacccatgtg 2341 ctcctcacccacaccatcagccgcatcgccgtctcctaccagaccaaggtcaacctcctc 2401 tctgccatcaagagcccctgccagagggagaccccagagggggctgaggccaagccctgg 2461 tatgagcccatctatctgggaggggtcttccagctggagaagggtgaccgactcagcgct 2521 gagatcaatcggcccgactatctcgactttgccgagtctgggcaggtctactttgggatc 2581 attgccctgtgaggaggacgaacatccaaccttcccaaacgcctcccctgccccaatccc 2641 tttattaccccctccttcagacaccctcaacctcttctggctcaaaaagagaattggggg 2701 cttagggtcggaacccaagcttagaactttaagcaacaagaccaccacttcgaaacctgg 2761 gattcaggaatgtgtggcctgcacagtgaagtgctggcaaccactaagaattcaaactgg 2821 ggcctccagaactcactggggcctacagctttgatccctgacatctggaatctggagacc 2881 agggagcctttggttctggccagaatgctgcaggacttgagaagacctcacctagaaatt 2941 gacacaagtggaccttaggccttcctctctccagatgtttccagacttccttgagacacg 3001 gagcccagccctccccatggagccagctccctctatttatgtttgcacttgtgattattt 3061 attatttatttattatttatttatttacagatgaatgtatttatttgggagaccggggta 3121 tcctgggggacccaatgtaggagctgccttggctcagacatgttttccgtgaaaacggag 3181 ctgaacaataggctgttcccatgtagccccctggcctctgtgccttcttttgattatgtt 3241 ttttaaaatatttatctgattaagttgtctaaacaatgctgatttggtgaccaactgtca 3301 ctcattgctgagcctctgctccccaggggagttgtgtctgtaatcgccctactattcagt 3361 ggcgagaaataaagtttgcttagaaaagaaacatggtctccttcttggaattaattctgc 3421 atctgcctcttcttgtgggtgggaagaagctccctaagtcctctctccacaggctttaag 3481 atccctcggacccagtcccatccttagactcctagggccctggagaccctacataaacaa 3541 agcccaacagaatattccccatcccccaggaaacaagagcctgaacctaattacctctcc 3601 ctcagggcatgggaatttccaactctgggaattc

[0132] The nanostructures descried herein may be stable self-assembling nanostructures. For instance the nanostructure may be an antisense oligonucleotide of 18-21 nucleotides in length having a sequence described herein, wherein a hydrophobic group at the 3 or 5 terminus self-associates to form the core of the nanostructure in water or other suitable solvents. A hydrophobic group as used herein may include cholesterol, a cholesteryl or modified cholesteryl residue, adamantine, dihydrotesterone, long chain alkyl, long chain alkenyl, long chain alkynyl, olely-lithocholic, cholenic, oleoyl-cholenic, palmityl, heptadecyl, myrisityl, bile acids, cholic acid or taurocholic acid, deoxycholate, oleyl litocholic acid, oleoyl cholenic acid, glycolipids, phospholipids, sphingolipids, isoprenoids, such as steroids, vitamins, such as vitamin E, fatty acids either saturated or unsaturated, fatty acid esters, such as triglycerides, pyrenes, porphyrines, Texaphyrine, adamantane, acridines, biotin, coumarin, fluorescein, rhodamine, Texas-Red, digoxygenin, dimethoxytrityl, t-butyldimethylsilyl, t-butyldiphenylsilyl, cyanine dyes (e.g. Cy3 or Cy5), Hoechst 33258 dye, psoralen, or ibuprofen.

[0133] The antisense oligonucleotides typically have a length of 10-30 or 15-20 bases, which is generally long enough to have one complementary sequence in the mammalian genome. Additionally, antisense compounds having a length of at least 12, typically at least 15 nucleotides in length hybridize well with their target mRNA. Thus, the antisense oligonucleotides of the invention are typically in a size range of 8-100 nucleotides, more preferably 12-50 nucleotides in length. In some embodiments of the invention the antisense oligonucleotides are of 18-19 nucleotides in length. The antisense oligonucleotides may include further nucleotides on the 5 and/or 3 end of the oligonucleotide. However an antisense oligonucleotide that is limited to 18 nucleotides in length, for example, does not have any additional nucleotides on the 5 or 3 end of the molecule. Other non-nucleotide molecules may be linked covalently or non-covalently to the 5 and/or 3 end of those oligonucleotides.

[0134] The terms nucleic acid and oligonucleotide are used interchangeably to mean multiple nucleotides (i.e., molecules comprising a sugar (e.g., ribose or deoxyribose) linked to a phosphate group and to an exchangeable organic base, which is either a substituted pyrimidine (e.g., cytosine (C), thymine (T) or uracil (U)) or a substituted purine (e.g., adenine (A) or guanine (G)). As used herein, the terms nucleic acid and oligonucleotide refer to oligoribonucleotides as well as oligodeoxyribonucleotides. The terms nucleic acid and oligonucleotide shall also include polynucleosides (i.e., a polynucleotide minus the phosphate) and any other organic base containing polymer. Nucleic acid molecules are preferably synthetic (e.g., produced by nucleic acid synthesis). The oligonucleotides may be any size useful for producing antisense effects. In some embodiments they are 18-23 nucleotides in length. In other embodiments the antisense oligonucleotide is 18 nucleotides in length.

[0135] The terms nucleic acid and oligonucleotide may also encompass nucleic acids or oligonucleotides with substitutions or modifications, such as in the bases and/or sugars. For example, they include nucleic acids having backbone sugars that are covalently attached to low molecular weight organic groups other than a hydroxyl group at the 2 position and other than a phosphate group or hydroxy group at the 5 position. Thus modified nucleic acids may include a 2-O-alkylated ribose group. In addition, modified nucleic acids may include sugars such as hexose, 2-F hexose, 2-amino ribose, CEt-LNA, arabinose or 2-fluoroarabinose instead of ribose. Thus the nucleic acids may be heterogeneous in backbone composition thereby containing any possible combination of polymer units linked together such as peptide-nucleic acids (which have an amino acid backbone with nucleic acid bases). Other examples are described in more detail below.

[0136] The oligonucleotides may be DNA, RNA, PNA, LNA, ENA or hybrids including any chemical or natural modification thereof. Chemical and natural modifications are well known in the art. Such modifications include, for example, modifications designed to increase binding to a target strand (i.e., increase their melting temperatures), to assist in identification of the oligonucleotide or an oligonucleotide-target complex, to increase cell penetration, to stabilize against nucleases and other enzymes that degrade or interfere with the structure or activity of the oligonucleotides, to provide a mode of disruption (a terminating event) once sequence-specifically bound to a target, and to improve the pharmacokinetic properties of the oligonucleotide.

[0137] Modifications include, but are not limited to, for example, (a) end modifications, e.g., 5 end modifications (phosphorylation dephosphorylation, conjugation, inverted linkages, etc.), 3 end modifications (conjugation, DNA nucleotides, inverted linkages, etc.), (b) base modifications, e.g., replacement with modified bases, stabilizing bases, destabilizing bases, or bases that base pair with an expanded repertoire of partners, or conjugated bases, (c) sugar modifications (e.g., at the 2 position or 4 position) or replacement of the sugar, as well as (d) internucleoside linkage modifications, including modification or replacement of the phosphodiester linkages. To the extent that such modifications interfere with translation (i.e., results in a reduction of 50%, 60%, 70%, 80%, or 90% or more in translation relative to the lack of the modificatione.g., in an in vitro translation assay), the modification may not be optimal for the methods and compositions described herein.

[0138] Non-limiting examples of modified internucleoside linkages include phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3-5 linkages, 2-5 linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3-5 to 5-3 or 2-5 to 5-2. Various salts, mixed salts and free acid forms are also included.

[0139] In some embodiments, the modified oligonucleotide is a single-stranded modified oligonucleotide. In some embodiments, the single-stranded modified oligonucleotide consists of 10-30, 10-35, 10-40, 10-45, 10-50, 10-60, 10-70, 10-80, 10-90, 10-100 or more than 100 linked nucleosides and has a gap segment. In some embodiments, a gap segment refers to one or more linked nucleic acids consisting of deoxynucleosides located at the center or near the center of a modified oligonucleotide, such as a single-stranded modified oligonucleotide. In some embodiments, the gap segment consists of 2-3, 2-4, 2-5, 2-6, 2-7, 2-8, 2-9, 2-10, 2-20, 2-30, 2-40 2-50, 10-20, 10-30, 10-40 or 10-50 linked deoxynucleosides.

[0140] A 5 wing segment corresponds to the linked nucleic acids (e.g., nucleosides) from the 5-end of a modified oligonucleotide to the nucleic acid before the first nucleic acid at the 5-end of the gap segment. A 3 wing segment corresponds to the linked nucleic acids (e.g., nucleosides) after the last nucleic acid at the 3 end of the gap segment to the last nucleic acid at the 3 end of the modified oligonucleotide.

[0141] The gap segment is positioned between the 5 wing segment and the 3 wing segment. In some embodiments, at least one nucleoside of the 5 wing segment and/or at least one nucleoside of the 3 wing segment comprises a modified nucleoside. In some embodiments, the internucleoside linkages within the gap segment and the linkages connecting the gap segment to the 3 wing segment and/or the 5 wing segment are all phosphorothioate linkages (*). In some embodiments, the internucleoside linkages connecting the rest of the nucleosides of both the 5 and 3 wing segments are phosphodiester linkages. In some embodiments, the nucleosides in the modified oligonucleotide are modified with a 2 O-methyl group. The nucleosides in the modified oligonucleoside can also be modified with any other modification described herein.

[0142] In some embodiments, the nucleobase sequence of the modified oligonucleotide consists of 10-30, 10-35, 10-40, 10-45, 10-50, 10-60, 10-70, 10-80, 10-90, 10-100 or more than 100 linked nucleosides and has a gap segment complementary to an equal length portion of the coding sequence (e.g., cDNA) of the IL-17R, such as IL-17RA (e.g., cDNA sequence of IL-17RA is represented by SEQ ID NO: 302), IL-17RB, IL-17RC, IL-17RD, or IL-17RE) (see e.g., Johansen et al., Br J Dermatol (2009) 160(2):319-24, or a pharmaceutically acceptable salt thereof.

[0143] Modified internucleoside linkages that do not include a phosphorus atom therein have internucleoside linkages that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatoms and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH.sub.2 component parts.

[0144] Substituted sugar moieties include, but are not limited to one of the following at the 2 position: H (deoxyribose); OH (ribose); F; O-, S-, or N-alkyl; O-, S-, or N-alkenyl; O-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl can be substituted or unsubstituted C.sub.1 to C.sub.10 alkyl or C.sub.2 to C.sub.10 alkenyl and alkynyl.

[0145] A chemically or naturally modified oligonucleotide may include, for example, at least one nucleotide modified at the 2 position of the sugar, most preferably a 2-O-alkyl, 2-O-alkyl-O-alkyl or 2-fluoro-modified nucleotide or an end cap. In other embodiments, RNA modifications include 2-fluoro, 2-amino and 2 O-methyl modifications on the ribose of pyrimidines, abasic residues or an inverted base at the 3 end of the RNA.

[0146] The oligonucleotides useful according to the invention may include a single modified nucleoside. In other embodiments the oligonucleotide may include at least two modified nucleosides, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or more nucleosides, up to the entire length of the oligonucleotide.

[0147] Nucleosides or nucleobases include the natural purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U). Modified nucleosides include other synthetic and natural nucleobases such as inosine, xanthine, hypoxanthine, nubularine, isoguanisine, tubercidine, 2-(halo)adenine, 2-(alkyl)adenine, 2-(propyl)adenine, 2 (amino)adenine, 2-(aminoalkyll)adenine, 2 (aminopropyl)adenine, 2 (methylthio) N6 (isopentenyl)adenine, 6 (alkyl)adenine, 6 (methyl)adenine, 7 (deaza)adenine, 8 (alkenyl)adenine, 8-(alkyl)adenine, 8 (alkynyl)adenine, 8 (amino)adenine, 8-(halo)adenine, 8-(hydroxyl)adenine, 8 (thioalkyl) adenine, 8-(thiol)adenine, N6-(isopentyl)adenine, N6 (methyl)adenine, N6, N6 (dimethyl)adenine, 2-(alkyl)guanine, 2 (propyl)guanine, 6-(alkyl)guanine, 6 (methyl)guanine, 7 (alkyl)guanine, 7 (methyl)guanine, 7 (deaza)guanine, 8 (alkyl)guanine, 8-(alkenyl)guanine, 8 (alkynyl)guanine, 8-(amino)guanine, 8 (halo)guanine, 8-(hydroxyl)guanine, 8 (thioalkyl)guanine, 8-(thiol)guanine, N (methyl)guanine, 2-(thio)cytosine, 3 (deaza) 5 (aza)cytosine, 3-(alkyl)cytosine, 3 (methyl)cytosine, 5-(alkyl)cytosine, 5-(alkynyl)cytosine, 5 (halo)cytosine, 5 (methyl)cytosine, 5 (propynyl)cytosine, 5 (propynyl)cytosine, 5 (trifluoromethyl)cytosine, 6-(azo)cytosine, N4 (acetyl)cytosine, 3 (3 amino-3 carboxypropyl)uracil, 2-(thio)uracil, 5 (methyl) 2 (thio)uracil, 5 (methylaminomethyl)-2 (thio)uracil, 4-(thio)uracil, 5 (methyl) 4 (thio)uracil, 5 (methylaminomethyl)-4 (thio)uracil, 5 (methyl) 2,4 (dithio)uracil, 5 (methylaminomethyl)-2,4 (dithio)uracil, 5 (2-aminopropyl)uracil, 5-(alkyl)uracil, 5-(alkynyl)uracil, 5-(allylamino)uracil, 5 (aminoallyl)uracil, 5 (aminoalkyl)uracil, 5 (guanidiniumalkyl)uracil, 5 (1,3-diazole-1-alkyl)uracil, 5-(cyanoalkyl)uracil, 5-(dialkylaminoalkyl)uracil, 5 (dimethylaminoalkyl)uracil, 5-(halo)uracil, 5-(methoxy)uracil, uracil-5 oxyacetic acid, 5 (methoxycarbonylmethyl)-2-(thio)uracil, 5 (methoxycarbonyl-methyl)uracil, 5 (propynyl)uracil, 5 (propynyl)uracil, 5 (trifluoromethyl)uracil, 6 (azo)uracil, dihydrouracil, N3 (methyl)uracil, 5-uracil (i.e., pseudouracil), 2 (thio)pseudouracil, 4 (thio)pseudouracil, 2,4-(dithio)psuedouracil, 5-(alkyl)pseudouracil, 5-(methyl)pseudouracil, 5-(alkyl)-2-(thio)pseudouracil, 5-(methyl)-2-(thio)pseudouracil, 5-(alkyl)-4 (thio)pseudouracil, 5-(methyl)-4 (thio)pseudouracil, 5-(alkyl)-2,4 (dithio)pseudouracil, 5-(methyl)-2,4 (dithio)pseudouracil, 1 substituted pseudouracil, 1 substituted 2(thio)-pseudouracil, 1 substituted 4 (thio)pseudouracil, 1 substituted 2,4-(dithio)pseudouracil, 1 (aminocarbonylethylenyl)-pseudouracil, 1 (aminocarbonylethylenyl)-2(thio)-pseudouracil, 1 (aminocarbonylethylenyl)-4 (thio)pseudouracil, 1 aminocarbonylethylenyl)-2,4-(dithio)pseudouracil, 1 (arninoalkylarninocarbonylethylenyl)-pseudouracil, 1 (arninoalkylarnino-carbonylethylenyl)-2(thio)-pseudouracil, 1(arninoalkylarninocarbonylethylenyl)-4 (thio)pseudouracil, 1 (arninoalkylarninocarbonylethylenyl)-2,4-(dithio)pseudouracil, 1,3-(diaza)-2-(oxo)-phenoxazin-1-yl, 1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl, 1,3-(diaza)-2-(oxo)-phenthiazin-1-yl, 1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl, 7-substituted 1,3-(diaza)-2-(oxo)-phenoxazin-1-yl, 7-substituted 1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl, 7-substituted 1,3-(diaza)-2-(oxo)-phenthiazin-1-yl, 7-substituted 1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl, 7-(arninoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl, 7-(arninoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl, 7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl, 7-(arninoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl, 7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl, 7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl, 7-(guanidiniumalkyl-hydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl, 7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl, 1,3,5-(triaza)-2,6-(dioxa)-naphthalene, inosine, xanthine, hypoxanthine, nubularine, tubercidine, isoguanisine, inosinyl, 2-aza-inosinyl, 7-deaza-inosinyl, nitroimidazolyl, nitropyrazolyl, nitrobenzimidazolyl, nitroindazolyl, aminoindolyl, pyrrolopyrimidinyl, 3-(methyl)isocarbostyrilyl, 5-(methyl)isocarbostyrilyl, 3-(methyl)-7-(propynyl)isocarbostyrilyl, 7-(aza)indolyl, 6-(methyl)-7-(aza)indolyl, imidizopyridinyl, 9-(methyl)-imidizopyridinyl, pyrrolopyrizinyl, isocarbostyrilyl, 7-(propynyl)isocarbostyrilyl, propynyl-7-(aza)indolyl, 2,4,5-(trimethyl)phenyl, 4-(methyl)indolyl, 4,6-(dimethyl)indolyl, phenyl, napthalenyl, anthracenyl, phenanthracenyl, pyrenyl, stilbenyl, tetracenyl, pentacenyl, diiluorotolyl, 4-(iluoro)-6-(methyl)benzimidazole, 4-(methyl)benzimidazole, 6-(azo)thymine, 2-pyridinone, 5 nitroindole, 3 nitropyrrole, 6-(aza)pyrimidine, 2 (amino)purine, 2,6-(diamino) purine, 5 substituted pyrimidines, N2-substituted purines, N6-substituted purines, 06-substituted purines, substituted 1,2,4-triazoles, pyrrolo-pyrimidin-2-on-3-yl, 6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, para-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, bis-ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, para-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, bis-ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl, pyridopyrimidin-3-yl, 2-oxo-7-amino-pyridopyrimidin-3-yl, 2-oxo-pyridopyrimidine-3-yl, or any O-alkylated or N-alkylated derivatives thereof.

[0148] The antisense oligonucleotides of the invention may be chimeric oligonucleotides. Chimeric antisense compounds of the invention may be formed as composite structures of two or more oligonucleotides, modified oligonucleotides, oligonucleotides and/or oligonucleotide mimetics as described above. Such compounds have also been referred to in the art as hybrids or mixed backbone or chimeric or gapmers. In particular a gapmer is an oligonucleotide that has at least three discrete portions, two of which are similar i.e. include one or more backbone modifications, and surround a region that is distinct, i.e., does not include backbone modifications.

[0149] The oligonucleotides may include a molecular species at one or both ends, i.e., at the 3 and/or 5 end. A molecular species as used herein refers to any compound that is not a naturally occurring or non-naturally occurring nucleotide. Molecular species include but are not limited to a spacer, a lipid, a sterol, lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-S-tritylthiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety, an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety, stearyl, C16 alkyl chain, bile acids, cholic acid, taurocholic acid, deoxycholate, oleyl litocholic acid, oleoyl cholenic acid, glycolipids, phospholipids, sphingolipids, isoprenoids, such as steroids, vitamins, such as vitamin E, saturated fatty acids, unsaturated fatty acids, fatty acid esters, such as triglycerides, pyrenes, porphyrines, Texaphyrine, adamantane, acridines, biotin, coumarin, fluorescein, rhodamine, Texas-Red, digoxygenin, dimethoxytrityl, t-butyldimethylsilyl, t-butyldiphenylsilyl, cyanine dyes (e.g. Cy3 or Cy576), Hoechst 33258 dye, psoralen, or ibuprofen.

[0150] The molecular species may be attached at various positions of the oligonucleotide. As described above, the molecular species may be linked to the 2-end, 3-end or 5-end of the oligonucleotide, where it also serves the purpose to enhance the stability of the oligomer against 3- or 5-exonucleases. Alternatively, it may be linked to an internal nucleotide or a nucleotide on a branch. The molecular species may be attached to a 2-position of the nucleotide. The molecular species may also be linked to the heterocyclic base of the nucleotide.

[0151] The molecular species may be connected to the oligonucleotide by a linker moiety. Optionally the linker moiety is a non-nucleotidic linker moiety. Non-nucleotidic linkers are e.g. abasic residues (dSpacer), oligoethyleneglycol, such as triethyleneglycol or hexaethylenegylcol, or alkane-diol, such as butanediol. The spacer units are preferably linked by phosphodiester, phosphorodithioate or phosphorothioate bonds. The linker units may appear just once in the molecule or may be incorporated several times, e.g. via phosphodiester, phosphorothioate, methylphosphonate, or amide linkages.

[0152] The oligonucleotide of the invention (separate from the linkers connecting nucleotides to the molecular species) may also contain non-nucleotidic linkers, in particular abasic linkers (dSpacers), trietyhlene glycol units or hexaethylene glycol units. Further preferred linkers are alkylamino linkers, such as C3, C6, C12 aminolinkers, and also alkylthiol linkers, such as C3 or C6 thiol linkers.

[0153] IL-17RA and TNF play a role in a wide variety of inflammatory disorders. An inflammatory disorder as used herein refers to a disorder in which IL-17 or TNF activity is detrimental to a particular physiological function in a subject. As used herein, the term a disorder in which IL-17 or TNF activity is detrimental is intended to include diseases and other disorders in which the levels of these cytokines expressed in a subject suffering from the disorder plays a role in the pathophysiology of the disorder or as a factor that contributes to a worsening of or maintenance of the disorder. Accordingly, a disorder in which IL-17 or TNF activity is detrimental is a disorder in which inhibition of IL-17/IL-17RA or TNF activity is expected to alleviate at least one symptom and/or progression or worsening of the disorder. Such disorders may be evidenced, for example, by an increase in the concentration of IL-17 or TNF in a biological fluid of a subject suffering from the disorder (e.g., an increase in the concentration of IL-17 or TNF in serum, plasma, synovial fluid, etc. of the subject), which can be detected, for example, using a probe or an antibody for detecting IL-17 or TNF message or protein respectively.

[0154] Inflammatory disorders include but are not limited to sepsis, infections, autoimmune diseases, cancer, transplant rejection and graft-versus-host disease, transplant rejection, malignancy, a pulmonary disorder, an intestinal disorder, a cardiac disorder, sepsis, a spondyloarthropathy, a metabolic disorder, anemia, pain, a hepatic disorder, a skin disorder, a nail disorder, rheumatoid arthritis, psoriasis, psoriasis in combination with psoriatic arthritis, ulcerative colitis, Crohn's disease, vasculitis, Behcet's disease, ankylosing spondylitis, asthma, chronic obstructive pulmonary disorder (COPD), idiopathic pulmonary fibrosis (IPF), restenosis, diabetes, anemia, pain, a Crohn's disease-related disorder, juvenile rheumatoid arthritis (JRA), a hepatitis C virus infection, psoriatic arthritis, and chronic plaque psoriasis.

[0155] The biological role played by IL-17 or TNF in these diseases is known. Inhibiting IL-17RA and/or TNF expression in these diseases provides a therapeutic treatment for the disorder.

[0156] The ASO-SNAs and mASO-SNAs may be administered alone or in conjunction with another therapeutic agent for the treatment of an inflammatory disorder. Non-limiting examples of therapeutic agents with which the ASO-SNAs and mASO-SNAs of the invention can be combined include the following: non-steroidal anti-inflammatory drug(s) (NSAIDs); cytokine suppressive anti-inflammatory drug(s) (CSAIDs); CDP-571/BAY-10-3356 (humanized anti-TNF antibody; Celltech/Bayer); cA2/infliximab (chimeric anti-TNF antibody; Centocor); 75 kdTNFR-IgG/etanercept (75 kD TNF receptor-IgG fusion protein; Immunex; 55 kdTNF-IgG (55 kD TNF receptor-IgG fusion protein; Hoffmann-LaRoche); IDEC-CE9/SB 210396 (non-depleting primatized anti-CD4 antibody; IDEC/SmithKline; DAB 486-IL-2 and/or DAB 389-IL-2 (IL-2 fusion proteins; Seragen; Anti-Tac (humanized anti-IL-2Ra; Protein Design Labs/Roche); IL-4 (anti-inflammatory cytokine; DNAX/Schering); IL-10 (SCH 52000; recombinant IL-10, anti-inflammatory cytokine; DNAX/Schering); IL-4; IL-10 and/or IL-4 agonists (e.g., agonist antibodies); IL-1 RA (IL-1 receptor antagonist; Synergen/Amgen); anakinra (Kineret/Amgen); TNF-bp/s-TNF (soluble TNF binding protein); R973401 (phosphodiesterase Type IV inhibitor; MK-966 (COX-2 Inhibitor; Iloprost; methotrexate; thalidomide and thalidomide-related drugs (e.g., Celgen); leflunomide (anti-inflammatory and cytokine inhibitor; tranexamic acid (inhibitor of plasminogen activation; T-614 (cytokine inhibitor; prostaglandin E1; Tenidap (non-steroidal anti-inflammatory drug; Naproxen (non-steroidal anti-inflammatory drug; Meloxicam (non-steroidal anti-inflammatory drug); Ibuprofen (non-steroidal anti-inflammatory drug); Piroxicam (non-steroidal anti-inflammatory drug); Diclofenac (non-steroidal anti-inflammatory drug); Indomethacin (non-steroidal anti-inflammatory drug); Sulfasalazine; Azathioprine; ICE inhibitor (inhibitor of the enzyme interleukin-1-beta-converting enzyme); zap-70 and/or Ick inhibitor (inhibitor of the tyrosine kinase zap-70 or Ick); VEGF inhibitor and/or VEGF-R inhibitor (inhibitors of vascular endothelial cell growth factor or vascular endothelial cell growth factor receptor; inhibitors of angiogenesis); corticosteroid anti-inflammatory drugs (e.g., SB203580); TNF-convertase inhibitors; anti-IL-12 antibodies; anti-IL-18 antibodies; interleukin-11; interleukin-13; interleukin-17 inhibitors; gold; penicillamine; chloroquine; hydroxychloroquine; chlorambucil; cyclosporine; cyclophosphamide; total lymphoid irradiation; anti-thymocyte globulin; anti-CD4 antibodies; CD5-toxins; orally-administered peptides and collagen; lobenzarit disodium; Cytokine Regulating Agents (CRAs) HP228 and HP466 (Houghten Pharmaceuticals, Inc.); ICAM-1 antisense phosphorothioate oligodeoxynucleotides (ISIS 2302; Isis Pharmaceuticals, Inc.); soluble complement receptor 1 (TP10; T Cell Sciences, Inc.); prednisone; orgotein; glycosaminoglycan polysulphate; minocycline; anti-IL2R antibodies; marine and botanical lipids (fish and plant seed fatty acids; auranofin; phenylbutazone; meclofenamic acid; flufenamic acid; intravenous immune globulin; zileuton; azaribine; mycophenolic acid (RS-61443); tacrolimus (FK-506); sirolimus (rapamycin); amiprilose (therafectin); cladribine (2-chlorodeoxyadenosine); methotrexate; antivirals; and immune modulating agents.

[0157] Toxicity and efficacy of the prophylactic and/or therapeutic protocols of the present invention can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD.sub.50/ED.sub.50. Prophylactic and/or therapeutic agents that exhibit large therapeutic indices are preferred. While prophylactic and/or therapeutic agents that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such agents to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.

[0158] The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage of the prophylactic and/or therapeutic agents for use in humans. The dosage of such agents lies preferably within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any agent used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC.sub.50 (i.e., the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography. A number of studies have examined the optimal dosages for antisense oligonucleotides.

[0159] In certain embodiments, pharmaceutical compositions may comprise, for example, at least about 0.000001% (w/w) of an active compound. In other embodiments, the active compound may comprise between about 2% to about 75% of the weight of the unit (w/w), or between about 25% to about 60%, for example, and any range derivable therein. In some embodiments, the active compound (e.g., oligonucleotide or nanostructure) described herein comprises between 0.000001% and 0.00001%, between 0.00001% and 0.0001%, between 0.0001% and 0.001%, between 0.001% and 0.01%, between 0.01% and 0.1%, between 0.1% and 1%, between 1% and 5%, between 5% and 10%, between 10% and 15%, between 15% and 20%, between 20% and 25%, between 25% and 30%, between 30% and 40%, between 40% and 50% (w/w), and any range derivable in between. In some embodiments, the active compound (e.g., oligonucleotide or nanostructure) described herein comprises 0.00007%, 0.007%, 0.01%, 0.1%, 1% (w/w)

[0160] Subject doses of the compounds described herein typically range from about 0.1 g to 10,000 mg, more typically from about 1 g/day to 8000 mg, and most typically from about 10 g to 100 g. Stated in terms of subject body weight, typical dosages range from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 microgram/kg/body weight, about 50 microgram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 microgram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein. In non-limiting examples of a derivable range from the numbers listed herein, a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc., can be administered, based on the numbers described above. The absolute amount will depend upon a variety of factors including the concurrent treatment, the number of doses and the individual patient parameters including age, physical condition, size and weight. These are factors well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is preferred generally that a maximum dose be used, that is, the highest safe dose according to sound medical judgment.

[0161] Multiple doses of the molecules of the invention are also contemplated. In some instances, when the molecules of the invention are administered with another therapeutic, for instance, an anti-inflammatory agent, a sub-therapeutic dosage of either the molecules or the other agent, or a sub-therapeutic dosage of both, is used in the treatment of a subject having, or at risk of developing an inflammatory disorder. When the two classes of drugs are used together, the other agent may be administered in a sub-therapeutic dose to produce a desirable therapeutic result. A sub-therapeutic dose as used herein refers to a dosage which is less than that dosage which would produce a therapeutic result in the subject if administered in the absence of the other agent. Thus, the sub-therapeutic dose of a therapeutic agent is one which would not produce the desired therapeutic result in the subject in the absence of the administration of the molecules of the invention. Therapeutic doses of agents useful for treating inflammatory disorders are well known in the field of medicine. These dosages have been extensively described in references such as Remington's Pharmaceutical Sciences; as well as many other medical references relied upon by the medical profession as guidance for the treatment of infectious disease, cancer, and autoimmune disease. Therapeutic dosages of oligonucleotides have also been described in the art.

[0162] Dosing regimens may be several times a day, daily, every other day, weekly, biweekly any of the times there between or less frequently. The term biweekly dosing as used herein, refers to the time course of administering a substance (e.g., an anti-IL-17RA nucleic acid) to a subject once every two weeks. The oligonucleotides may be administered every 7-20 days, every 11-17 days, or every 13-15 days, for example.

[0163] In some embodiments, a compound (e.g., oligonucleotide, nanostructure, etc.) described herein is administered for 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 72, 96, 120, 240, 480 hours, or any ranges in between, per dose in a dosing schedule.

[0164] The oligonucleotides are administered in effective amounts. The effective amount of a compound of the invention in the treatment of a disease described herein may vary depending upon the specific compound used, the mode of delivery of the compound, and whether it is used alone or in combination. The effective amount for any particular application can also vary depending on such factors as the disease being treated, the particular compound being administered, the size of the subject, or the severity of the disease or condition. One of ordinary skill in the art can empirically determine the effective amount of a particular molecule of the invention without necessitating undue experimentation. Combined with the teachings provided herein, by choosing among the various active compounds and weighing factors such as potency, relative bioavailability, patient body weight, severity of adverse side-effects and preferred mode of administration, an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is entirely effective to treat the particular subject.

[0165] In some embodiments, the cell is contacted with an oligonucleotide, a nanostructure, or a mASO-SNA described herein at a concentration of at least 0.001 nM, at least 0.01 nM, at least 0.1 nM, at least 1 nM, at least 10 nM, at least 100 nM, at least 1000 nM, at least 10 M, at least 100 M, at least 1000 M, or above 1000 M. In some embodiments, the cell is contacted with an oligonucleotide, a nanostructure, or a mASO-SNA described herein at a concentration range of 0.001 nM to 0.01 nM, 0.01 nM to 0.1 nM, 0.1 nM to 1 nM, 1 nM to 10 nM, 10 nM to 100 nM, 100 nM to 1000 nM, 1000 nM to 10 M, 10 M to 100 M, or 100 M to 1000 M. In some embodiments, the cell is contacted with an oligonucleotide, a nanostructure, or a mASO-SNA described herein at a concentration of 0.001 nM, 0.01 nM, 0.1 nM, 1 nM, 10 nM, 100 nM, 1000 nM, 10 M, 100 M, 1000 M or above 1000 M.

[0166] The oligonucleotides described herein can be used alone or in conjugates with other molecules such as detection or cytotoxic agents in the detection and treatment methods of the invention, as described in more detail herein.

[0167] The oligonucleotide may be, for instance, coupled or conjugated to a detectable label. A detectable label is a moiety, the presence of which can be ascertained directly or indirectly. Generally, detection of the label involves an emission of energy by the label. The label can be detected directly by its ability to emit and/or absorb photons or other atomic particles of a particular wavelength (e.g., radioactivity, luminescence, optical or electron density, etc.). A label can be detected indirectly by its ability to bind, recruit and, in some cases, cleave another moiety which itself may emit or absorb light of a particular wavelength (e.g., epitope tag such as the FLAG epitope, enzyme tag such as horseradish peroxidase, etc.). An example of indirect detection is the use of a first enzyme label which cleaves a substrate into visible products. The label may be of a chemical, peptide or nucleic acid molecule nature although it is not so limited. Other detectable labels include radioactive isotopes such as P.sup.32 or H.sup.3, luminescent markers such as fluorochromes, optical or electron density markers, etc., or epitope tags such as the FLAG epitope or the HA epitope, biotin, avidin, and enzyme tags such as horseradish peroxidase, -galactosidase, etc. The label may be bound to an oligonucleotide during or following its synthesis. There are many different labels and methods of labeling known to those of ordinary skill in the art. Examples of the types of labels that can be used in the present invention include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bioluminescent compounds. Those of ordinary skill in the art will know of other suitable labels for the oligonucleotides described herein, or will be able to ascertain such, using routine experimentation. Furthermore, the coupling or conjugation of these labels to the oligonucleotides of the invention can be performed using standard techniques common to those of ordinary skill in the art.

[0168] Conjugation of the oligonucleotides to a detectable label facilitates, among other things, the use of such agents in diagnostic assays. Another category of detectable labels includes diagnostic and imaging labels (generally referred to as in vivo detectable labels) such as for example magnetic resonance imaging (MRI): Gd(DOTA); for nuclear medicine: .sup.201Tl, gamma-emitting radionuclide 99mTc; for positron-emission tomography (PET): positron-emitting isotopes, (18)F-fluorodeoxyglucose ((18)FDG), (18)F-fluoride, copper-64, gadodiamide, and radioisotopes of Pb(II) such as 203Pb; 111In. In such instances, the use of the oligonucleotide could be observed as the oligonucleotide provides an antisense effect.

[0169] The conjugations or modifications described herein employ routine chemistry, which chemistry does not form a part of the invention and which chemistry is well known to those skilled in the art of chemistry. The use of protecting groups and known linkers such as mono- and hetero-bifunctional linkers are well documented in the literature and will not be repeated here.

[0170] As used herein, conjugated means two entities stably bound to one another by any physiochemical means. It is important that the nature of the attachment is such that it does not impair substantially the effectiveness of either entity. Keeping these parameters in mind, any covalent or non-covalent linkage known to those of ordinary skill in the art may be employed. In some embodiments, covalent linkage is preferred. Noncovalent conjugation includes hydrophobic interactions, ionic interactions, high affinity interactions such as biotin-avidin and biotin-streptavidin complexation and other affinity interactions. Such means and methods of attachment are well known to those of ordinary skill in the art. A variety of methods may be used to detect the label, depending on the nature of the label and other assay components.

[0171] Pharmaceutical compositions of the present invention comprise an effective amount of one or more agents, dissolved or dispersed in a pharmaceutically acceptable carrier. The phrases pharmaceutical or pharmacologically acceptable refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. Moreover, for animal (e.g., human) administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards. The compounds are generally suitable for administration to humans. This term requires that a compound or composition be nontoxic and sufficiently pure so that no further manipulation of the compound or composition is needed prior to administration to humans.

[0172] As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art.

[0173] The agent may comprise different types of carriers depending on whether it is to be administered in solid, liquid, gel, cream, or aerosol form, and whether it need to be sterile for such routes of administration as injection. The present invention can be administered intravenously, intradermally, intraarterially, intralesionally, intratumorally, intracranially, intrathecally, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intratumorally, intramuscularly, intraperitoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, via eyedrops, orally, topically, locally, inhalation (e.g., aerosol inhalation), injection, infusion, continuous infusion, localized perfusion bathing target cells directly, via a catheter, via a lavage, in creams, in gel, in lipid compositions (e.g., liposomes), or by other method or any combination of the forgoing as would be known to one of ordinary skill in the art.

[0174] In any case, the composition may comprise various antioxidants to retard oxidation of one or more components. Additionally, the prevention of the action of microorganisms can be brought about by preservatives such as various antibacterial and antifungal agents, including but not limited to parabens (e.g., methylparabens, propylparabens), chlorobutanol, phenol, sorbic acid, thimerosal or combinations thereof.

[0175] The agent may be formulated into a composition in a free base, neutral or salt form. Pharmaceutically acceptable salts, include the acid addition salts, e.g., those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups also can be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine.

[0176] In embodiments where the composition is in a liquid form, a carrier can be a solvent or dispersion medium comprising but not limited to, water, ethanol, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol, etc.), lipids (e.g., triglycerides, vegetable oils, liposomes) and combinations thereof. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin; by the maintenance of the required particle size by dispersion in carriers such as, for example liquid polyol or lipids; by the use of surfactants such as, for example hydroxypropylcellulose; or combinations thereof such methods. In many cases, it will be preferable to include isotonic agents, such as, for example, sugars, sodium chloride or combinations thereof.

[0177] The compounds of the invention may be administered directly to a tissue. Direct tissue administration may be achieved by direct injection, topical application, or local application. The compounds may be administered once, or alternatively they may be administered in a plurality of administrations. If administered multiple times, the compounds may be administered via different routes. For example, the first (or the first few) administrations may be made directly into the affected tissue while later administrations may be systemic.

[0178] The formulations of the invention are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.

[0179] According to the methods of the invention, the compound may be administered in a pharmaceutical composition. In general, a pharmaceutical composition comprises the compound of the invention and a pharmaceutically-acceptable carrier. As used herein, a pharmaceutically-acceptable carrier means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients.

[0180] Pharmaceutically acceptable carriers include diluents, fillers, salts, buffers, stabilizers, solubilizers and other materials which are well-known in the art. Such preparations may routinely contain salt, buffering agents, preservatives, compatible carriers, and optionally other therapeutic agents. When used in medicine, the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically-acceptable salts thereof and are not excluded from the scope of the invention. Such pharmacologically and pharmaceutically-acceptable salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulfuric, nitric, phosphoric, maleic, acetic, salicylic, citric, formic, malonic, succinic, and the like. Also, pharmaceutically-acceptable salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts.

[0181] The compounds of the invention may be formulated into preparations in solid, semi-solid, liquid or gaseous forms such as tablets, capsules, powders, granules, ointments, solutions, depositories, inhalants and injections, and usual ways for oral, parenteral or surgical administration. The invention also embraces pharmaceutical compositions which are formulated for local administration, such as by implants.

[0182] Compositions suitable for oral administration may be presented as discrete units, such as capsules, tablets, lozenges, each containing a predetermined amount of the active agent. Other compositions include suspensions in aqueous liquids or non-aqueous liquids such as a syrup, elixir or an emulsion.

[0183] For oral administration, the compounds can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art. Such carriers enable the compounds of the invention to be formulated as tablets, pills, dragees, capsules, liquids, gels, thermoreversible hydrogels such as pluronic F-127, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated. Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. Optionally the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.

[0184] Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.

[0185] Pharmaceutical preparations which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added. Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.

[0186] For buccal administration, the compositions may take the form of tablets or lozenges formulated in conventional manner.

[0187] For administration by inhalation, the compounds for use according to the present invention may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g. gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch. Techniques for preparing aerosol delivery systems are well known to those of skill in the art.

[0188] The compounds, when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.

[0189] Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like. Lower doses will result from other forms of administration, such as intravenous administration. In the event that a response in a subject is insufficient at the initial doses applied, higher doses (or effectively higher doses by a different, more localized delivery route) may be employed to the extent that patient tolerance permits. Multiple doses per day are contemplated to achieve appropriate systemic levels of compounds.

[0190] The compositions of the invention may be formulated in a topical composition for administration to the skin or a body cavity. Suitable topical vehicles and vehicle components are well known in the cosmetic and pharmaceutical arts, and include such vehicles (or vehicle components) as water; thermoreversible hydrogels such as pluronic F-127, organic solvents such as alcohols (particularly lower alcohols readily capable of evaporating from the skin such as ethanol), glycols (such as propylene glycol, butylene glycol, and glycerin), aliphatic alcohols (such as lanolin); mixtures of water and organic solvents (such as water and alcohol), and mixtures of organic solvents such as alcohol and glycerin (optionally also with water); lipid-based materials such as fatty acids, acylglycerols (including oils, such as mineral oil, and fats of natural or synthetic origin), phosphoglycerides, sphingolipids and waxes; protein-based materials such as collagen and gelatin; silicone-based materials (both non-volatile and volatile) such as cyclomethicone, demethiconol and dimethicone copolyol (Dow Corning); hydrocarbon-based materials such as petrolatum and squalane; anionic, cationic and amphoteric surfactants and soaps; sustained-release vehicles such as microsponges and polymer matrices; stabilizing and suspending agents; emulsifying agents; and other vehicles and vehicle components that are suitable for administration to the skin, as well as mixtures of topical vehicle components as identified above or otherwise known to the art. The vehicle may further include components adapted to improve the stability or effectiveness of the applied formulation, such as preservatives, antioxidants, skin penetration enhancers, sustained release materials, and the like.

[0191] The choice of a suitable vehicle will depend on the particular physical form and mode of delivery that the formulation is to achieve. Examples of suitable forms include liquids (e.g., gargles and mouthwashes, including dissolved forms of the strontium cation as well as suspensions, emulsions and the like); solids and semisolids such as gels, foams, pastes, creams, ointments, sticks (as in lipsticks or underarm deodorant sticks), powders and the like; formulations containing liposomes or other delivery vesicles; rectal or vaginal suppositories, creams, foams, gels or ointments; and other forms. Typical modes of delivery include application using the fingers; application using a physical applicator such as a cloth, tissue, swab, stick or brush (as achieved for example by soaking the applicator with the formulation just prior to application, or by applying or adhering a prepared applicator already containing the formulationsuch as a treated or premoistened bandage, wipe, washcloth or stickto the skin); spraying (including mist, aerosol or foam spraying); dropper application (as for example with ear drops); sprinkling (as with a suitable powder form of the formulation); and soaking.

[0192] Topical formulations also include formulations for rectal and vaginal administration. Formulations for rectal administration may be presented as a suppository with a suitable base comprising, for example, cocoa butter. Formulations suitable for vaginal administration may be presented as tablets, pessaries, tampons, creams, gels, pastes, foams or spray formulations containing in addition to the active ingredient such carriers as are known in the art to be appropriate.

[0193] In yet other embodiments, a delivery vehicle is a biocompatible microparticle or implant that is suitable for implantation into the mammalian recipient. Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compound, increasing convenience to the subject and the physician. Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides.

[0194] In some embodiments the antisense nucleic acids of the invention are formulated as a stable self-assembling nanostructure. The nanostructure includes a IL-17RA antisense oligonucleotide, wherein the antisense oligonucleotide is associated with a core. The core may be a solid or a hollow core, such as a liposomal core. A solid core is a spherical shaped material that does not have a hollow center. The term spherical as used herein refers to a general shape and does not imply or is not limited to a perfect sphere or round shape. It may include imperfections.

[0195] Solid cores can be constructed from a wide variety of materials known to those skilled in the art including but not limited to: noble metals (gold, silver), transition metals (iron, cobalt) and metal oxides (silica). In addition, these cores may be inert, paramagnetic, or superparamagnetic. These solid cores can be constructed from either pure compositions of described materials, or in combinations of mixtures of any number of materials, or in layered compositions of materials. In addition, solid cores can be composed of a polymeric core such as amphiphilic block copolymers, hydrophobic polymers such as polystyrene, poly(lactic acid), poly(lactic co-glycolic acid), poly(glycolic acid), poly(caprolactone) and other biocompatible polymers known to those skilled in the art.

[0196] The core may alternatively be a hollow core, which has at least some space in the center region of a shell material. Hollow cores include liposomal cores and niosomes. A liposomal core as used herein refers to a centrally located core compartment formed by a component of the lipids or phospholipids that form a lipid bilayer. Liposomes are artificial, self closed vesicular structure of various sizes and structures, where one or several membranes encapsulate an aqueous core. Most typically liposome membranes are formed from lipid bilayers membranes, where the hydrophilic head groups are oriented towards the aqueous environment and the lipid chains are embedded in the lipophilic core. Liposomes can be formed as well from other amphiphilic monomeric and polymeric molecules, such as polymers, like block copolymers, or polypeptides. Unilamellar vesicles are liposomes defined by a single membrane enclosing an aqueous space. In contrast, oligo- or multilamellar vesicles are built up of several membranes. Typically, the membranes are roughly 4 nm thick and are composed of amphiphilic lipids, such as phospholipids, of natural or synthetic origin. Optionally, the membrane properties can be modified by the incorporation of other lipids such as sterols or cholic acid derivatives.

[0197] The lipid bilayer is composed of two layers of lipid molecules. Each lipid molecule in a layer is oriented substantially parallel to adjacent lipid bilayers, and two layers that form a bilayer have the polar ends of their molecules exposed to the aqueous phase and the non-polar ends adjacent to each other. The central aqueous region of the liposomal core may be empty or filled fully or partially with water, an aqueous emulsion, oligonucleotides, or other therapeutic or diagnostic agents.

[0198] Niosomes are vesicles formed from non-ionic surfactant oriented in a bilayer. Niosomes commonly have cholesterol added as an excipient, but other lipid-based and non-lipid-based constituents can also be included. Methods for preparation of niosomes are known in the art. In some embodiments polyethylene glycol (PEG) is included during or following niosome preparation. Niosome vesicles are structurally and functionally analogous to liposomes, but are based on non-ionic surfactant rather than lipid as the primary constiuent. Common non-ionic surfactants used include sorbitans (spans) or polysorbates (tween); however, a wide variety of non-ionic surfactants can be used to prepare niosomes.

[0199] Lipid refers to its conventional sense as a generic term encompassing fats, lipids, alcohol-ether-soluble constituents of protoplasm, which are insoluble in water. Lipids usually consist of a hydrophilic and a hydrophobic moiety. In water lipids can self organize to form bilayers membranes, where the hydrophilic moieties (head groups) are oriented towards the aqueous phase, and the lipophilic moieties (acyl chains) are embedded in the bilayers core. Lipids can comprise as well two hydrophilic moieties (bola amphiphiles). In that case, membranes may be formed from a single lipid layer, and not a bilayer. Typical examples for lipids in the current context are fats, fatty oils, essential oils, waxes, steroid, sterols, phospholipids, glycolipids, sulpholipids, aminolipids, chromolipids, and fatty acids. The term encompasses both naturally occurring and synthetic lipids. Preferred lipids in connection with the present invention are: steroids and sterol, particularly cholesterol, phospholipids, including phosphatidyl, phosphatidylcholines and phosphatidylethanolamines and sphingomyelins. Where there are fatty acids, they could be about 12-24 carbon chains in length, containing up to 6 double bonds. The fatty acids are linked to the backbone, which may be derived from glycerol. The fatty acids within one lipid can be different (asymmetric), or there may be only 1 fatty acid chain present, e.g. lysolecithins. Mixed formulations are also possible, particularly when the non-cationic lipids are derived from natural sources, such as lecithins (phosphatidylcholines) purified from egg yolk, bovine heart, brain, liver or soybean.

[0200] The liposomal core can be constructed from one or more lipids known to those in the art including but not limited to: 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dimyristoyl-sn-phosphatidylcholine (DMPC), 1-palmitoyl-2-oleoyl-sn-phosphatidylcholine (POPC), 1,2-distearoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DSPG), 1,2-dioleoyl-sn-glycero-3-phospho-(1-rac-glycerol) (DOPG), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine (DOPE), and 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (DPPE), sphingolipids such as sphingosine, sphingosine phosphate, methylated sphingosines and sphinganines, ceramides, ceramide phosphates, 1-0 acyl ceramides, dihydroceramides, 2-hydroxy ceramides, sphingomyelin, glycosylated sphingolipids, sulfatides, gangliosides, phosphosphingolipids, and phytosphingosines of various lengths and saturation states and their derivatives, phospholipids such as phosphatidylcholines, lysophosphatidylcholines, phosphatidic acids, lysophosphatidic acids, cyclic LPA, phosphatidylethanolamines, lysophosphatidylethanolamines, phosphatidylglycerols, lysophosphatidylglycerols, phosphatidylserines, lysophosphatidylserines, phosphatidylinositols, inositol phosphates, LPI, cardiolipins, lysocardiolipins, bis(monoacylglycero) phosphates, (diacylglycero) phosphates, ether lipids, diphytanyl ether lipids, and plasmalogens of various lengths, saturation states, and their derivatives, sterols such as cholesterol, desmosterol, stigmasterol, lanosterol, lathosterol, diosgenin, sitosterol, zymosterol, zymostenol, 14-demethyl-lanosterol, cholesterol sulfate, DHEA, DHEA sulfate, 14-demethyl-14-dehydrlanosterol, sitostanol, campesterol, ether anionic lipids, ether cationic lipids, lanthanide chelating lipids, A-ring substituted oxysterols, B-ring substituted oxysterols, D-ring substituted oxysterols, side-chain substituted oxysterols, double substituted oxysterols, cholestanoic acid derivatives, fluorinated sterols, fluorescent sterols, sulfonated sterols, phosphorylated sterols, and polyunsaturated sterols of different lengths, saturation states, and their derivatives.

[0201] In certain embodiments, the diameter of the core is from 1 nm to about 250 nm in mean diameter, about 1 nm to about 240 nm in mean diameter, about 1 nm to about 230 nm in mean diameter, about 1 nm to about 220 nm in mean diameter, about 1 nm to about 210 nm in mean diameter, about 1 nm to about 200 nm in mean diameter, about 1 nm to about 190 nm in mean diameter, about 1 nm to about 180 nm in mean diameter, about 1 nm to about 170 in mean diameter, about 1 nm to about 160 nm in mean diameter, about 1 nm to about 150 nm in mean diameter, about 1 nm to about 140 nm in mean diameter, about 1 nm to about 130 nm in mean diameter, about 1 nm to about 120 nm in mean diameter, about 1 nm to about 110 nm in mean diameter, about 1 nm to about 100 nm in mean diameter, about 1 nm to about 90 nm in mean diameter, about 1 nm to about 80 nm in mean diameter, about 1 nm to about 70 nm in mean diameter, about 1 nm to about 60 nm in mean diameter, about 1 nm to about 50 nm in mean diameter, about 1 nm to about 40 nm in mean diameter, about 1 nm to about 30 nm in mean diameter, or about 1 nm to about 20 nm in mean diameter, or about 1 nm to about 10 nm in mean diameter.

[0202] The oligonucleotides may be positioned on the exterior of the core, within the walls of the core and/or in the center of the core. An oligonucleotide that is positioned on the core is typically referred to as coupled to the core. Coupled may be direct or indirect. In some embodiments at least 5, 10, 15, 25, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 5000 or 10,000 oligonucleotides or any range combination thereof are on the exterior of the core. In some embodiments, 1-1000, 10-500, 50-250, or 50-300 oligonucleotides are present on the surface.

[0203] The oligonucleotides of the oligonucleotide shell may be oriented in a variety of directions. In some embodiments the oligonucleotides are oriented radially outwards. The orientation of these oligonucleotides can be either 5 distal/3 terminal in relation to the core, or 3 distal/5terminal in relation to the core, or laterally oriented around the core. In one embodiment one or a multiplicity of different oligonucleotides are present on the same surface of a single SNA. In all cases, at least 1 oligonucleotide is present on the surface but up to 10,000 can be present.

[0204] The oligonucleotides may be linked to the core or to one another and/or to other molecules such an active agents either directly or indirectly through a linker. The oligonucleotides may be conjugated to a linker via the 5 end or the 3 end, e.g. [Sequence, 5-3]-Linker or Linker-[Sequence, 5-3]. Some or all of the oligonucleotides of the nanostructure may be linked to one another either directly or indirectly through a covalent or non-covalent linkage. The linkage of one oligonucleotide to another oligonucleotide may be in addition to or alternatively to the linkage of that oligonucleotide to liposomal core.

[0205] The oligonucleotide shell may be anchored to the surface of the core through one or multiple of linker molecules, including but not limited to: any chemical structure containing one or multiple thiols, such as the various chain length alkane thiols, cyclic dithiol, lipoic acid, or other thiol linkers known to those skilled in the art.

[0206] In an embodiment containing a liposomal core, the oligonucleotide shell may be anchored to the surface of the liposomal core through conjugation to one or a multiplicity of linker molecules including but not limited to: tocopherols, sphingolipids such as sphingosine, sphingosine phosphate, methylated sphingosines and sphinganines, ceramides, ceramide phosphates, 1-0 acyl ceramides, dihydroceramides, 2-hydroxy ceramides, sphingomyelin, glycosylated sphingolipids, sulfatides, gangliosides, phosphosphingolipids, and phytosphingosines of various lengths and saturation states and their derivatives, phospholipids such as phosphatidylcholines, lysophosphatidylcholines, phosphatidic acids, lysophosphatidic acids, cyclic LPA, phosphatidylethanolamines, lysophosphatidylethanolamines, phosphatidylglycerols, lysophosphatidylglycerols, phosphatidylserines, lysophosphatidylserines, phosphatidylinositols, inositol phosphates, LPI, cardiolipins, lysocardiolipins, bis(monoacylglycero) phosphates, (diacylglycero) phosphates, ether lipids, diphytanyl ether lipids, and plasmalogens of various lengths, saturation states, and their derivatives, sterols such as cholesterol, desmosterol, stigmasterol, lanosterol, lathosterol, diosgenin, sitosterol, zymosterol, zymostenol, 14-demethyl-lanosterol, cholesterol sulfate, DHEA, DHEA sulfate, 14-demethyl-14-dehydrlanosterol, sitostanol, campesterol, ether anionic lipids, ether cationic lipids, lanthanide chelating lipids, A-ring substituted oxysterols, B-ring substituted oxysterols, D-ring substituted oxysterols, side-chain substituted oxysterols, double substituted oxysterols, cholestanoic acid derivatives, fluorinated sterols, fluorescent sterols, sulfonated sterols, phosphorylated sterols, and polyunsaturated sterols of different lengths, saturation states, and their derivatives.

[0207] The oligonucleotide may also be associated with the core by being embedded within the core (liposomal core) or it may be attached or linked, either indirectly (i.e. non-covalently or covalently through other molecules such a linkers) or directly (i.e. covalently).

[0208] The invention also includes articles, which refers to any one or collection of components. In some embodiments the articles are kits. The articles include pharmaceutical or diagnostic grade compounds of the invention in one or more containers. The article may include instructions or labels promoting or describing the use of the compounds of the invention.

[0209] As used herein, promoted includes all methods of doing business including methods of education, hospital and other clinical instruction, pharmaceutical industry activity including pharmaceutical sales, and any advertising or other promotional activity including written, oral and electronic communication of any form, associated with compositions of the invention in connection with treatment of inflammatory disorders.

[0210] Instructions can define a component of promotion, and typically involve written instructions on or associated with packaging of compositions of the invention. Instructions also can include any oral or electronic instructions provided in any manner.

[0211] Thus the agents described herein may, in some embodiments, be assembled into pharmaceutical or diagnostic or research kits to facilitate their use in therapeutic, diagnostic or research applications. A kit may include one or more containers housing the components of the invention and instructions for use. Specifically, such kits may include one or more agents described herein, along with instructions describing the intended therapeutic application and the proper administration of these agents. In certain embodiments agents in a kit may be in a pharmaceutical formulation or pharmaceutical composition and dosage suitable for a particular application and for a method of administration of the agents.

[0212] The kit may be designed to facilitate use of the methods described herein by physicians and can take many forms. Each of the compositions of the kit, where applicable, may be provided in liquid form (e.g., in solution), or in solid form, (e.g., a dry powder). In certain cases, some of the compositions may be constitutable or otherwise processable (e.g., to an active form), for example, by the addition of a suitable solvent or other species (for example, water or a cell culture medium), which may or may not be provided with the kit. As used herein, instructions can define a component of instruction and/or promotion, and typically involve written instructions on or associated with packaging of the invention. Instructions also can include any oral or electronic instructions provided in any manner such that a user will clearly recognize that the instructions are to be associated with the kit, for example, audiovisual (e.g., videotape, DVD, etc.), Internet, and/or web-based communications, etc. The written instructions may be in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which instructions can also reflects approval by the agency of manufacture, use or sale for human administration.

[0213] The kit may contain any one or more of the components described herein in one or more containers. As an example, in one embodiment, the kit may include instructions for mixing one or more components of the kit and/or isolating and mixing a sample and applying to a subject. The kit may include a container housing agents described herein. The agents may be prepared sterilely, packaged in syringe and shipped refrigerated. Alternatively it may be housed in a vial or other container for storage. A second container may have other agents prepared sterilely. Alternatively the kit may include the active agents premixed and shipped in a syringe, vial, tube, or other container.

[0214] The kit may have a variety of forms, such as a blister pouch, a shrink wrapped pouch, a vacuum sealable pouch, a sealable thermoformed tray, or a similar pouch or tray form, with the accessories loosely packed within the pouch, one or more tubes, containers, a box or a bag. The kit may be sterilized after the accessories are added, thereby allowing the individual accessories in the container to be otherwise unwrapped. The kits can be sterilized using any appropriate sterilization techniques, such as radiation sterilization, heat sterilization, or other sterilization methods known in the art. The kit may also include other components, depending on the specific application, for example, containers, cell media, salts, buffers, reagents, syringes, needles, a fabric, such as gauze, for applying or removing a disinfecting agent, disposable gloves, a support for the agents prior to administration etc.

[0215] The compositions of the kit may be provided as any suitable form, for example, as liquid solutions or as dried powders. When the composition provided is a dry powder, the powder may be reconstituted by the addition of a suitable solvent, which may also be provided. In embodiments where liquid forms of the composition are sued, the liquid form may be concentrated or ready to use. The solvent will depend on the compound and the mode of use or administration. Suitable solvents for drug compositions are well known and are available in the literature. The solvent will depend on the compound and the mode of use or administration.

[0216] The kits, in one set of embodiments, may comprise a carrier means being compartmentalized to receive in close confinement one or more container means such as vials, tubes, and the like, each of the container means comprising one of the separate elements to be used in the method. For example, one of the containers may comprise a positive control for an assay. Additionally, the kit may include containers for other components, for example, buffers useful in the assay.

[0217] The present invention also encompasses a finished packaged and labeled pharmaceutical product. This article of manufacture includes the appropriate unit dosage form in an appropriate vessel or container such as a glass vial or other container that is hermetically sealed. In the case of dosage forms suitable for parenteral administration the active ingredient is sterile and suitable for administration as a particulate free solution. In other words, the invention encompasses both parenteral solutions and lyophilized powders, each being sterile, and the latter being suitable for reconstitution prior to injection. Alternatively, the unit dosage form may be a solid suitable for oral, transdermal, topical or mucosal delivery.

[0218] In a preferred embodiment, the unit dosage form is suitable for intravenous, intramuscular or subcutaneous delivery. Thus, the invention encompasses solutions, preferably sterile, suitable for each delivery route.

[0219] As with any pharmaceutical product, the packaging material and container are designed to protect the stability of the product during storage and shipment. Further, the products of the invention include instructions for use or other informational material that advise the physician, technician or patient on how to appropriately prevent or treat the inflammatory disease or disorder. In other words, the article of manufacture includes instruction means indicating or suggesting a dosing regimen including, but not limited to, actual doses, monitoring procedures and other monitoring information.

[0220] More specifically, the invention provides an article of manufacture comprising packaging material, such as a box, bottle, tube, vial, container, sprayer, insufflator, intravenous (i.v.) bag, envelope and the like; and at least one unit dosage form of a pharmaceutical agent contained within said packaging material. The invention also provides an article of manufacture comprising packaging material, such as a box, bottle, tube, vial, container, sprayer, insufflator, intravenous (i.v.) bag, envelope and the like; and at least one unit dosage form of each pharmaceutical agent contained within said packaging material. The invention further provides an article of manufacture comprising packaging material, such as a box, bottle, tube, vial, container, sprayer, insufflator, intravenous (i.v.) bag, envelope and the like; and at least one unit dosage form of each pharmaceutical agent contained within said packaging material. The invention further provides an article of manufacture comprising a needle or syringe, preferably packaged in sterile form, for injection of the formulation, and/or a packaged alcohol pad.

[0221] This invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The invention is capable of other embodiments and of being practiced or of being carried out in various ways. Also, the phraseology and terminology used herein is for the purpose of description and should not be regarded as limiting. The use of including, comprising, or having, containing, involving, and variations thereof herein, is meant to encompass the items listed thereafter and equivalents thereof as well as additional items.

[0222] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

[0223] All references, including patent documents, disclosed herein are incorporated by reference in their entirety.

EXAMPLES

Example 1. Liposomal Spherical Nucleic Acid (SNA) Constructs Presenting Antisense Oligonucleotides (ASO) for Specific Knockdown of Interleukin 17 Receptor mRNA

Results

[0224] Experiment 1. In Vitro IL-17RA mRNA Knockdown Using Targeted SNAs

[0225] HFK cells were treated with 294 SNAs presenting one ASO sequence each of the sequences in Table 1 and human IL-17RA mRNA expression was measured by qRT-PCR. This was performed twice and the three SNAs showing the greatest inhibition of IL-17RA mRNA in multiple assays and having low off-target effects were chosen for further optimization by chemical modification. HFK cells were treated at larger dose ranges with SNAs presenting one ASO sequence of either IL17RA_219, IL17RA_282, IL17RA_285 or a non-complementary control. Targeted SNAs demonstrate target specific mRNA inhibition in a dose-dependent manner while the non-complementary control SNA has no considerable inhibition at all concentrations tested (FIG. 1). Targeted SNAs demonstrate similar IL-17RA mRNA inhibition in HEKa cells. Analyzing the dose-response data as a non-linear fit and calculating the half maximal inhibitory concentration (IC.sub.50) results in IC.sub.50 values of 124.2, 9.57 and 34.64 nM for IL17RA_285, IL17RA_219 and IL17RA_282, respectively. These results demonstrate that SNAs targeting IL-17RA mRNA can effectively inhibit gene expression in a specific manner in HFK cells.

Experiment 2. IL-17RA mRNA Knockdown Using Topically Applied Targeted SNAs in the Human Skin Equivalent, EpiDerm-FT

[0226] A human skin equivalent model treated topically with SNAs presenting either ASO sequence IL17RA_219 or IL17RA_282 targeting human IL-17RA mRNA resulted in target mRNA specific inhibition. IL17RA_219 and IL17RA_282 were chosen as the lead candidate compounds for further testing after taking into consideration the efficacy data collected in experiment 1. ASOs IL17RA_219 and IL17RA_282 exhibited the best combination of IC.sub.50 value, homology to other human mRNA sequences (as determined by BLAST) and cross-species conservation. IL-17RA mRNA expression is decreased in human skin equivalent tissues treated topically with SNAs presenting either ASO IL17RA_219 or ASO IL17RA_282 for 48 hours. Tissues treated with SNAs presenting the control ASO do not demonstrate an appreciable decrease in IL-17RA mRNA expression as measured by qRT-PCR (FIG. 2). Further, IL17RA_219 and IL17RA_282 exhibited no toxicity in HFKs and no cytokine induction in HFKs, HEKa cells and PBMCs from four different donors, up to 20 M DNA concentration. For these reasons, IL17RA_219 and IL17RA_282 were chosen for further testing. SNAs targeting IL-17RA delivered topically were shown to specifically inhibit mRNA expression in a human skin equivalent model.

[0227] Experiment 3. Ex Vivo IL-17RA mRNA Knockdown Using Topically Applied Targeted SNAs in Human Skin Explants

[0228] Human skin explants treated topically with SNAs presenting either ASO sequence IL17RA_219 or ASO sequence IL17RA_282 targeting human IL-17RA mRNA resulted in target mRNA specific inhibition. IL-17RA mRNA expression is decreased in human skin explant biopsies treated topically with SNAs presenting either ASO IL17RA_219 or ASO IL17RA_282 for 96 hours. Biopsies treated with SNAs presenting the control ASO do not demonstrate an appreciable decrease in IL-17RA mRNA expression as measured by qRT-PCR (FIG. 3). SNAs targeting IL-17RA delivered topically can specifically inhibit mRNA expression in human skin explants.

Experiment 4. TNF mRNA Knockdown Using a Mixture of SNAs

[0229] SNAs presenting either an anti-TNF or an anti-IL17RA ASO sequence were mixed together and co-administered to HFK cells. Mixed SNAs demonstrated target mRNA specific knockdown corresponding to the ASO sequence identity (FIG. 4, FIG. 5).

[0230] FIG. 4 shows TNF mRNA expression decreased in HFK cells treated with a mixture of anti-TNF-SNAs and anti-IL17RA-SNAs. FIG. 5 shows IL17RA mRNA expression is decreased in HFK cells treated with a mixture of anti-TNF-SNAs and anti-IL17RA-SNAs. Cells treated with control-SNAs do not demonstrate an appreciable decrease in TNF mRNA levels.

[0231] These results demonstrate that mixtures of SNAs targeting more than one mRNA can be co-administered and perform gene knockdown with respect to each target.

Experiment 5. Comparison of TNF mRNA Knockdown and IL17RA Knockdown Using Multiplexed SNAs

[0232] SNAs presenting one, two, or three ASO sequences demonstrated target mRNA specific knockdown in HFK cells corresponding to the ASO sequence identity. Only data obtained using SNAs multiplexed with two ASO sequences. SNAs were shown to serve as a platform capable of presenting multiple therapeutic modalities. These results demonstrate that ASO sequences targeting more than one mRNA can be co-delivered on the same SNA particle and perform gene knockdown with respect to each target (FIG. 7, FIG. 8).

[0233] When the two gene targets are in a related biological pathway, an additive knockdown effect can be observed for the downstream target (FIG. 8). TNF and IL17A cytokine signaling have been shown to have an additive and synergistic effect in their proinflammatory properties(3). This relationship indicates a shared or highly related signaling pathway, though the exact relationship is not well understood(4). The mRNA of the TNF cytokine as well as the receptor for IL17A, IL17RA were targeted. It is likely that the reduction of secreted TNF cytokine has an effect on IL17RA receptor turnover and expression.

[0234] Materials and Methods

[0235] Antisense Sequence Design. Antisense sequences, 18 nucleotides in length, targeting human IL-17RA mRNA (GeneBank Accession No. NM_014339.6) were determined based on the following parameters: Sfold Algorithm(2), % GC content, proximity to start codon, and the exclusion of CpG motifs (Table 1). Unless otherwise noted, antisense oligonucleotide sequences are divided into 3 regions: an internal, phosphorothioate linked gap region flanked by two external, 2-O-methyl wings. This gap-mer sequence is modified at the 3 end with two consecutive hexa(ethylene glycol) spacers and a terminal cholesterol.

[0236] Antisense oligonucleotide synthesis. All oligonucleotides were synthesized at the 1 mole scale employing universal UnyLinker Support 1000 (ChemGenes) on the Bioautomation MerMade 48 oligonucleotide synthesizer. The DNA, RNA, 2-O-Me monomers, hexa(ethylene glycol) spacers and cholesterol modifiers were obtained from ChemGenes Corporation. Coupling time was 1 minute for standard DNA bases and 3 minutes for modified bases. Linkages were either standard phosphodiesters or phosphorothioates made with 0.2 M phenylacetyl disulfide (PADS) in 1:1 lutidine:ACN as the sulfurization agent. Synthesis was performed DMT-off, in the 5 to 3 direction. After synthesis, the oligonucleotides were cleaved from the support and deprotected using a 4:1 mixture of ammonium hydroxide and ethanol at 55 C. for 16 hours. The oligonucleotides were purified via high performance liquid chromatography (HPLC) techniques. Molecular weights and extinction coefficients were determined using IDT OligoAnalyzer. Verification of oligonucleotide molecular weight was performed using matrix-assisted laser desorption/ionization (MALDI). Oligonucleotide concentration was determined by UV-absorbance at 260 nm on a microplate reader (BioTek) together with the calculated extinction coefficient from the IDT OligoAnalyzer. All oligonucleotides were sterile filtered using 0.2 m syringe filters (VWR). The oligonucleotide sequences are listed in Table 1.

[0237] Liposome synthesis. Liposomes were synthesized by extrusion of 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) hydrated in phosphate buffered saline solution (PBS) (137 mM NaCl, 10 mM phosphate, 2.7 mM KCl, pH 7.4, Hyclone) using 47 mm diameter polycarbonate membranes with 50 nm pores (Sterlitech). Liposome diameters were measured using dynamic light scattering using a Malvern Zetasizer Nano (Malvern Instruments). Lipid concentration was determined using a phospholipid assay kit (Sigma).

[0238] Cell Culture. Human neonatal foreskin keratinocytes (HFKs) and adult human epidermal keratinocytes (HEKa) were cultured in M154 media (Life Technologies) supplemented with Human Keratinocyte Growth Supplement (Life Technologies), 0.07 mM CaCl.sub.2, 10 g/mL gentamicin, and 0.25m/mL amphotericin B. Cells were maintained at 37 C. in a 5% CO.sub.2 humidified incubator. Fresh primary human peripheral blood mononuclear cells (PBMCs) from four different donors (Zenbio) were cultured in RPMI supplemented with 10% fetal bovine serum, 2 mM L-glutamine, 50 U/mL penicillin, and 50 mg/mL streptomycin. Cells were maintained at 37 C. in a 5% CO.sub.2 humidified incubator.

[0239] EpiDerm-FT Human Skin Equivalent Culture. The human skin equivalent model, EpiDerm-FT (Mattek), tissues were cultured according to the manufacturer's instructions. Briefly, upon receipt, tissues were incubated overnight with supplied maintenance media at 37 C. in a 5% CO.sub.2 humidified incubator. The following day, and every day after that for the length of the experiment, the media was replaced with fresh media. The tissues were maintained at 37 C. in a 5% CO.sub.2 humidified incubator throughout the length of the experiment.

[0240] Human Skin Explant Culture. Fresh human skin explant (Zenbio) was cleaned upon receipt. 8 mm punch biopsies were taken from the explant and placed into trans-well stands for culturing. DMEM supplemented with 2% FBS, 10 g/mL gentamicin, and 0.25 g/mL amphotericin B was supplied to the underside of the biopsies and changed every day for the length of the experiment. The biopsies were maintained at 37 C. in a 5% CO.sub.2 humidified incubator throughout the length of the experiment.

[0241] SNA Synthesis. SNAs were formulated by mixing a 100 molar excess (unless otherwise stated) of cholesterol-modified oligonucleotide to a liposome suspension in PBS and storing them overnight, protected from light, at 4 C. 294 different oligonucleotides (Table 1) were used for the synthesis process, specifically targeting human IL-17RA mRNA, and a control oligonucleotide of the same length and gap-mer chemical scheme that does not have any complementarity to known human genes (confirmed by BLAST).

[0242] Multiplex SNA Synthesis. SNAs were formulated by mixing a 200 molar excess (unless otherwise stated) of cholesterol-modified oligonucleotide to a liposome suspension in PBS and storing them overnight, protected from light, at 4 C. Four different oligonucleotides were used for the synthesis process: an antisense oligonucleotide targeting human IL-17RA, an antisense oligonucleotide targeting human TNF, an antisense oligonucleotide targeting human IL22RA1, and a same length control oligonucleotide that does not have any complementarity to known genes (confirmed by BLAST). For monoplex SNAs, the oligonucleotide population consisted of 33% targeted antisense oligonucleotide and 66% control oligonucleotide. For multiplex SNAs containing two different targeted antisense oligonucleotides, the oligonucleotide population consisted of 33% of each targeted antisense oligonucleotide and the remaining 33% control oligonucleotide (FIG. 6). For multiplex SNAs containing three different targeted antisense oligonucleotides, the oligonucleotide population consisted of 33% of each targeted antisense oligonucleotide. Control SNAs consisted of 100% of the control oligonucleotide (FIG. 6D).

[0243] Cell Culture Studies. HFKs were seeded at passage 5 in 96-well, tissue culture plates at a cell density of 17,000 cells per well. HEKa cells were seeded at passage 5 in 96-well, tissue culture plates at a cell density of 17,000 cells per well. Fresh PBMCs were isolated from cell suspension by centrifugation and seeded in 96-well, tissue culture plates at a cell density of 200,000 cells per well. Cells were allowed to rest in the incubator overnight following plating. Cells were treated with either an IL-17RA targeted antisense SNA or a non-complementary control SNA (confirmed by NCBI Blast), comprising the same gap-mer design and 3-chemical modifications, in fresh maintenance media. Unless otherwise stated, all treatments lasted 24 hours.

[0244] For the human skin equivalent model, EpiDerm-FT, and human skin explant tissues, treatments were applied in biological triplicate. Tissues were treated topically with either an SNA presenting the IL17RA_219 ASO, an SNA presenting the IL17RA_282 ASO, an SNA presenting the non-complementary control ASO or left untreated. The EpiDerm-FT tissues were treated for 48 hours and the human skin explant tissues were treated for 96 hours.

[0245] For multiplex SNA experiments, HFKs were seeded at passage 5 in 96-well, tissue culture plates at a cell density of 17,000 cells per well. Cells were allowed to rest in the incubator overnight following plating. Cells were treated in triplicate with either an IL-17RA targeted antisense SNA, TNF targeted antisense SNA, a multiplex SNA targeting more than one transcript or a non-complementary control SNA (confirmed by NCBI Blast), comprising the same gap-mer design and 3-chemical modifications, at concentrations of 1000, 100, 10 and 1 nM in fresh maintenance media.

[0246] Alamar Blue Viability Assay. For viability studies, HFKs were seeded at passage 5 in 96-well, tissue culture plates at a cell density of 15,000 cells per well. Cells were allowed to rest in the incubator overnight following plating. Cells were treated in triplicate with either an IL-17RA targeted antisense SNA or a non-complementary control (confirmed by NCBI Blast), comprising the same gap-mer design and 3 chemical modifications, at concentrations of 20, 10, 2 and 1 M for 24 hours. Briefly, treatments were removed and replace with a 10% solution of AlamarBlue reagent in M154 maintenance media. Cells were incubated at 37 C. for 3 hours in a 5% CO.sub.2 humidified incubator before measuring the fluorescence of each well (excitation 570 nm, emission 585 nm) with a microplate reader (BioTek). Percent viability was calculated by comparing fluorescent values of each treatment to those of the untreated cells.

[0247] Cytokine Q-Plex Array. After 24 hours of treatment, the cells in the 96-well tissue culture plates were pelleted by centrifugation; the supernatants were transferred to new plates and stored at 80 C. Cytokine quantification of the supernatants was performed using a Q-Plex chemiluminescent array (Quansys) following the manufacturer's instructions. Each plate was custom built to allow for the detection of IL-12p40, TNF, IP-10, IL-6, RANTES, IL-4, IL-5, IL-10, IL-17, IL-22 and MCP-1 within each well. Briefly, a standard curve was prepared using a cytokine stock of known concentration and diluting it as indicated. The cell culture supernatants were diluted 1:2 using the provided sample buffer. The cell culture samples and standard curve samples were added to the 96-well Q-plex plate and incubated at room temperature for 1 hour with shaking. The plate was then washed three times with the provided wash buffer. Then 50 L of provided Detection mix was added to each well and the plate was incubated again for 1 hour at room temperature with shaking. Again, the plate was washed three times with wash buffer, followed by incubation with 50 L of provided Streptavidin-HRP solution for 15 minutes at room temperature with shaking. Finally, the plate was washed six times in wash buffer and 50 L of a prepared substrate was added to each well. Within 15 minutes, the plate was imaged using a Bio-Rad ChemiDoc XRS+ imager and analyzed using the Q-view software (Quansys). All data was fit to the standard curves for each individual cytokine and plotted in comparison to untreated cells.

[0248] RNA Extraction and Quantitative Reverse Transcriptase Polymerase Chain Reaction (qRT-PCR). HFK and HEKa cells were lysed in RLT Buffer (Qiagen) at 24 hours post-transfection. EpiDerm-FT tissues and human skin explant tissues were bead homogenized in RLT buffer at 48 and 96 hours of treatment, respectively. RNA was isolated from lysates using the RNEasy 96-well kit (Qiagen) according to the manufacturer's instructions. cDNA was then synthesized from RNA isolates using the cDNA High Capacity Reverse Transcription Kit (Life Technologies). Samples were run on a thermocycler at 25 C. for 10 minutes, 37 C. for 90 minutes, 85 C. for 5 minutes and held at 4 C. to generate cDNA. qPCR was performed using 6 L of the synthesized cDNA, 4.66 L LightCycler480 Probes Master Mix (Roche), 0.47 L target specific FAM-labeled probe and primers, and 0.37 L human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) specific HEX-labeled probe and primers per reaction well of a 384-well optical reaction plate (Roche). The primer and probe sets for IL-17RA were purchased from ThermoFisher Scientific (catalogue number Hs01064648_m1). The primer and probe sets for TNF and GAPDH were designed using the known human genome sequence (NCBI reference sequences NM_000594.3 and NM_002046.5, respectively) and were found to be specific by blastn analysis (NCBI). The oligonucleotide sequences used for TNF were: forward 5-GCT GCA CTT TGG AGT GAT CG-3 (SEQ ID NO: 1), reverse 5-GTT TGC TAC AAC ATG GGC TAC AG-3 (SEQ ID NO: 2), probe 5-FAM-CCC AGG CAG TCA GAT CAT CTT CTC GA-BHQ1-3 (SEQ ID NO: 3). The oligonucleotide sequences used for GAPDH were: forward 5-CAA GGT CAT CCA TGA CAA CTT TG-3 (SEQ ID NO: 4), reverse 5-GGG CCA TCC ACA GTC TTC T-3 (SEQ ID NO: 5), probe 5-HEX-ACC ACA GTC CAT GCC ATC ACT GCC A-BHQ1-3 (SEQ ID NO: 6). FAM is 6-fluorescein amidite, HEX is hexachloro-fluorescein, and BHQ1 is a black hole quencher 1. qPCR reactions, in technical duplicate, were carried out on the Roche Lightcycler 480 under the following conditions: initial denaturation at 95 C. for 10 minutes and then 50 cycles of denaturation at 95 C. for 10 seconds, annealing at 60 C. for 30 seconds and extension at 72 C. for 1 second. Cp values were obtained by analysis with the 2nd derivative method. Relative gene expression was determined by normalization with the housekeeping gene (GAPDH) and the -Ct method. Each treatment was compared to its respective concentration control.

TABLE-US-00011 TABLE1 OligonucleotideSequences Specialbasesusedintheoligonucleotidesare asfollows:mN=2O-methylRNA,/iSp18/= hexa(ethyleneglycol)spacer,*=phosphoro- thioate,/3CholTEG/=3cholesterol %IL17RA SEQ mRNA Compound OligonucleotideSequence ID Expres- ID (5'to3') NO: sion IL17RA_001 mUmCmGmCmGmGA*G*G*G*C*T*mCmGm 7 67 GmCmCmC/iSp18//iSp18//3CholTEG/ IL17RA_002 mGmUmCmGmCmGG*A*G*G*G*C*mUmCm 8 35 GmGmCmC/iSp18//iSp18//3CholTEG/ IL17RA_003 mCmGmUmCmGmCG*G*A*G*G*G*mCmUm 9 36 CmGmGmC/iSp18//iSp18//3CholTEG/ IL17RA_004 mAmCmGmGmCmGG*G*C*T*G*C*mGmUm 10 49 GmCmGmG/iSp18//iSp18//3CholTEG/ IL17RA_005 mGmAmCmGmGmCG*G*G*C*T*G*mCmGm 11 40 UmGmCmG/iSp18//iSp18//3CholTEG/ IL17RA_006 mAmCmUmCmUmGC*A*C*C*C*T*mCmGm 12 35 AmGmGmU/iSp18//iSp18//3CholTEG/ IL17RA_007 mGmGmGmCmUmGC*C*C*A*G*C*mAmGm 13 30 CmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_008 mUmGmUmGmUmGG*G*T*C*T*G*mUmGm 14 73 AmGmGmA/iSp18//iSp18//3CholTEG/ IL17RA_009 mGmGmCmGmUmGT*G*T*G*G*G*mUmCm 15 43 UmGmUmG/iSp18//iSp18//3CholTEG/ IL17RA_010 mGmGmGmCmGmUG*T*G*T*G*G*mGmUm 16 35 CmUmGmU/iSp18//iSp18//3CholTEG/ IL17RA_011 mAmGmGmGmCmGT*G*T*G*T*G*mGmGm 17 54 UmCmUmG/iSp18//iSp18//3CholTEG/ IL17RAv012 mUmAmGmGmGmCG*T*G*T*G*T*mGmGm 18 49 GmUmCmU/iSp18//iSp18//3CholTEG/ IL17RA_013 mAmGmCmUmCmCT*G*G*A*G*A*mUmGm 19 38 UmAmGmC/iSp18//iSp18//3CholTEG/ IL17RA_014 mGmAmGmCmUmCC*T*G*G*A*G*mAmUm 20 49 GmUmAmG/iSp18//iSp18//3CholTEG/ IL17RA_015 mGmGmAmGmCmUC*C*T*G*G*A*mGmAm 21 88 UmGmUmA/iSp18//iSp18//3CholTEG/ IL17RA_016 mCmCmCmUmCmGG*G*G*G*G*C*mUmGm 22 91 CmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_017 mGmGmGmAmGmAG*A*G*T*G*G*mCmAm 23 105 GmGmGmC/iSp18//iSp18//3CholTEG/ IL17RA_018 mCmGmGmGmAmGA*G*A*G*T*G*mGmCm 24 106 AmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_019 mAmCmGmAmUmAA*C*C*A*G*A*mCmCm 25 103 GmCmUmG/iSp18//iSp18//3CholTEG/ IL17RA_020 mGmGmGmAmGmCG*G*G*C*T*G*mUmGm 26 77 UmGmGmA/iSp18//iSp18//3CholTEG/ IL17RA_021 mAmCmAmUmAmGT*A*G*G*T*G*mCmAm 27 81 CmAmAmU/iSp18//iSp18//3CholTEG/ IL17RA_022 mCmAmCmAmUmAG*T*A*G*G*T*mGmCm 28 76 AmCmAmA/iSp18//iSp18//3CholTEG/ IL17RA_023 mGmGmGmUmCmUC*A*C*T*C*T*mGmCm 29 57 UmGmCmC/iSp18//iSp18//3CholTEG/ IL17RA_024 mGmGmGmCmAmGG*C*T*T*C*C*mAmCm 30 43 UmCmCmA/iSp18//iSp18//3CholTEG/ IL17RA_025 mAmAmAmGmCmUG*T*T*A*G*G*mAmGm 31 77 GmAmCmA/iSp18//iSp18//3CholTEG/ IL17RA_026 mUmAmAmAmGmCT*G*T*T*A*G*mGmAm 32 75 GmGmAmC/iSp18//iSp18//3CholTEG/ IL17RA_027 mAmUmAmAmAmGC*T*G*T*T*A*mGmGm 33 91 AmGmGmA/iSp18//iSp18//3CholTEG/ IL17RA_028 mAmCmCmGmGmCA*T*C*A*A*A*mUmUm 34 87 GmUmGmC/iSp18//iSp18//3CholTEG/ IL17RA_029 mAmAmCmCmGmGC*A*T*C*A*A*mAmUm 35 93 UmGmUmG/iSp18//iSp18//3CholTEG/ IL17RA_030 mCmUmGmGmAmUT*T*C*T*T*T*mUmGm 36 64 GmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_031 mGmCmUmGmGmAT*T*T*C*T*T*mUmUm 37 53 GmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_032 mGmGmCmUmGmGA*T*T*T*C*T*mUmUm 38 38 UmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_033 mGmGmGmCmUmGG*A*T*T*T*C*mUmUm 39 41 UmUmGmG/iSp18//iSp18//3CholTEG/ IL17RA_034 mGmGmGmGmCmUG*G*A*T*T*T*mCmUm 40 77 UmUmUmG/iSp18//iSp18//3CholTEG/ IL17RA_035 mGmGmGmAmGmGG*A*A*T*G*T*mGmAm 41 58 GmGmAmG/iSp18//iSp18//3CholTEG/ IL17RA_036 mGmCmUmGmAmAG*A*G*G*T*G*mGmGm 42 49 AmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_037 mGmAmGmCmCmUG*G*G*A*G*G*mUmCm 43 40 GmAmGmG/iSp18//iSp18//3CholTEG/ IL17RA_038 mGmGmGmAmGmGA*T*G*A*G*G*mCmGm 44 39 GmGmCmA/iSp18//iSp18//3CholTEG/ IL17RA_039 mUmGmGmGmAmGG*A*T*G*A*G*mGmCm 45 31 GmGmGmC/iSp18//iSp18//3CholTEG/ IL17RA_040 mUmUmUmAmGmGA*A*G*G*G*G*mAmG 46 60 mCmAmCmC/iSp18//iSp18//3CholTEG/ IL17RA_041 mAmUmUmUmAmGG*A*A*G*G*G*mGmA 47 57 mGmCmAmC/iSp18//iSp18//3CholTEG/ IL17RA_042 mUmAmUmUmUmAG*G*A*A*G*G*mGmG 48 57 mAmGmCmA/iSp18//iSp18//3CholTEG/ IL17RA_043 mUmUmAmUmUmUA*G*G*A*A*G*mGmG 49 23 mGmAmGmC/iSp18//iSp18//3CholTEG/ IL17RA_044 mCmAmUmUmUmAT*T*T*A*G*G*mAmAm 50 38 GmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_045 mUmCmAmUmUmUA*T*T*T*A*G*mGmAm 51 35 AmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_046 mGmGmGmAmUmGC*A*G*G*C*C*mCmGm 52 53 GmCmUmG/iSp18//iSp18//3CholTEG/ IL17RA_047 mAmAmAmGmAmGG*A*T*C*A*G*mUmGm 53 71 GmUmAmC/iSp18//iSp18//3CholTEG/ IL17RA_048 mGmAmAmAmGmAG*G*A*T*C*A*mGmUm 54 42 GmGmUmA/iSp18//iSp18//3CholTEG/ IL17RA_049 mUmGmGmGmUmUT*A*G*G*G*G*mUmA 55 48 mGmCmUmG/iSp18//iSp18//3CholTEG/ IL17RA_050 mAmUmGmGmGmUT*T*A*G*G*G*mGmUm 56 43 AmGmCmU/iSp18//iSp18//3CholTEG/ IL17RA_051 mAmAmUmGmGmGT*T*T*A*G*G*mGmGm 57 64 UmAmGmC/iSp18//iSp18//3CholTEG/ IL17RA_052 mUmGmCmAmAmUG*G*G*T*T*T*mAmGm 58 58 GmGmGmU/iSp18//iSp18//3CholTEG/ IL17RA_053 mGmUmGmCmAmAT*G*G*G*T*T*mUmAm 59 64 GmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_054 mUmGmUmGmCmAA*T*G*G*G*T*mUmUm 60 79 AmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_055 mUmUmGmUmGmCA*A*T*G*G*G*mUmUm 61 73 UmAmGmG/iSp18//iSp18//3CholTEG/ IL17RA_056 mCmUmUmGmUmGC*A*A*T*G*G*mGmUm 62 64 UmUmAmG/iSp18//iSp18//3CholTEG/ IL17RA_057 mGmCmUmUmGmUG*C*A*A*T*G*mGmGm 63 77 UmUmUmA/iSp18//iSp18//3CholTEG/ IL17RA_058 mAmGmCmUmUmGT*G*C*A*A*T*mGmGm 64 11 GmUmUmU/iSp18//iSp18//3CholTEG/ IL17RA_059 mCmAmGmCmUmUG*T*G*C*A*A*mUmGm 65 75 GmGmUmU/iSp18//iSp18//3CholTEG/ IL17RA_060 mGmGmGmCmAmUG*G*A*G*A*G*mCmCm 66 52 AmUmGmC/iSp18//iSp18//3CholTEG/ IL17RA_061 mUmCmUmGmGmGA*G*A*G*G*C*mGmA 67 47 mUmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_062 mGmGmGmAmGmGT*G*G*G*C*T*mGmGm 68 59 GmCmCmA/iSp18//iSp18//3CholTEG/ IL17RA_063 mAmCmUmCmCmCT*C*T*C*C*T*mCmCm 69 44 UmCmCmU/iSp18//iSp18//3CholTEG/ IL17RA_064 mUmAmCmUmCmCC*T*C*T*C*C*mUmCm 70 29 CmUmCmC/iSp18//iSp18//3CholTEG/ IL17RA_065 mGmGmGmAmGmGC*A*A*G*G*T*mCmUm 71 60 GmAmGmA/iSp18//iSp18//3CholTEG/ IL17RA_066 mUmCmAmGmGmGC*A*G*C*C*C*mGmGm 72 64 GmAmGmG/iSp18//iSp18//3CholTEG/ IL17RA_067 mCmAmCmUmCmCA*C*T*C*A*C*mCmUm 73 16 CmCmCmA/iSp18//iSp18//3CholTEG/ IL17RA_068 mGmGmGmUmGmCA*G*G*G*C*T*mUmCm 74 26 AmGmAmC/iSp18//iSp18//3CholTEG/ IL17RA_069 mGmCmGmGmGmUG*C*A*G*G*G*mCmUm 75 40 UmCmAmG/iSp18//iSp18//3CholTEG/ IL17RA_070 mCmUmGmUmUmUG*C*T*C*T*C*mCmUm 76 22 GmUmCmA/iSp18//iSp18//3CholTEG/ IL17RA_071 mCmCmUmGmUmUT*G*C*T*C*T*mCmCm 77 61 UmGmUmC/iSp18//iSp18//3CholTEG/ IL17RA_072 mUmCmCmUmGmUT*T*G*C*T*C*mUmCm 78 51 CmUmGmU/iSp18//iSp18//3CholTEG/ IL17RA_073 mGmUmCmCmUmGT*T*T*G*C*T*mCmUm 79 46 CmCmUmG/iSp18//iSp18//3CholTEG/ IL17RA_074 mUmGmUmCmCmUG*T*T*T*G*C*mUmCm 80 45 UmCmCmU/iSp18//iSp18//3CholTEG/ IL17RA_075 mCmUmGmUmCmCT*G*T*T*T*G*mCmUm 81 52 CmUmCmC/iSp18//iSp18//3CholTEG/ IL17RA_076 mGmGmCmUmAmGT*G*G*C*T*G*mGmGm 82 70 AmGmGmC/iSp18//iSp18//3CholTEG/ IL17RA_077 mGmGmAmAmUmGG*G*A*G*C*A*mGmA 83 63 mUmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_078 mGmGmGmCmUmUG*G*G*C*A*G*mGmU 84 32 mGmGmUmG/iSp18//iSp18//3CholTEG/ IL17RA_079 mGmGmGmAmUmGG*G*C*T*T*G*mGmGm 85 42 CmAmGmG/iSp18//iSp18//3CholTEG/ IL17RA_080 mGmGmUmCmUmCC*A*C*G*G*T*mGmAm 86 30 UmGmUmU/iSp18//iSp18//3CholTEG/ IL17RA_081 mGmUmAmAmUmGG*G*T*A*G*A*mUmU 87 22 mCmGmUmU/iSp18//iSp18//3CholTEG/ IL17RA_082 mGmGmUmAmAmUG*G*G*T*A*G*mAmU 88 40 mUmCmGmU/iSp18//iSp18//3CholTEG/ IL17RA_083 mUmGmGmUmAmAT*G*G*G*T*A*mGmAm 89 35 UmUmCmG/iSp18//iSp18//3CholTEG/ IL17RA_084 mCmUmGmGmUmAA*T*G*G*G*T*mAmGm 90 37 AmUmUmC/iSp18//iSp18//3CholTEG/ IL17RA_085 mGmGmGmCmGmCA*G*G*T*A*T*mGmUm 91 55 GmGmUmG/iSp18//iSp18//3CholTEG/ IL17RA_086 mGmGmCmUmGmAG*T*A*G*A*T*mGmAm 92 65 UmCmCmA/iSp18//iSp18//3CholTEG/ IL17RA_087 mCmGmCmGmCmCG*A*A*C*A*G*mGmUm 93 63 CmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_088 mGmUmAmGmAmGG*T*T*C*T*C*mAmCm 94 57 AmUmUmC/iSp18//iSp18//3CholTEG/ IL17RA_089 mCmCmGmCmCmCG*G*G*C*T*C*mCmGm 95 83 CmAmGmG/iSp18//iSp18//3CholTEG/ IL17RA_090 mCmCmCmUmGmGG*C*A*G*G*C*mUmUm 96 67 CmCmAmC/iSp18//iSp18//3CholTEG/ IL17RA_091 mCmAmAmUmGmGG*T*T*T*A*G*mGmGm 97 66 GmUmAmG/iSp18//iSp18//3CholTEG/ IL17RA_092 mGmCmAmAmUmGG*G*T*T*T*A*mGmGm 98 64 GmGmUmA/iSp18//iSp18//3CholTEG/ IL17RA_093 mGmGmAmGmGmAT*G*A*G*G*C*mGmGm 99 68 GmCmAmG/iSp18//iSp18//3CholTEG/ IL17RA_094 mGmUmGmCmGmGC*C*C*C*C*A*mUmGm 100 79 GmCmCmC/isp18//isp18//3CholTEG/ IL17RA_095 mCmGmUmGmCmGG*C*C*C*C*C*mAmUm 101 74 GmGmCmC/isp18//isp18//3CholTEG/ IL17RA_096 mGmCmGmUmGmCG*G*C*C*C*C*mCmAm 102 72 UmGmGmC/isp18//isp18//3CholTEG/ IL17RA_097 mUmGmCmGmUmGC*G*G*C*C*C*mCmCm 103 77 AmUmGmG/isp18//isp18//3CholTEG/ IL17RA_098 mCmUmGmCmGmUG*C*G*G*C*C*mCmCm 104 58 CmAmUmG/isp18//isp18//3CholTEG/ IL17RA_099 mCmGmGmGmCmUG*C*G*T*G*C*mGmGm 105 83 CmCmCmC/isp18//isp18//3CholTEG/ IL17RA_100 mGmCmGmGmGmCT*G*C*G*T*G*mCmGm 106 84 GmCmCmC/isp18//isp18//3CholTEG/ IL17RA_101 mGmGmCmGmGmGC*T*G*C*G*T*mGmCm 107 75 GmGmCmC/isp18//isp18//3CholTEG/ IL17RA_102 mUmCmGmCmAmGG*G*A*G*G*C*mGmCm 108 87 CmAmCmC/isp18//isp18//3CholTEG/ IL17RA_103 mGmUmCmGmCmAG*G*G*A*G*G*mCmGm 109 72 CmCmAmC/isp18//isp18//3CholTEG/ IL17RA_104 mUmUmCmGmAmUG*T*G*A*G*C*mCmAm 110 74 CmGmGmG/isp18//isp18//3CholTEG/ IL17RA_105 mCmCmAmUmUmCG*A*T*G*T*G*mAmGm 111 76 CmCmAmC/isp18//isp18//3CholTEG/ IL17RA_106 mGmAmUmAmAmCT*C*T*G*C*A*mCmCm 112 84 CmUmCmG/isp18//isp18//3CholTEG/ IL17RA_107 mGmGmCmUmUmGG*G*C*A*G*G*mUmG 113 65 mGmUmGmA/isp18//isp18//3CholTEG/ IL17RA_108 mUmGmGmGmCmUT*G*G*G*C*A*mGmGm 114 37 UmGmGmU/isp18//isp18//3CholTEG/ IL17RA_109 mAmAmUmGmGmGT*A*G*A*T*T*mCmGm 115 44 UmUmCmC/isp18//isp18//3CholTEG/ IL17RA_110 mUmAmAmUmGmGG*T*A*G*A*T*mUmCm 116 62 GmUmUmC/isp18//isp18//3CholTEG/ IL17RA_111 mUmCmCmCmCmCG*C*C*A*G*T*mGmCm 117 57 CmAmGmC/isp18//isp18//3CholTEG/ IL17RA_112 mCmCmCmUmCmUG*A*C*T*C*T*mGmAm 118 57 CmCmCmC/isp18//isp18//3CholTEG/ IL17RA_113 mGmGmGmCmCmCC*T*C*T*G*A*mCmUm 119 85 CmUmGmA/isp18//isp18//3CholTEG/ IL17RA_114 mUmGmGmGmCmCC*C*T*C*T*G*mAmCm 120 76 UmCmUmG/isp18//isp18//3CholTEG/ IL17RA_115 mCmUmGmGmGmCC*C*C*T*C*T*mGmAm 121 64 CmUmCmU/isp18//isp18//3CholTEG/ IL17RA_116 mAmGmGmGmUmCT*C*A*C*T*C*mUmGm 122 8 CmUmGmC/isp18//isp18//3CholTEG/ IL17RA_117 mCmAmGmGmGmUC*T*C*A*C*T*mCmUm 123 55 GmCmUmG/isp18//isp18//3CholTEG/ IL17RA_118 mAmCmAmGmGmGT*C*T*C*A*C*mUmCm 124 59 UmGmCmU/isp18//isp18//3CholTEG/ IL17RA_119 mGmAmCmAmGmGG*T*C*T*C*A*mCmUm 125 60 CmUmGmC/isp18//isp18//3CholTEG/ IL17RA_120 mAmGmAmCmAmGG*G*T*C*T*C*mAmCm 126 70 UmCmUmG/isp18//isp18//3CholTEG/ IL17RA_121 mGmAmGmAmCmAG*G*G*T*C*T*mCmAm 127 83 CmUmCmU/isp18//isp18//3CholTEG/ IL17RA_122 mUmGmAmGmAmCA*G*G*G*T*C*mUmCm 128 78 AmCmUmC/isp18//isp18//3CholTEG/ IL17RA_123 mGmCmAmGmGmCT*T*C*C*A*C*mUmCm 129 60 CmAmUmC/isp18//isp18//3CholTEG/ IL17RA_124 mCmUmCmCmAmCT*C*A*C*C*T*mCmCm 130 62 CmAmGmC/isp18//isp18//3CholTEG/ IL17RA_125 mAmCmUmCmCmAC*T*C*A*C*C*mUmCm 131 78 CmCmAmG/isp18//isp18//3CholTEG/ IL17RA_126 mGmCmUmCmAmCT*C*C*A*C*T*mCmAm 132 91 CmCmUmC/isp18//isp18//3CholTEG/ IL17RA_127 mAmGmCmUmCmAC*T*C*C*A*C*mUmCm 133 89 AmCmCmU/isp18//isp18//3CholTEG/ IL17RA_128 mGmAmCmAmAmGC*T*C*A*C*T*mCmCm 134 86 AmCmUmC/isp18//isp18//3CholTEG/ IL17RA_129 mUmCmCmCmCmCC*A*C*C*C*C*mCmCm 135 59 AmCmCmC/isp18//isp18//3CholTEG/ IL17RA_130 mAmGmGmGmCmUT*C*A*G*A*C*mUmCm 136 58 AmCmCmU/isp18//isp18//3CholTEG/ IL17RA_131 mCmAmGmGmGmCT*T*C*A*G*A*mCmUm 137 65 CmAmCmC/isp18//isp18//3CholTEG/ IL17RA_132 mGmCmAmGmGmGC*T*T*C*A*G*mAmCm 138 51 UmCmAmC/isp18//isp18//3CholTEG/ IL17RA_133 mUmGmCmAmGmGG*C*T*T*C*A*mGmAm 139 57 CmUmCmA/isp18//isp18//3CholTEG/ IL17RA_134 mGmUmGmCmAmGG*G*C*T*T*C*mAmGm 140 84 AmCmUmC/isp18//isp18//3CholTEG/ IL17RA_135 mCmGmGmGmUmGC*A*G*G*G*C*mUmUm 141 66 CmAmGmA/isp18//isp18//3CholTEG/ IL17RA_136 mCmGmCmGmGmGT*G*C*A*G*G*mGmCm 142 43 UmUmCmA/isp18//isp18//3CholTEG/ IL17RA_137 mAmCmGmCmGmGG*T*G*C*A*G*mGmGm 143 39 CmUmUmC/isp18//isp18//3CholTEG/ IL17RA_138 mAmAmCmGmCmGG*G*T*G*C*A*mGmGm 144 51 GmCmUmU/isp18//isp18//3CholTEG/ IL17RA_139 mGmAmAmCmGmCG*G*G*T*G*C*mAmGm 145 59 GmGmCmU/isp18//isp18//3CholTEG/ IL17RA_140 mCmUmCmUmCmCT*G*T*C*A*C*mAmUm 146 55 UmUmCmC/isp18//isp18//3CholTEG/ IL17RA_141 mGmCmUmCmUmCC*T*G*T*C*A*mCmAm 147 58 UmUmUmC/isp18//isp18//3CholTEG/ IL17RA_142 mUmGmCmUmCmUC*C*T*G*T*C*mAmCm 148 59 AmUmUmU/isp18//isp18//3CholTEG/ IL17RA_143 mUmUmGmCmUmCT*C*C*T*G*T*mCmAm 149 53 CmAmUmU/isp18//isp18//3CholTEG/ IL17RA_144 mUmUmUmGmCmUC*T*C*C*T*G*mUmCm 150 51 AmCmAmU/isp18//isp18//3CholTEG/ IL17RA_145 mGmUmUmUmGmCT*C*T*C*C*T*mGmUm 151 56 CmAmCmA/isp18//isp18//3CholTEG/ IL17RA_146 mUmGmUmUmUmGC*T*C*T*C*C*mUmGm 152 53 UmCmAmC/isp18//isp18//3CholTEG/ IL17RA_147 mCmCmUmGmUmUT*G*C*T*C*T*mCmCm 153 71 UmGmUmC/isp18//isp18//3CholTEG/ IL17RA_148 mAmGmCmUmGmAA*G*A*G*G*T*mGmGm 154 64 GmAmGmG/isp18//isp18//3CholTEG/ IL17RA_149 mGmAmGmCmUmGA*A*G*A*G*G*mUmG 155 73 mGmGmAmG/isp18//isp18//3CholTEG/ IL17RA_150 mCmGmAmGmCmUG*A*A*G*A*G*mGmU 156 64 mGmGmGmA/isp18//isp18//3CholTEG/ IL17RA_151 mAmCmGmAmGmCT*G*A*A*G*A*mGmGm 157 86 UmGmGmG/isp18//isp18//3CholTEG/ IL17RA_152 mGmGmCmAmGmGC*T*T*C*C*A*mCmUm 158 66 CmCmAmU/isp18//isp18//3CholTEG/ IL17RA_153 mUmGmGmGmCmAG*G*C*T*T*C*mCmAm 159 63 CmUmCmC/isp18//isp18//3CholTEG/ IL17RA_154 mCmUmGmGmGmCA*G*G*C*T*T*mCmCm 160 42 AmCmUmC/isp18//isp18//3CholTEG/ IL17RA_155 mCmCmUmGmGmGC*A*G*G*C*T*mUmCm 161 45 CmAmCmU/isp18//isp18//3CholTEG/ IL17RA_156 mCmCmAmCmCmUC*T*G*C*A*C*mAmCm 162 77 UmCmAmG/isp18//isp18//3CholTEG/ IL17RA_157 mGmCmCmUmGmGG*A*G*G*T*C*mGmAm 163 64 GmGmCmU/isp18//isp18//3CholTEG/ IL17RA_158 mAmGmCmCmUmGG*G*A*G*G*T*mCmGm 164 71 AmGmGmC/isp18//isp18//3CholTEG/ IL17RA_159 mUmGmAmGmCmCT*G*G*G*A*G*mGmUm 165 80 CmGmAmG/isp18//isp18//3CholTEG/ IL17RA_160 mUmUmGmAmGmCC*T*G*G*G*A*mGmGm 166 95 UmCmGmA/isp18//isp18//3CholTEG/ IL17RA_161 mCmUmUmGmAmGC*C*T*G*G*G*mAmGm 167 92 GmUmCmG/isp18//isp18//3CholTEG/ IL17RA_162 mUmUmGmGmGmAG*G*A*T*G*A*mGmG 168 78 mCmGmGmG/isp18//isp18//3CholTEG/ IL17RA_163 mUmUmUmGmGmGA*G*G*A*T*G*mAmG 169 74 mGmCmGmG/isp18//isp18//3CholTEG/ IL17RA_164 mGmUmGmGmGmAT*G*C*A*G*G*mCmCm 170 92 CmGmGmC/isp18//isp18//3CholTEG/ IL17RA_165 mUmGmUmGmGmGA*T*G*C*A*G*mGmCm 171 85 CmCmGmG/isp18//isp18//3CholTEG/ IL17RA_166 mUmUmGmUmGmGG*A*T*G*C*A*mGmGm 172 89 CmCmCmG/isp18//isp18//3CholTEG/ IL17RA_167 mAmCmUmCmCmUG*C*C*C*C*A*mCmCm 173 75 CmAmCmU/isp18//isp18//3CholTEG/ IL17RA_168 mAmGmGmCmUmGG*T*G*C*C*A*mCmUm 174 82 CmGmGmG/isp18//isp18//3CholTEG/ IL17RA_169 mGmAmGmGmAmUC*A*G*T*G*G*mUmAm 175 84 CmCmUmC/isp18//isp18//3CholTEG/ IL17RA_170 mAmAmGmAmGmGA*T*C*A*G*T*mGmGm 176 80 UmAmCmC/isp18//isp18//3CholTEG/ IL17RA_171 mGmCmAmUmGmGA*G*A*G*C*C*mAmUm 177 80 GmCmAmG/isp18//isp18//3CholTEG/ IL17RA_172 mGmGmGmAmAmAG*A*G*G*A*T*mCmAm 178 82 GmUmGmG/isp18//isp18//3CholTEG/ IL17RA_173 mAmGmGmGmAmAA*G*A*G*G*A*mUmC 179 88 mAmGmUmG/isp18//isp18//3CholTEG/ IL17RA_174 mCmAmUmGmGmAG*A*G*C*C*A*mUmGm 180 84 CmAmGmA/isp18//isp18//3CholTEG/ IL17RA_175 mGmGmCmAmUmGG*A*G*A*G*C*mCmAm 181 88 UmGmCmA/isp18//isp18//3CholTEG/ IL17RA_176 mGmGmGmGmCmAT*G*G*A*G*A*mGmCm 182 86 CmAmUmG/isp18//isp18//3CholTEG/ IL17RA_177 mUmGmGmGmGmCA*T*G*G*A*G*mAmGm 183 56 CmCmAmU/isp18//isp18//3CholTEG/ IL17RA_178 mAmUmGmGmGmGC*A*T*G*G*A*mGmAm 184 84 GmCmCmA/isp18//isp18//3CholTEG/ IL17RA_179 mAmUmCmUmGmGG*A*G*A*G*G*mCmG 185 80 mAmUmGmG/isp18//isp18//3CholTEG/ IL17RA_180 mGmAmUmCmUmGG*G*A*G*A*G*mGmC 186 80 mGmAmUmG/isp18//isp18//3CholTEG/ IL17RA_181 mGmGmAmUmCmUG*G*G*A*G*A*mGmG 187 85 mCmGmAmU/isp18//isp18//3CholTEG/ IL17RA_182 mCmCmCmUmCmUC*C*T*C*C*T*mCmCm 188 78 UmAmCmC/isp18//isp18//3CholTEG/ IL17RA_183 mUmCmCmCmUmCT*C*C*T*C*C*mUmCm 189 74 CmUmAmC/isp18//isp18//3CholTEG/ IL17RA_184 mCmUmCmCmCmUC*T*C*C*T*C*mCmUm 190 77 CmCmUmA/isp18//isp18//3CholTEG/ IL17RA_185 mCmUmAmCmUmCC*C*T*C*T*C*mCmUm 191 93 CmCmUmC/isp18//isp18//3CholTEG/ IL17RA_186 mUmCmUmAmCmUC*C*C*T*C*T*mCmCm 192 96 UmCmCmU/isp18//isp18//3CholTEG/ IL17RA_187 mUmUmCmUmAmCT*C*C*C*T*C*mUmCm 193 91 CmUmCmC/isp18//isp18//3CholTEG/ IL17RA_188 mUmUmUmCmUmAC*T*C*C*C*T*mCmUm 194 80 CmCmUmC/isp18//isp18//3CholTEG/ IL17RA_189 mCmUmUmUmCmUA*C*T*C*C*C*mUmCm 195 89 UmCmCmU/isp18//isp18//3CholTEG/ IL17RA_190 mCmCmUmUmUmCT*A*C*T*C*C*mCmUm 196 86 CmUmCmC/isp18//isp18//3CholTEG/ IL17RA_191 mCmUmCmCmUmUT*C*T*A*C*T*mCmCm 197 83 CmUmCmU/isp18//isp18//3CholTEG/ IL17RA_192 mUmCmCmCmUmCC*T*T*T*C*T*mAmCm 198 82 UmCmCmC/isp18//isp18//3CholTEG/ IL17RA_193 mUmCmCmCmUmCG*T*C*A*C*A*mGmCm 199 74 CmAmCmC/isp18//isp18//3CholTEG/ IL17RA_194 mGmCmUmCmUmCT*C*T*G*C*C*mUmCm 200 79 UmCmGmU/isp18//isp18//3CholTEG/ IL17RA_195 mGmAmGmCmUmCT*C*T*C*T*G*mCmCm 201 80 UmCmUmC/isp18//isp18//3CholTEG/ IL17RA_196 mGmGmGmCmUmUC*A*G*A*C*T*mCmAm 202 40 CmCmUmU/isp18//isp18//3CholTEG/ IL17RA_197 mCmUmCmCmGmCA*G*G*T*A*G*mUmUm 203 60 GmUmCmC/isp18//isp18//3CholTEG/ IL17RA_198 mGmGmCmUmCmCG*C*A*G*G*T*mAmGm 204 20 UmUmGmU/isp18//isp18//3CholTEG/ IL17RA_199 mGmGmGmCmUmCC*G*C*A*G*G*mUmAm 205 34 GmUmUmG/isp18//isp18//3CholTEG/ IL17RA_200 mAmCmAmCmCmCA*C*A*G*G*G*mGmCm 206 10 AmUmGmU/isp18//isp18//3CholTEG/ IL17RA_201 mUmCmCmCmCmGA*C*C*A*G*C*mGmGm 207 76 GmUmCmU/isp18//isp18//3CholTEG/ IL17RA_202 mCmUmCmCmCmCG*A*C*C*A*G*mCmGm 208 47 GmGmUmC/isp18//isp18//3CholTEG/ IL17RA_203 mCmGmUmAmGmGG*C*G*T*G*T*mGmUm 209 31 GmGmGmU/isp18//isp18//3CholTEG/ IL17RA_204 mUmCmGmUmAmGG*G*C*G*T*G*mUmGm 210 70 UmGmGmG/isp18//isp18//3CholTEG/ IL17RA_205 mCmUmCmGmUmAG*G*G*C*G*T*mGmUm 211 47 GmUmGmG/isp18//isp18//3CholTEG/ IL17RA_206 mCmCmUmCmGmUA*G*G*G*C*G*mUmGm 212 58 UmGmUmG/isp18//isp18//3CholTEG/ IL17RA_207 mUmCmCmUmCmGT*A*G*G*G*C*mGmUm 213 36 GmUmGmU/isp18//isp18//3CholTEG/ IL17RAv208 mCmUmCmCmUmCG*T*A*G*G*G*mCmGm 214 32 UmGmUmG/isp18//isp18//3CholTEG/ IL17RA_209 mGmGmGmCmGmUC*A*A*A*C*A*mGmUm 215 33 UmAmUmU/isp18//isp18//3CholTEG/ IL17RA_210 mUmCmCmAmAmUA*A*A*G*C*T*mGmUm 216 84 UmAmGmG/isp18//isp18//3CholTEG/ IL17RA_211 mCmUmCmCmAmAT*A*A*A*G*C*mUmGm 217 71 UmUmAmG/isp18//isp18//3CholTEG/ IL17RA_212 mAmCmUmCmCmAA*T*A*A*A*G*mCmUm 218 87 GmUmUmA/isp18//isp18//3CholTEG/ IL17RA_213 mUmAmCmUmCmCA*A*T*A*A*A*mGmCm 219 78 UmGmUmU/isp18//isp18//3CholTEG/ IL17RA_214 mUmGmCmCmCmUA*T*T*T*A*A*mUmUm 220 84 UmUmCmA/isp18//isp18//3CholTEG/ IL17RA_215 mAmUmGmCmCmCT*A*T*T*T*A*mAmUm 221 87 UmUmUmC/isp18//isp18//3CholTEG/ IL17RA_216 mUmAmUmGmCmCC*T*A*T*T*T*mAmAm 222 81 UmUmUmU/isp18//isp18//3CholTEG/ IL17RA_217 mCmUmCmAmUmUT*A*T*T*T*A*mGmGm 223 87 AmAmGmG/isp18//isp18//3CholTEG/ IL17RA_218 mCmCmUmCmAmUT*T*A*T*T*T*mAmGm 224 85 GmAmAmG/isp18//isp18//3CholTEG/ IL17RA_219 mGmCmUmUmGmGG*C*A*G*G*T*mGmGm 225 36 UmGmAmA/isp18//isp18//3CholTEG/ IL17RA_220 mUmCmCmAmCmUC*A*C*C*T*C*mCmCm 226 46 AmGmCmA/isp18//isp18//3CholTEG/ IL17RA_221 mUmCmAmCmUmCC*A*C*T*C*A*mCmCm 227 63 UmCmCmC/isp18//isp18//3CholTEG/ IL17RA_222 mUmCmCmCmCmAC*C*C*C*T*G*mAmGm 228 73 CmUmCmU/isp18//isp18//3CholTEG/ IL17RA_223 mAmGmAmGmGmAT*C*A*G*T*G*mGmUm 229 76 AmCmCmU/isp18//isp18//3CholTEG/ IL17RA_224 mGmCmUmCmCmGC*A*G*G*T*A*mGmUm 230 56 UmGmUmC/isp18//isp18//3CholTEG/ IL17RA_225 mCmUmCmAmCmUC*C*A*C*T*C*mAmCm 231 68 CmUmCmC/isp18//isp18//3CholTEG/ IL17RA_226 mAmUmGmGmGmCT*T*G*G*G*C*mAmGm 232 54 GmUmGmG/isp18//isp18//3CholTEG/ IL17RA_227 mAmUmGmGmGmUA*G*A*T*T*C*mGmUm 233 57 UmCmCmA/isp18//isp18//3CholTEG/ IL17RA_228 mCmAmCmUmCmUT*G*A*A*G*C*mUmCm 234 79 UmUmGmG/isp18//isp18//3CholTEG/ IL17RA_229 mCmGmUmCmAmAA*C*A*G*T*T*mAmUm 235 81 UmUmAmU/isp18//isp18//3CholTEG/ IL17RA_230 mGmGmCmUmGmGA*T*T*T*C*T*mUmUm 236 38 UmGmGmG/iSp18//iSp18//3CholTEG/ IL17RA_231 mCmUmCmCmUmCG*T*A*G*G*G*mCmGm 237 32 UmGmUmG/isp18//isp18//3CholTEG/ IL17RA_232 mGmGmCmAmGmGT*G*G*T*G*A*mAmCm 238 57 GmGmUmC/isp18//isp18//3CholTEG/ IL17RA_233 mGmGmGmCmAmGG*T*G*G*T*G*mAmAm 239 69 CmGmGmU/isp18//isp18//3CholTEG/ IL17RA_234 mUmGmGmGmCmAG*G*T*G*G*T*mGmAm 240 69 AmCmGmG/isp18//isp18//3CholTEG/ IL17RA_235 mUmUmGmGmGmCA*G*G*T*G*G*mUmGm 241 62 AmAmCmG/isp18//isp18//3CholTEG/ IL17RA_236 mCmUmUmGmGmGC*A*G*G*T*G*mGmUm 242 49 GmAmAmC/isp18//isp18//3CholTEG/ IL17RA_237 mCmAmCmAmGmGG*G*C*A*T*G*mUmAm 243 5 GmUmCmC/isp18//isp18//3CholTEG/ IL17RA_238 mCmCmAmCmAmGG*G*G*C*A*T*mGmUm 244 6 AmGmUmC/isp18//isp18//3CholTEG/ IL17RA_239 mCmCmCmAmCmAG*G*G*G*C*A*mUmGm 245 5 UmAmGmU/isp18//isp18//3CholTEG/ IL17RA_240 mCmAmCmCmCmAC*A*G*G*G*G*mCmAm 246 12 UmGmUmA/isp18//isp18//3CholTEG/ IL17RA_241 mUmAmCmAmCmCC*A*C*A*G*G*mGmGm 247 16 CmAmUmG/isp18//isp18//3CholTEG/ IL17RA_242 mGmUmAmCmAmCC*C*A*C*A*G*mGmGm 248 7 GmCmAmU/isp18//isp18//3CholTEG/ IL17RA_243 mAmGmUmAmCmAC*C*C*A*C*A*mGmGm 249 4 GmGmCmA/isp18//isp18//3CholTEG/ IL17RA_244 mCmAmGmUmAmCA*C*C*C*A*C*mAmGm 250 4 GmGmGmC/isp18//isp18//3CholTEG/ IL17RA_245 mCmCmAmGmUmAC*A*C*C*C*A*mCmAm 251 4 GmGmGmG/isp18//isp18//3CholTEG/ IL17RA_246 mGmUmAmGmGmGC*G*T*G*T*G*mUmGm 252 26 GmGmUmC/isp18//isp18//3CholTEG/ IL17RA_247 mCmCmUmCmCmUC*G*T*A*G*G*mGmCm 253 15 GmUmGmU/isp18//isp18//3CholTEG/ IL17RA_248 mUmCmCmUmCmCT*C*G*T*A*G*mGmGm 254 16 CmGmUmG/isp18//isp18//3CholTEG/ IL17RA_249 mCmUmCmCmUmCC*T*C*G*T*A*mGmGm 255 18 GmCmGmU/isp18//isp18//3CholTEG/ IL17RA_250 mGmCmUmCmCmUC*C*T*C*G*T*mAmGm 256 49 GmGmCmG/isp18//isp18//3CholTEG/ IL17RA_251 mGmCmUT*G*G*G*C*A*G*G*T*G*G*T*m 257 49 GmAmA/isp18//isp18//3CholTEG/ IL17RA_252 mUmCmCT*C*G*T*A*G*G*G*C*G*T*G*m 258 48 UmGmU/isp18//isp18//3CholTEG/ IL17RA_253 mGmCmUmUG*G*G*C*A*G*G*T*G*G*mU 259 49 mGmAmA/isp18//isp18//3CholTEG/ IL17RA_254 mAmCmAmCC*C*A*C*A*G*G*G*G*C*mA 260 82 mUmGmU/isp18//isp18//3CholTEG/ IL17RA_255 mCmGmUmAG*G*G*C*G*T*G*T*G*T*mG 261 51 mGmGmU/isp18//isp18//3CholTEG/ IL17RA_256 mUmCmCmUC*G*T*A*G*G*G*C*G*T*mG 262 51 mUmGmU/isp18//isp18//3CholTEG/ IL17RA_257 mGmCmUmUmGG*G*C*A*G*G*T*G*mGm 263 17 UmGmAmA/isp18//isp18//3CholTEG/ IL17RA_258 mAmCmAmCmCC*A*C*A*G*G*G*G*mCmA 264 82 mUmGmU/isp18//isp18//3CholTEG/ IL17RA_259 mCmGmUmAmGG*G*C*G*T*G*T*G*mUmG 265 48 mGmGmU/isp18//isp18//3CholTEG/ IL17RA_260 mUmCmCmUmCG*T*A*G*G*G*C*G*mUmG 266 48 mUmGmU/isp18//isp18//3CholTEG/ IL17RA_261 mGmCmUmUmGmGmGmCmAG*G*T*G*G* 267 14 T*mGmAmA/isp18//isp18//3CholTEG/ IL17RA_262 mAmCmAmCmCmCmAmCmAG*G*G*G*C* 268 11 A*mUmGmU/isp18//isp18//3CholTEG/ IL17RA_263 mUmCmCmUmCmGmUmAmGG*G*C*G*T* 269 18 G*mUmGmU/isp18//isp18//3CholTEG/ IL17RA_264 mGmCmUT*G*G*G*C*A*mGmGmUmGmGm 270 16 UmGmAmA/isp18//isp18//3CholTEG/ IL17RA_265 mAmCmAC*C*C*A*C*A*mGmGmGmGmCm 271 14 AmUmGmU/isp18//isp18//3CholTEG/ IL17RA_266 mCmGmUA*G*G*G*C*G*mUmGmUmGmU 272 31 mGmGmGmU/isp18//isp18//3CholTEG/ IL17RA_267 mUmCmCT*C*G*T*A*G*mGmGmCmGmUm 273 31 GmUmGmU/isp18//isp18//3CholTEG/ IL17RA_268 mGmCmUmUmGmGmGC*A*G*G*T*G*mGm 274 9 UmGmAmA/isp18//isp18//3CholTEG/ IL17RA_269 mAmCmAmCmCmCmAC*A*G*G*G*G*mCm 275 12 AmUmGmU/isp18//isp18//3CholTEG/ IL17RA_270 mCmGmUmAmGmGmGC*G*T*G*T*G*mUm 276 33 GmGmGmU/isp18//isp18//3CholTEG/ IL17RA_271 mUmCmCmUmCmGmUA*G*G*G*C*G*mUm 277 33 GmUmGmU/isp18//isp18//3CholTEG/ IL17RA_272 mGmCmUmUmGG*G*C*A*G*G*mUmGmG 278 13 mUmGmAmA/isp18//isp18//3CholTEG/ IL17RA_273 mAmCmAmCmCC*A*C*A*G*G*mGmGmCm 279 34 AmUmGmU/isp18//isp18//3CholTEG/ IL17RA_274 mCmGmUmAmGG*G*C*G*T*G*mUmGmUm 280 46 GmGmGmU/isp18//isp18//3CholTEG/ IL17RA_275 mUmCmCmUmCG*T*A*G*G*G*mCmGmUm 281 47 GmUmGmU/isp18//isp18//3CholTEG/ IL17RA_276 mAmCmAC*C*C*A*C*A*G*G*G*G*C*A*m 282 82 UmGmU/isp18//isp18//3CholTEG/ IL17RA_277 mCmGmUA*G*G*G*C*G*T*G*T*G*T*G*m 283 48 GmGmU/isp18//isp18//3CholTEG/ IL17RA_278 mAmCmCmCmAmCA*G*G*G*G*C*mAmUm 284 7 GmUmAmG/isp18//isp18//3CholTEG/ IL17RA_279 mCmGmUmAmGmGmGmCmGT*G*T*G*T*G 285 18 *mGmGmU/isp18//isp18//3CholTEG/ IL17RA_280 mCmCmCmAmCmAmGmGmGG*C*A*T*G*T 286 7 *mAmGmU/isp18//isp18//3CholTEG/ IL17RA_281 mCmCmCmAmCA*G*G*G*G*C*mAmUmGm 287 10 UmAmGmU/isp18//isp18//3CholTEG/ IL17RA_282 mCmCmCmAmCmAmGG*G*G*C*A*T*mGm 288 3 UmAmGmU/isp18//isp18//3CholTEG/ IL17RA_283 mGmUmAmGmGmGmCG*T*G*T*G*T*mGm 289 33 GmGmUmC/isp18//isp18//3CholTEG/ IL17RA_284 mGmUmAG*G*G*C*G*T*mGmUmGmUmGm 290 31 GmGmUmC/isp18//isp18//3CholTEG/ IL17RA_285 mGmUmAmGmGmGmCmGmUG*T*G*T*G* 291 18 G*mGmUmC/isp18//isp18//3CholTEG/ IL17RA_286 mGmUmAmGmGG*C*G*T*G*T*mGmUmGm 292 46 GmGmUmC/isp18//isp18//3CholTEG/ IL17RA_287 mCmCmCA*C*A*G*G*G*mGmCmAmUmGm 293 12 UmAmGmU/isp18//isp18//3CholTEG/ IL17RA_288 mGmUmAG*G*G*C*G*T*G*T*G*T*G*G*m 294 48 GmUmC/isp18//isp18//3CholTEG/ IL17RA_289 mGmUmAmGG*G*C*G*T*G*T*G*T*G*mG 295 51 mGmUmC/isp18//isp18//3CholTEG/ IL17RA_290 mCmCmCA*C*A*G*G*G*G*C*A*T*G*T*m 296 57 AmGmU/isp18//isp18//3CholTEG/ IL17RA_291 mCmCmCmAC*A*G*G*G*G*C*A*T*G*mU 297 35 mAmGmU/isp18//isp18//3CholTEG/ IL17RA_292 mCmCmCmAmCA*G*G*G*G*C*A*T*mGmU 298 10 mAmGmU/isp18//isp18//3CholTEG/ IL17RA_293 mGmUmAmGmGG*C*G*T*G*T*G*T*mGmG 299 55 mGmUmC/isp18//isp18//3CholTEG/ Control mGmUmUmUmCmAC*C*A*C*C*C*mAmAm 300 UmUmCmC/iSp18//iSp18//3CholTEG/

TABLE-US-00012 TABLE2 OligonucleotideSequences Specialbasesusedintheoligonucleotidesare asfollows:mN=2'O-methylRNA,/iSp18/= hexa(ethyleneglycol)spacerphosphoramidite, *=phosphorothioate,/3CholTEG/=3 cholesterol Com- SEQ pound ID ID OligonucleotideSequence(5to3) NO: Control mGmUmUmUmCmAC*C*A*C*C*C*mAmAmUmUmCmC/ 300 iSp18//iSp18//3CholTEG/ Anti- mUmGmGmGmAmGT*A*G*A*C*A*mAmGmGmUmAmC/ 301 TNF iSp18//iSp18//3CholTEG/ IL17RA_ mGmCmUmUmGmGG*C*A*G*G*T*mGmGmUmGmAmA/ 225 219 iSp18//iSp18//3CholTEG/

Example 2. IL-17RA mRNA Knockdown in Human Skin Using SNAs Formulated in a Gel Vehicle

[0249] Methods and Materials

[0250] Tissue Culture. Healthy human ex vivo skin, freshly acquired from a single donor was received the day of experiment initiation and prepared immediately. Prior to use, the skin was inspected, noting any areas of extensive stretch marks or scarring, and any sections with visible holes or damage were removed. A dermatome was used to excise full thickness skin from the donor sample. The resulting tissue contained an intact stratum corneum, epidermis, and dermis. No subcutaneous tissue from the surgical explant remained. The skin was carefully cut to the appropriate size and care was taken not to stretch the skin when it was placed into the Franz cells. The skin was then clamped into the Franz cell. Next, a stir bar and receiving medium that had been pre-warmed to 37 C. were added to each Franz cell. The receiving medium consisted of Dulbecco's modified Eagle's medium, supplemented with 2% fetal bovine serum, 50 U/mL penicillin, 50 mg/mL streptomycin, 0.25 g/mL amphotericin B and 10 g/mL gentamycin. The Franz cells, explants and receiving medium were allowed to equilibrate for a minimum of 30 minutes, after which the temperature of the media in each cell was verified to be 371 C. Any air bubbles that were introduced during assembly of the cells were removed. The integrity of the skin was confirmed prior to initiating the study by inverting the cell. If leaks were identified, the skin and donor chamber were repositioned until leaks were absent. Over the course of the experiment, the skin was maintained at ambient humidity and at an epidermal surface temperature of 32 C., which was regulated using 37 C. water-jacketing of the receptor chamber containing cell culture media that contacts the dermal portion of the explant.

[0251] SNA Synthesis. The oligonucleotide was synthesized at the 1 mmole scale employing standard UniLinker support (ChemGenes). The DNA, 2-O-Me RNA monomers and hexa(ethylene glycol) spacers were obtained from ChemGenes Corporation. The cholesterol modifier was obtained from Glen Research. Linkages were either standard phosphodiesters or phosphorothioates prepared with a solution of 0.2 M phenylacetyl disulfide (PADS) in a mixture of 1:1 lutidine:ACN. Synthesis was performed DMT-off, in the 3 to 5 direction. After synthesis, the oligonucleotide was cleaved from the support and de-protected using a 4:1 mixture of ammonium hydroxide and ethanol at 55 C. for 16 hours. The oligonucleotide was purified via high performance liquid chromatography (HPLC) techniques. Molecular weights and extinction coefficients were calculated using the IDT OligoAnalyzer. The verification of the oligonucleotide product molecular weight was performed using electrospray ionization mass spectrometry (ESI-MS). Finally, the oligonucleotide concentration was determined by UV-absorbance at 260 nm on a microplate reader (BioTek).

[0252] Liposomes were formulated by first dissolving 250 mg 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) in chloroform to a final concentration of 50 mg/mL. The solvent was then removed under nitrogen to form a thin lipid film. The film was lyophilized overnight to ensure all solvent was removed. The lipid film was subsequently hydrated with 10 mM phosphate buffered saline (PBS) and sonication/freeze-fracture were used to form large, unilamellar vesicles. These vesicles were then continuously homogenized through a micro-fluidizer at up to 25 kpsi, until the desired mean number diameter of 20 nm was achieved. Liposome concentrations were determined using a choline quantification assay and the particle size and dispersion were measured by dynamic light scattering (DLS).

[0253] SNAs targeting human IL-17RA, compound IL17RA_282, were formulated by mixing a 30-fold molar excess of cholesterol-modified oligonucleotide, SEQ ID NO: 288, to the liposome suspension in PBS followed by overnight incubation at 4 C.

[0254] Drug Application to Skin. A gel vehicle was used to apply IL17RA_282 to the skin. The pre-formulated SNAs were mixed into the gel vehicle, resulting in three drug product strengths of 0, 0.00007 and 0.007% w/w (oligonucleotide weight). The composition of these drug products can be found in Table 3.

[0255] These drug products were then applied topically to the skin explants. The drug products were briefly mixed prior to dosing using a pipette tip. 40 L of each drug product was dosed topically to each Franz cell using a positive displacement pipette. The pipette tip was used to spread the drug product evenly covering the entire exposed surface area of the skin (1.0 cm2). After dosing, the sampling port was occluded to prevent solvent evaporation during the study. The actual dosing time was recorded and the explants were maintained at ambient humidity and at an epidermal surface temperature of 32 C. for 24 hours.

[0256] RNA Extraction and qRT-PCR. At the conclusion of the 24 hour incubation period, the Franz cells were disassembled and the skin was carefully removed from each cell. A cotton swab wetted with PBS was used to remove the drug product and then the application area was blotted dry. Three samples were cut from the 1.0 cm.sup.2 dosing area using a 4 mm biopsy punch. The skin was not stretched while the biopsy punches were taken. The biopsy punches were then lysed in RLT buffer (Qiagen) with a bead homogenizer. RNA was isolated from lysates using the RNEasy 96-well kit (Qiagen) according to the manufacturer's instructions. cDNA was then synthesized from RNA isolates using the cDNA high capacity reverse transcription kit (Life Technologies). cDNA was prepared on a thermocycler with the following temperature program: 25 C. for 10 minutes, 37 C. for 90 minutes, 85 C. for 5 minutes followed by a 4 C. hold. The resulting cDNA was diluted 8 fold with nuclease-free water. qPCR was performed using 6 L of the diluted cDNA, 4.66 L LightCycler480 Probes Master Mix (Roche), 0.47 L human IL-17RA specific FAM-labeled probe and primers, and 0.37 L human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) specific HEX-labeled probe and primers per reaction well of a 384-well optical reaction plate (Roche). The primer and probe set for IL-17RA was purchased commercially (Hs01064648 ml, Thermo Fisher Scientific). The primer and probe set for GAPDH was designed using the known human genome sequence (NCBI reference sequences NM_002046.5) and was found to be specific by blastn analysis (NCBI). The oligonucleotide sequences used for GAPDH were: forward 5-CAA GGT CAT CCA TGA CAA CTT TG-3 (SEQ ID NO: 4), reverse 5-GGG CCA TCC ACA GTC TTC T-3 (SEQ ID NO: 5), probe 5-HEX-ACC ACA GTC CAT GCC ATC ACT GCC A-BHQ1-3 (SEQ ID NO: 6). qPCR reactions, in technical duplicate, were carried out on the Roche Lightcycler 480 under the following conditions: initial denaturation at 95 C. for 10 minutes and then 50 cycles of denaturation at 95 C. for 10 seconds, annealing at 60 C. for 30 seconds and extension at 72 C. for 1 second. Cp values were obtained by analysis with the 2nd derivative method. Relative gene expression was determined by normalization with the housekeeping gene (GAPDH) and the -Ct method. Statistical analysis was done by performing a one-way ANOVA.

[0257] Protein Isolation and Western Blot. Total protein was isolated from the biopsy lysates with acetone precipitation. Lysates from each treatment group were pooled before isolating the protein to increase protein yield. Briefly, four volumes of ice cold acetone were added to the lysate and incubated at 20 C. for 30 minutes. The samples were centrifuged and decanted, and the pellets were washed with one volume ice cold ethanol. Again, the samples were centrifuged and the pellets were allowed to air dry. The pellets were re-suspended in one volume Laemmli sample buffer containing 1% -mercaptoethanol. To ensure the samples were completely dissolved, they were boiled at 95 C. for 10 minutes and subsequently centrifuged to remove any undissolved debris.

[0258] The protein isolates were loaded into a 10% SDS-PAGE gel, run and transferred overnight (22 V) to an Immobilon PSQ PVDF membrane (ISEQ00010, Millipore). The membrane was blocked for 1 hour with 5% dry milk in tris buffered saline containing Tween 20 (the resulting buffer is referred to as TBST) followed by a 5 minute wash in TBST. Human-specific antibodies targeting IL-17RA or -actin protein were used to probe for the presence of those specific proteins. IL-17RA protein was detected using an anti-IL-17RA rabbit monoclonal primary antibody, and was shown to detect a protein with a predicted molecular weight of 150 kDa (12661, Cell Signaling). This antibody was diluted in blocking buffer (5% dry milk in TBST) at a ratio of 1:500 prior to use. -actin protein was detected using an anti--actin rabbit monoclonal primary antibody, and was shown to detect a protein with a predicted molecular weight of 45 kDa (4970, Cell Signaling). This antibody was diluted in blocking buffer at a ratio of 1:1000 prior to use. Primary antibody incubation occurred overnight at 4 C.

[0259] After the incubation period, the membrane was rinsed twice with TBST, followed by two consecutive washes with TBST of 15 minutes and 5 minutes. Next, the membrane was incubated with an anti-rabbit HRP secondary antibody (7074, Cell Signaling) diluted in blocking buffer at a ratio of 1:1000 prior to use. The secondary antibody incubation occurred for 90 minutes at room temperature. Then, the membrane was rinsed twice with TBST, followed by two consecutive washes with TBST for 15 minutes and 5 minutes. Then, the membrane was further washed twice with distilled water for 5 minutes. Subsequently, GE Amersham Prime ECL reagent (RPN2232) was added to the membrane and incubated at room temperature for 5 minutes. Then, the membrane was imaged using an exposure interval of 20 seconds for up to 2 minutes on a BioRad GelDoc Imager. Finally, images were analyzed by densitometry and IL-17RA signal was normalized to -actin signal to compared expression levels across treatments.

TABLE-US-00013 TABLE 3 Drug Product Compositions Gel Strength Formulations (w/w) Ingredient 0% 0.00007% 0.007% SEQ ID NO: 288 0 0.00007 0.007 DOPC 0 0.0003801 0.03801 Diethylene glycol 25 25 25 monoethyl ether (Transcutol P) Glycerin 5 5 5 Hydroxyethyl Cellulose 1 1 1 Methylparaben 0.15 0.15 0.15 Propylparaben 0.05 0.05 0.05 Disodium EDTA 0.1 0.1 0.1 Sodium Metabisulfite 0.2 0.2 0.2 Water 68.5 68.5 68.45

Results

[0260] The IL-17RA mRNA targeted SNA (compound IL17RA_282) formulated as a drug product in a gel vehicle showed dose-dependent knockdown of IL-17RA mRNA in healthy human skin explant after only 24 hours of treatment (FIG. 9). Knockdown was observed when compared to both untreated skin and the 0% strength drug product. Treatment with the 0.007% strength drug product resulted in statistically significant IL-17RA mRNA inhibition compared to untreated (p=0.0011) and 0% strength drug product (p<0.0001) by one-way ANOVA. The IL-17RA mRNA targeted SNA (compound IL17RA_282) formulated as a drug product in a gel vehicle showed inhibition of IL-17RA protein expression in healthy human skin explant after only 24 hours of treatment (FIG. 10). Knockdown was observed when compared to both untreated skin and the 0% strength drug product. The graph represents the analyzed densitometry data collected from the western blot (inset). There was insufficient material to perform a protein-level analysis for the skin samples treated with 0.0007% gel.

Discussion and Conclusions

[0261] Clinical data suggests that the IL-17 signaling pathway plays a significant role in sustaining the psoriasis disease state. While current monoclonal antibody therapies, like brodalumab, provide very effective treatment options, they also present with troubling side-effect profiles. This presents a therapeutic need for a safer alternative. Antisense technology can reduce the expression of mRNA in cells; however, antisense oligonucleotides generally have poor uptake into cells and skin. In contrast, it has been found that when oligonucleotides are arranged in the SNA geometry, they exhibit skin penetration properties and increased cellular uptake. Given these advantages and the therapeutic needs for psoriasis treatment, an antisense SNA based therapy targeting human IL-17RA in the skin may prove an effective treatment for psoriasis.

[0262] It has been shown here that when the IL-17RA mRNA targeted SNA (compound IL17RA_282) formulated as a drug product in a gel vehicle is applied topically to healthy human skin explants, there is a pharmacodynamic effect seen at both the level of IL-17RA mRNA and protein. Increasing strength of the drug product results in decreased IL-17RA expression.

[0263] The response observed in this study represents only a 24 hour treatment. It is expected that longer treatment with multiple doses would further enhance the inhibition observed. Given the importance of IL-17 signaling in maintaining the diseased state observed in psoriasis, a strong topical drug product candidate for the treatment of psoriasis is presented.

Example 3. IL-17RA mRNA Knockdown in Human Psoriatic Skin Using SNAs Formulated in a Gel Vehicle

[0264] Methods and Materials

[0265] Tissue Culture. Four skin biopsies (3 mm diameter) were obtained from each of 8 different patients with mild to moderate plaque psoriasis. Biopsies were taken directly from psoriatic plaques. Due to the limited number of biopsies that can be taken from a single patient, only 4 biopsies were taken per individual. Biopsies were taken from volunteers at about 45 minute intervals and transported to the laboratory (rolled in moist sterile gauze). The time between taking biopsies and starting the incubation was between 5 and 7.5 hours. The biopsies were positioned in the membrane of an insert-well, and incubated in 12-well plates at 32 C. with ambient CO.sub.2 and humidity. The membranes were immersed in 1 mL cell culture medium (Dulbecco's modified Eagle's medium, 1% fetal bovine serum, 1.25 g/mL amphotericin B, 50 g/mL gentamicin, and 0.1 U/mL penicillin/streptomycin) such that the dermis contacted the medium in the well and the epidermis was exposed to air. There was 1 biopsy per well. The lid of the 12-well plate was elevated using two sterile 1 mL pipette tips to limit moisture build-up. The total incubation time of the drug product treated skin was 21 hours and 15 minutes.

[0266] SNA Synthesis. The oligonucleotide, SEQ ID NO: 288, was synthesized via standard solid-phase phosphoramidite chemistry. The molecule was synthesized with successive cycles of de-protection, monomer addition, capping, and oxidation. The DNA, and 2-O-Me RNA monomers were obtained from Sigma Aldrich Biochemie (Germany). The hexa(ethylene glycol) spacers and cholesterol modifier were obtained from ChemGenes Corporation. Linkages were either standard phosphodiesters or phosphorothioates prepared with a solution of 0.2 M phenylacetyl disulfide (PADS) in a mixture of 1:1 lutidine:ACN. Synthesis was performed DMT-off, in the 3 to 5 direction. After synthesis, the oligonucleotide was cleaved from the support and de-protected using a 3:1 mixture of ammonium hydroxide and ethanol at 65 C. for 17 hours. The oligonucleotide was purified via anion exchange high performance liquid chromatography (AX-HPLC) techniques. Then the oligonucleotide solution was lyophilized completely to a dry powder. Verification of the oligonucleotide product molecular weight was performed using electrospray ionization mass spectrometry (ESI-MS) and dual-MS sequencing was performed to confirm the oligonucleotide sequence. Oligonucleotide concentration was determined by UV-absorbance at 260 nm.

[0267] Liposomes were formulated by Avanti Polar Lipids (Alabama, USA). First, 500 g 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) was dissolved in chloroform to a final concentration of 50 mg/mL. The solvent was then removed under nitrogen to form a thin lipid film. The film was lyophilized overnight to ensure all solvent was removed. The lipid film was subsequently hydrated with Hyclone sterile, nuclease-free water (SH30538.03, GE) at a concentration of 100 mg/mL and sonication/freeze-fracture were used to form large, unilamellar vesicles. These vesicles were then continuously homogenized through a micro-fluidizer at up to 25 kpsi, until the mean number diameter of 20 nm was achieved. The liposome solution was further concentrated by tangential flow filtration (TFF) to a final lipid concentration of 208 mg/mL. Lipid concentrations were determined using a choline quantification assay and nuclear magnetic resonance spectroscopy. The particle size and dispersion were measured by dynamic light scattering (DLS).

[0268] SNAs targeting human IL-17RA, were formulated by mixing a 30-fold molar excess of cholesterol-modified full length oligonucleotide to the liposome suspension in Hyclone sterile, nuclease-free water (SH30538.03, GE) followed by overnight incubation at 4 C.

[0269] Drug Application to the Skin. The pre-formulated SNAs targeting human IL-17RA were mixed into a gel vehicle, resulting in four IL17RA_282 gel strengths of 0, 0.01, 0.1 and 1.0% w/w (full length oligonucleotide weight). The composition of these drug products can be found in Table 4.

[0270] The IL17RA_282 gels were then applied topically to the skin explants in replicates of eight. During the sample processing, one sample in the 1.0% group was lost, resulting in only 7 replicates for that group. Each replicate was taken from a different patient for accurate representation and comparison of a patient specific response. The IL17RA_282 gels were briefly mixed prior to dosing using a pipette tip. 10 L of each drug product was dosed topically to each 3 mm biopsy using a positive displacement pipette. The pipette tip was used to spread the drug product evenly covering the entire exposed surface area of the skin. The actual dosing time was recorded and the explants were maintained at 32 C. and ambient humidity for 21 hours.

[0271] At the conclusion of the 21 hour incubation period, the biopsies were removed from each membrane. A cotton swab wetted with PBS was used to remove the drug product and then the application area was blotted dry. The biopsy punches were lysed in RLT buffer (Qiagen) with a bead homogenizer and stored frozen at 80 C. until shipped on dry ice to the research facility.

[0272] RNA Extraction and qRT-PCT. RNA was isolated from lysates using the RNEasy 96-well kit (Qiagen) according to the manufacturer's instructions. cDNA was then synthesized from RNA isolates using the cDNA high capacity reverse transcription kit (Life Technologies). cDNA was prepared on a thermocycler with the following temperature program: 25 C. for 10 minutes, 37 C. for 90 minutes, 85 C. for 5 minutes followed by a 4 C. hold. The resulting cDNA was diluted 8 fold with nuclease-free water. qPCR was performed using 6 L of the diluted cDNA, 4.66 L LightCycler480 Probes Master Mix (Roche), 0.47 L human IL-17RA specific FAM-labeled probe and primers, and 0.37 L human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) specific HEX-labeled probe and primers per reaction well of a 384-well optical reaction plate (Roche). The primer and probe set for IL-17RA was purchased commercially (Hs01064648_m1, Thermo Fisher Scientific). The primer and probe set for GAPDH was designed using the known human genome sequence (NCBI reference sequences NM_002046.5) and was found to be specific by blastn analysis (NCBI). The oligonucleotide sequences used for GAPDH were: forward 5-CAA GGT CAT CCA TGA CAA CTT TG-3 (SEQ ID NO: 4), reverse 5-GGG CCA TCC ACA GTC TTC T-3 (SEQ ID NO: 5), probe 5-HEX-ACC ACA GTC CAT GCC ATC ACT GCC A-BHQ1-3 (SEQ ID NO: 6). qPCR reactions, in technical duplicate, were carried out on the Roche Lightcycler 480 under the following conditions: initial denaturation at 95 C. for 10 minutes and then 50 cycles of denaturation at 95 C. for 10 seconds, annealing at 60 C. for 30 seconds and extension at 72 C. for 1 second. Cp values were obtained by analysis with the 2nd derivative method. Relative gene expression was determined by normalization with the housekeeping gene (GAPDH) and the -Ct method. Statistical analysis was done by performing a one sample t-test.

TABLE-US-00014 TABLE 4 Drug Product Compositions Gel Strength Formulations (w/w) Ingredient 0% 0.01% 0.1% 1.0% SEQ ID NO: 288 0 0.01419 0.1419 1.419 DOPC 0 0.2655 2.655 26.55 Diethylene glycol 25 25 25 25 monoethyl ether (Transcutol P) Glycerin 5 5 5 5 Hydroxyethyl Cellulose 1 1 1 1 Methylparaben 0.15 0.15 0.15 0.15 Propylparaben 0.05 0.05 0.05 0.05 Disodium EDTA 0.1 0.1 0.1 0.1 Sodium Metabisulfite 0.2 0.2 0.2 0.2 Water 68.5 68.2 65.7 40.5

[0273] Results

[0274] The IL17RA_282 gels showed dose-dependent knockdown of IL-17RA mRNA in human psoriatic skin biopsies after 21 hours of treatment (FIG. 11). Knockdown was observed when comparing the IL17RA_282-containing gels to the 0% gel strength formulation. Treatment with the IL17RA_282 gels resulted in statistically significant reduction of IL-17RA mRNA.

[0275] Discussion and Conclusions

[0276] It was shown here that when the IL17RA_282 gel is applied topically to ex vivo human psoriatic skin biopsies, there is a pharmacodynamic effect seen at the level of IL-17RA mRNA. The response observed in this study represents only a 21 hour treatment. It is expected that longer treatment with multiple doses would further enhance the inhibition observed. Given the importance of IL-17 signaling in maintaining the diseased state observed in psoriasis, a strong topical drug product candidate for the treatment of psoriasis is presented.

Example 4. Multiplex SNAs Targeting Three Different mRNAs

[0277] Materials and Methods

[0278] Multiplex SNA Synthesis. SNAs were formulated by mixing a 100 molar excess (unless otherwise stated) of cholesterol-modified oligonucleotide to a liposome suspension in PBS and storing them overnight, protected from light, at 4 C. Four different oligonucleotides were used for the synthesis process: an antisense oligonucleotide targeting human IL-4R, an antisense oligonucleotide targeting human IL-1, an antisense oligonucleotide targeting human CTGF, and a same length control oligonucleotide that does not have any complementarity to known genes (confirmed by BLAST). For monoplex SNAs, the oligonucleotide population consisted of 33% targeted antisense oligonucleotide and 66% control oligonucleotide. For multiplex SNAs containing two different targeted antisense oligonucleotides, the oligonucleotide population consisted of 33% of each targeted antisense oligonucleotide and the remaining 33% control oligonucleotide (FIG. 12). For multiplex SNAs containing three different targeted antisense oligonucleotides, the oligonucleotide population consisted of 33% of each targeted antisense oligonucleotide. Control SNAs consisted of 100% of the control oligonucleotide (FIG. 9).

[0279] Cell Culture Studies. Primary human foreskin keratinocytes (HFKs) were seeded at passage 5 in 96-well, tissue culture plates at a cell density of 17,000 cells per well. Cells were allowed to rest in the incubator overnight following plating. Cells were treated in triplicate with either an IL-4R targeted antisense SNA, IL-1 targeted antisense SNA, CTGF targeted antisense SNA, a multiplex SNA targeting more than one transcript or a non-complementary control SNA (confirmed by NCBI Blast), comprising the same gap-mer design and 3-chemical modifications, at concentrations of 1000, 100, 10 and 1 nM in fresh maintenance media. Unless otherwise stated, all treatments lasted 24 hours.

[0280] RNA Extraction and Quantitative Reverse Transcriptase Polymerase Chain Reaction (qRT-PCR). HFK cells were lysed in RLT Buffer (Qiagen) at 24 hours post-transfection. RNA was isolated from lysates using the RNEasy 96-well kit (Qiagen) according to the manufacturer's instructions. cDNA was then synthesized from RNA isolates using the cDNA High Capacity Reverse Transcription Kit (Life Technologies). Samples were run on a thermocycler at 25 C. for 10 minutes, 37 C. for 90 minutes, 85 C. for 5 minutes and held at 4 C. to generate cDNA. qPCR was performed using 6 L of the synthesized cDNA, 4.66 L LightCycler480 Probes Master Mix (Roche), 0.47 L target specific FAM-labeled probe and primers, and 0.37 L human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) specific HEX-labeled probe and primers per reaction well of a 384-well optical reaction plate (Roche). The primer and probe sets for IL-4R, IL-1 and CTGF were purchased from ThermoFisher Scientific (catalogue numbers Hs00166237_m1, Hs01555410_m1 and Hs01026927_g1, respectively). The primer and probe set for GAPDH was designed using the known human genome sequence (NCBI reference sequence NM_002046.5) and was found to be specific by blastn analysis (NCBI). The oligonucleotide sequences used for GAPDH were: forward 5-CAA GGT CAT CCA TGA CAA CTT TG-3 (SEQ ID NO: 4), reverse 5-GGG CCA TCC ACA GTC TTC T-3 (SEQ ID NO: 5), probe 5-HEX-ACC ACA GTC CAT GCC ATC ACT GCC A-BHQ1-3 (SEQ ID NO: 6). qPCR reactions, in technical duplicate, were carried out on the Roche Lightcycler 480 under the following conditions: initial denaturation at 95 C. for 10 minutes and then 50 cycles of denaturation at 95 C. for 10 seconds, annealing at 60 C. for 30 seconds and extension at 72 C. for 1 second. Cp values were obtained by analysis with the 2nd derivative method. Relative gene expression was determined by normalization with the housekeeping gene (GAPDH) and the -Ct method. Each treatment was compared to its respective concentration control.

[0281] Results

[0282] Seven different SNA configurations were made to test whether three different mRNAs can be targeted using single SNA construct. Three mRNAs were chosen that were not functionally dependent on each other for expression and were not in a single known pathway. In certain cases, it may be advantageous to target mRNAs that are part of the same pathway, e.g. TNF, IL17, IL22, to control a specific pathway. SNAs were synthesized targeting each individual mRNA alone, three pairs of mRNAs and one SNA configuration that can target all three mRNAs. Control oligonucleotide was used to ensure that each SNA configuration has the same number of targeted and non-targeted oligonucleotides.

[0283] The results from cell culture experiments demonstrate that single SNA can be formulated that targets three different mRNAs. The mRNAs chosen were interleukin 4 receptor (IL4R), interleukin 1 beta (IL1b) and connective tissue growth factor (CTGF). These targets were chosen because in other experiments it was noted that knocking down any one of these mRNAs didn't significantly reduce the levels of the other two. The results show that when antisense oligonucleotides targeting any single mRNA is present on the SNA, the expression of that mRNA is reduced in a dose dependent manner (FIG. 13 for IL4R, FIG. 14 for IL1b, FIG. 15 for CTGF). This configuration can be extended to target more than three mRNAs. The total antisense loading per SNA may be the theoretical limit to the number of mRNAs that can be targeted with a single SNA configuration.

REFERENCES

[0284] 1. Banga R J, Chernyak N, Narayan S P, Nguyen S T, Mirkin C A. Liposomal Spherical Nucleic Acids. J. Am. Chem. Soc. 2014 136: 9866-9869. [0285] 2. Ding Y and Lawrence C E. A Statistical Sampling Algorithm for RNA Secondary Structure

[0286] Prediction. Nucleic Acids Res. 2003: 31: 7280-7301. [0287] 3. Chabaud M I, Fossiez F, Taupin J L, Miossec P. Enhancing effect of IL-17 on IL-1-induced IL-6 and leukemia inhibitory factor production by rheumatoid arthritis synoviocytes and its regulation by Th2 cytokines. J Immunol. 1998 Jul. 1; 161(1):409-14. [0288] 4. Miossec P. Interleukin-17 in rheumatoid arthritis: if T cells were to contribute to inflammation and destruction through synergy. Arthritis Rheum. 2003 March; 48(3):594-601.

EQUIVALENTS

[0289] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

[0290] All references, including patent documents, disclosed herein are incorporated by reference in their entirety.