Engineered cells for adoptive cell therapy

10786533 ยท 2020-09-29

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are engineered cells for adoptive therapy, including NK cells and T cells. Also provided are compositions for engineering and producing the cells, compositions containing the cells, and methods for their administration to subjects. In some embodiments, the cells contain genetically engineered antigen receptors that specifically bind to antigens, such as chimeric antigen receptors (CARs) and costimulatory receptors. In some embodiments, the cells include receptors targeting multiple antigens. In some embodiments, the cells include repression of one or more gene product, for example, by disruption of a gene encoding the gene product. In some embodiments, a gene encoding an antigen recognized by the engineered antigen receptor is disrupted, reducing the likelihood of targeting of the engineered cells. In some embodiments, the antigen recognized by the engineered antigen receptor is related to a tumor antigen recognized by the engineered antigen receptor.

Claims

1. An engineered immune cell comprising: a recombinant receptor comprising an anti-B cell maturation antigen (BCMA) antibody or an antigen-binding fragment thereof that specifically binds to a BCMA, wherein the recombinant receptor also binds or is suspected of binding to a related antigen that is a transmembrane activator and CAML Interactor (TACI) or a B-cell activating factor receptor (BAFF-R); and a genetic disruption in the gene encoding the related antigen in the engineered immune cell.

2. The engineered immune cell of claim 1, wherein the genetic disruption has been induced by a targeted nuclease.

3. The engineered immune cell of claim 2, wherein the targeted nuclease is an RNA-guided nuclease.

4. The engineered immune cell of claim 3, wherein the RNA-guided nuclease is a CRISPR-Cas9 combination comprising a Cas9 enzyme and a guide RNA (gRNA) that specifically binds to, recognizes, or hybridizes to the gene encoding the related antigen.

5. A pharmaceutical composition comprising the engineered immune cell of claim 4 and a pharmaceutically acceptable carrier.

6. The engineered immune cell of claim 4, wherein the immune cell is a T cell.

7. The engineered immune cell of claim 6, wherein the T cell is a CD4+ or CD8+ T cell.

8. The engineered immune cell of claim 4, wherein the immune cell is a natural killer (NK) cell.

9. A pharmaceutical composition comprising the engineered immune cell of claim 2 and a pharmaceutically acceptable carrier.

10. The engineered immune cell of claim 2, wherein the targeted nuclease is a fusion protein comprising a DNA-targeting protein and a nuclease.

11. The engineered cell of claim 10, wherein the fusion protein is a zinc finger nuclease (ZFN) or a TAL-effector nuclease (TALEN) that specifically binds to or recognizes the gene encoding the related antigen.

12. The engineered immune cell of claim 2, wherein the immune cell is a T cell.

13. The engineered immune cell of claim 12, wherein the T cell is a CD4+ or CD8+ T cell.

14. The engineered immune cell of claim 2, wherein the immune cell is a natural killer (NK) cell.

15. The engineered immune cell of claim 1, wherein the recombinant receptor is a chimeric antigen receptor (CAR).

16. The engineered immune cell of claim 15, wherein the immune cell is a T cell.

17. The engineered immune cell of claim 16, wherein the T cell is a CD4+ or CD8+ T cell.

18. The engineered immune cell of claim 15, wherein the immune cell is a natural killer (NK) cell.

19. A pharmaceutical composition comprising the engineered immune cell of claim 15 and a pharmaceutically acceptable carrier.

20. The engineered immune cell of claim 1, wherein: the disruption comprises disrupting the gene at the DNA level, the disruption is not reversible; or the disruption is not transient.

21. A pharmaceutical composition comprising the engineered immune cell of claim 1 and a pharmaceutically acceptable carrier.

22. The engineered immune cell of claim 1, wherein the immune cell is a T cell.

23. The engineered immune cell of claim 22, wherein the T cell is a CD4+ or CD8+ T cell.

24. The engineered immune cell of claim 1, wherein the immune cell is a natural killer (NK) cell.

Description

DETAILED DESCRIPTION

I. Compositions and Methods Providing Specificity and/or Efficacy in Adoptive Cell Therapy

(1) Provided are cells for adoptive cell therapy, e.g., adoptive immunotherapy. The cells include immune cells such as T cells and NK cells, and generally express genetically engineered antigen receptors such as engineered TCRs and/or chimeric antigen receptors (CARs). Also provided are methods and uses of the cells, such as in adoptive therapy in the treatment of cancers including multiple myeloma (MM). Also provided are methods for engineering, preparing, and producing the cells, compositions containing the cells, and kits and devices containing and for using, producing and administering the cells. In some aspects, the provided embodiments provide improved selectivity, specificity, and/or efficacy of antigen-specific adoptive cell therapy, and/or expand the scope of diseases, conditions, and/or target antigens which may be targeted via adoptive cell therapy. In some aspects, they improve the exposure to the cells being administered.

(2) The cells generally are engineered by introducing one or more genetically engineered nucleic acid or product thereof. Among such products are genetically engineered antigen receptors, including engineered T cell receptors (TCRs) and functional non-TCR antigen receptors, such as chimeric antigen receptors (CARs), including activating, stimulatory, and costimulatory CARs, and combinations thereof.

(3) Also among the cells are those in which certain genes and/or gene products have been disrupted, modified and/or repressed, such as via disruption that impairs or reduces expression. Such genes and gene products may include, or include those encoding, one or more antigen recognized or specifically bound by a chimeric antigen receptor (CAR) or other engineered receptor such as antigen receptor expressed by the cells, such as a disease-specific target antigen, disease-specific epitope thereof and/or one that is related thereto. In some embodiments, the gene or gene product disrupted or repressed is or is a gene encoding an antigen targeted by the genetically engineered antigen receptor, such as an activating, inhibitory, or costimulatory CAR, and generally an activating or costimulatory CAR. Thus, also provided are nucleic acids effecting repression of expression and/or disruption of endogenous genes, such as by gene editing. Also provided are cells with reduced expression of a gene or genes and methods for effecting the repression.

(4) In some embodiments, the cells express an engineered receptor targeting (e.g., specifically binding to or recognizing) an antigen, such as a disease-specific target antigen corresponding to the disease or condition to be treated. In some such embodiments, the target antigen is not expressed, or may not be overexpressed, on or in the engineered cells. In some aspects, such a receptor, e.g., TCR or CAR, may further specifically bind to or recognize with, e.g., may cross-react with, one or more other antigens, which may be expressed or overexpressed on or in the engineered cells or activated cells of the same type. In some aspects, the other antigens are related to, e.g., contain sequence or structural similarity to or an epitope of, the disease-specific target antigen. Such related antigen may be a disease-specific antigen or one that is expressed on the disease or condition to be treated, or may be one that is not disease specific or is not expressed on or in such disease or condition.. Such cross-reactivity can in some aspects produce unwanted effects and/or reduce efficacy. For example, if an engineered cell expresses an antigen that is structurally similar to a target tumor antigen specifically bound by the receptor, the tumor antigen-specific CAR or TCR may recognize and bind to, e.g., specifically bind to, the similar antigen and induce unwanted killing or inhibition of the engineered cell itself. In some embodiments, such related antigen or expression thereof is disrupted in the engineered cell, addressing or reducing risk of such effects. In some embodiments, the engineered cell expresses the same antigen that is targeted by the CAR or TCR and/or may express at least the target antigen and one or more antigens related to the target antigen.

(5) In some embodiments, for example, in the context of an activating or costimulatory antigen receptor, e.g., activating CAR or costimulatory CAR, the repression of a gene that encodes an antigen (such as a disease-specific target antigen and/or antigen related thereto, e.g., sharing sequence or structural similarity or epitope therewith) expressed in the engineered cells avoids or reduces the likelihood of the engineered cells themselves being targeted for killing or inhibition, thereby improving efficacy of, and/or persistence or expansion of cells in, the adoptive cell therapy. Thus, in some aspects, such disruption avoids or reduces the likelihood of targeting, by the engineered cells, of the engineered cells themselves.

(6) For example, antigen-specific cells, such as antigen-specific T cells, targeting antigens also expressed by such cells, can induce fratricide killing of the cells. In some cases, fratricide killing of T cells is observed in cultures of antigen-specific T cells against survivin, hTERT, p53 and others, such as CS1, which are protein antigens expressed in activated T cells (Turksma et al. (2013) Journal of Translational Medicine, 11:152; Leisegang et al. (2010) J Clin. Invest., 120:3869-3877; Chen et al. (2007) Cancer Biol Ther., 6:1991-1996; Theoret et al. (2008) Hum Gene Ther., 19:1219-1232). Methods of detecting fratricide, such as self-killing, of the immune cells can include, for example, methods in which T cells genetically engineered with an antigen receptor (e.g. TCR or CAR or other antigen receptor) are cultured in vitro, e.g., for up to 2 weeks, and monitored over time using any of a variety of assays for cell proliferation, viability and/or cytotoxicity. In some cases, the cultured cells can be stained with 7-AAD or other staining or other reagent used to discriminate viability and cell death or apoptosis or activation of apoptotic pathways, such as by detection of caspase or activated caspase molecules. In some examples, cytotoxicity induced by fratricide killing of antigen-specific immune cells can be assessed using a cytotoxicity assay, such as an assay to assess chromium release. In some cases, the self-killing of the immune cells themselves expressing the genetically engineered antigen receptor can limit methods of using certain antigen-specific immune cells in adoptive cell therapy, since such cells can be eliminated by the fratricide killing ex vivo prior to administration and/or are upon administration in vivo. Self-killing of engineered cells within a population may be by killing of a single cell within such population of engineered cells by the same cell or by cells within the population killing one another.

(7) Provided are cells and methods that overcome such problems. For example, in some embodiments, the expression of a gene encoding an antigen specifically bound by one or more of the genetically engineered antigen receptors is repressed in the cell. In some embodiments, the expression of a gene encoding an antigen that is related to an antigen targeted by one or more of the genetically engineered antigen receptors is repressed in the cell. By repressing an antigen as described herein in the immune cell, in some embodiments, the fratricide killing of the immune cells themselves is prevented or reduced. In some embodiments, the fratricide killing (e.g. as assessed by a proliferation, viability and/or cytotoxicity assay) is reduced by at least 40%, 50%, 60%, 70%, 80%, 90%, 95% or more, such as compared to a cell or cell population in which the cells express the engineered antigen receptor but in which the gene or antigen targeted thereby or expression thereof has not been disrupted. Such features in some aspects confer improved specificity and/or efficacy in the context of adoptive cell therapy.

(8) Among such antigens are those expressed in cancers of the immune system, such as leukemias, lymphomas, and/or myelomas, such as multiple myeloma, and/or expressed on T cells and/or NK cells, including activated T cells. Exemplary antigens are those expressed on activated or stimulated T cells or NK cells, and subsets thereof, particularly activated cells produced by stimulatory conditions used to promote the introduction of the nucleic acid encoding the CAR or other engineered receptor. For example, among such antigens are those not generally expressed on resting T cells but expression of which is induced upon T cell activation and/or that are expressed on activated T cells. In some embodiments, the gene encodes a universal tumor antigen, or a family member thereof, such as hTERT, survivin, MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53 or cyclin (D1). For example, the gene encodes hTERT or survivin. In some aspects, the gene encodes BCMA, BAFFR, or TACI (Kimberley et al., (2008) J Cellular Physiology, 218:1; Pelekanou, et al., (2013) PloS One, 8:12; Wang et al., (2001) Nat Immunol, 2:7; Mariette, X, (2011) Sjgren's Syndrome; Salzer et al., (2005) Curr Opin Allergy Clin Immunol, 5:6) and/or encodes FcRH5. In some embodiments, the gene encodes the antigen CD33 or TIM-3; in some embodiments, it encodes the antigen CD26, CD30, CD53, CD92, CD100, CD148, CD150, CD200, CD261, CD262, or CD362.

(9) In some embodiments, the repression is effected via disruption of the gene encoding the antigen, such as by deletion, e.g., deletion of an entire gene, exon, or region, and/or replacement with an exogenous sequence, and/or by mutation, e.g., frameshift or missense mutation, within the gene, typically within an exon of the gene. In some embodiments, the disruption results in a premature stop codon being incorporated into the gene, such that the antigen is not expressed or is not expressed in a form that is recognized by the antigen receptor. The disruption is generally carried out at the DNA level. The disruption generally is permanent, irreversible, or not transient. In other embodiments, transient or reversible repression strategies are used, such as gene knockdown using RNAi. In some embodiments, by disrupting or otherwise repressing expression of the antigen on the engineered cells, the methods and compositions provided here avoid or reduce the likelihood of killing of the engineered cells by the engineered cells themselves, thereby promoting efficacy.

(10) In some embodiments, the cells include features for increased efficacy of the cells and methods are provided by the disruption of gene expression in the engineered cells. In some aspects, the gene disrupted encodes a checkpoint molecule, immunosuppressive molecule, such as a receptor that delivers an immunosuppressive signal to the cell, and/or any molecule which could reduce the robustness of the response of the engineered cell, for example, following administration in connection with immunotherapy.

(11) In some embodiments, for example, in the context of an antigen that is recognized by an inhibitory CAR, the gene disruption prevents or reduces the likelihood of the inhibitory CAR expressed by the engineered cell of itself binding to a molecule also expressed by the engineered cells, thereby inducing a dampening effect on the signaling or targeted immune response by the engineered cells. Exemplary of such antigens are those expressed on normal or non-targeted or off-target cells (such that an inhibitory CAR molecule is included to prevent off-target effects), but is also expressed on the cell type used for genetic engineering, such as the T cell or NK cell. Exemplary antigens are MHC molecules, such as MHC-class I molecules, which can in some cases be downregulated in the context of immune evasion, cancer, or infection, but are generally expressed on nucleated cells. Other examples are any inhibitory CAR target that is also expressed on a T cell, NK cell, or other cell engineered for cell therapy.

(12) In other embodiments, the gene or genes disrupted is a gene other than that encoding the antigen, such as a gene encoding an immunosuppressive molecule, e.g., checkpoint molecule or adenosine receptor, e.g., A2AR.

(13) In some aspects, the disruption is carried out by gene editing, such as using a DNA binding protein or DNA-binding nucleic acid, which specifically binds to or hybridizes to the gene at a region targeted for disruption. In some aspects, the protein or nucleic acid is coupled to or complexed with a nuclease, such as in a chimeric or fusion protein. For example, in some embodiments, the disruption is effected using a fusion comprising a DNA-targeting protein and a nuclease, such as a Zinc Finger Nuclease (ZFN) or TAL-effector nuclease (TALEN), or an RNA-guided nuclease such as a clustered regularly interspersed short palindromic nucleic acid (CRISPR)-Cas system, such as CRISPR-Cas9 system, specific for the gene being disrupted.

(14) In some embodiments, improved selectivity and specificity is achieved through strategies targeting multiple antigens. Such strategies generally involve multiple antigen-binding domains, which typically are present on distinct genetically engineered antigen receptors and specifically bind to distinct antigens. Thus, in some embodiments, the cells are engineered with the ability to bind more than one antigen. In some aspects, a plurality of genetically engineered antigen receptors are introduced into the cell, which specifically bind to different antigens, each expressed in or on the disease or condition to be targeted with the cells or tissues or cells thereof. Such features can in some aspects address or reduce the likelihood of off-target effects. For example, where a single antigen expressed in a disease or condition is also expressed on or in non-diseased or normal cells, such multi-targeting approaches can provide selectivity for desired cell types by requiring binding via multiple antigen receptors in order to activate the cell or induce a particular effector function.

(15) In some embodiments, the cell expresses a first genetically engineered antigen receptor recognizing a first antigen and a second genetically engineered antigen receptor recognizing a second antigen. In some aspects, the second receptor is a costimulatory receptor recognizing the second antigen. In some aspects, both receptors are activating receptors. In some embodiments, additional receptors recognize third, or more antigens. In some aspects, each of the antigens is expressed in the context of a target cell, disease, or condition, such as in a neoplasia, cancer, malignancy, or infectious disease, for example, is a disease-specific target. In some aspects, one or more of the antigens is also expressed on cells or in tissues or environments which it is not desired to target with the cell therapy, such as in normal or non-diseased tissue. In some embodiments, the presence of multiple receptors and/or multiple antigen-recognition components avoids or reduces the likelihood of off-target effects on such tissues, cells, or environments. Thus, in some aspects, features of the provided cells and methods avoid or reduce the likelihood of inappropriate activation or response of cells directed at cells, tissues, or environments other than those being targeted by the cell therapy. For example, in some embodiments, they avoid or reduce the likelihood of off-target effects. In some embodiments, the ability of the cells or the compositions or methods provided herein to target two or more disease-specific targets avoids or reduces the risk of unwanted effects due to antigen or epitope loss, for example, by allowing activation or stimulation in the presence of either of two or more disease-specific antigens. In some such aspects, the two or more receptors targeting the two or more disease-specific antigen receptors may be expressed on the same cell, e.g., from the same or different construct and/or control of the same promoter, and/or may be expressed by different cells in the same composition, and/or may be present in two different compositions both administered to the same subject.

(16) In some embodiments, at least one of the two or more antigens is a tumor-specific or associated target, a universal tumor antigen and/or a multiple myeloma-specific or associated target. In some aspects, one or more of the two or more antigens is selected from among a human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53, cyclin (D1), BCMA, BAFFR, FcRH5, or TACI, and the other is another antigen expressed on a tumor or cancer, and in some cases is expressed on a particular type of tumor or cancer, and not on one or more certain other types of cancers. In some aspects, one or more of the antigens is a multiple myeloma-associated or multiple myeloma-specific antigen such as CD38 or CD138 or BCMA or CS-1 and/or BAFF-R, FcRH5, or TACI; in some aspects, such other antigen is expressed on one or more blood cancers or one or more solid tumor types. In some aspects, the target antigen and said another antigen are distinct and are selected, individually, from the group consisting of CD38 and CD138, CS-1, BCMA, BAFF-R, FcRH5 and/or TACI. In some such aspects, the cell further comprises an additional genetically engineered antigen receptor which recognizes an antigen expressed on a disease or condition to be treated and induces a stimulatory or activating signal, which is dampened by the first genetically engineered antigen receptor.

(17) In some aspects, at least one of the genetically engineered antigen receptor is specific for a target antigen that is a universal tumor antigen, or a family member thereof, and/or is expressed on one or on more than one type of tumor. For example, among the cells are those targeting multiple antigens where at least one of the targeted antigens is hTERT, survivin, MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53, cyclin (D1), and/or in some embodiments at least one of the target antigens is or comprises BCMA, BAFFR, FcRH5 and/or TACI. In some embodiments, the one or other antigens targeted by one or more other genetically engineered antigen receptors on the cells is one that is expressed on a tumor or cancer.

(18) In some aspects, the disease or condition is multiple myeloma, the target cell is a multiple myeloma cell, and/or the target antigens are antigens expressed in multiple myeloma. Among the cells are those targeting multiple antigens, such multiple antigens expressed in a disease or condition such as multiple myeloma, such as combinations of CD38, CD138 CS-1, BCMA, BAFF-R, TACI, and/or FcRH5. Exemplary combinations of antigens to be targeted include two or more of CD38, CD138, and/or CS-1; two or more of BCMA, BAFF-R, TACI, and/or two or more of BCMA, FcRH5 and/or CS-1, a combination of BCMA and any one or more of CD38, CD138 CS-1, BAFF-R, TACI, and/or FcRH5; and/or a combination of BCMA and any one or more of CD38, CD138, CS-1 and/or FcRH5. In some aspects, the cells recognize two or more antigens expressed in multiple myeloma, one or more of which may also be expressed on normal or non-cancerous cells. In some embodiments, the antigens include two or more of CD38, CD138, and CS-1; and/or two or more of BCMA, CS-1, CD38, CD138 and/or FcRH5.

(19) In some embodiments, the multiple antigen-recognition domains or multiple antigen receptors are designed or engineered such that a response is induced in the cell only upon specific binding or ligation of the plurality of receptors or antigen-recognition domains, and not upon ligation or binding to antigen by a single receptor or domain alone. In some aspects, the first receptor includes an activation domain, such as an ITAM-containing motif, such as an immunostimulatory domain of a CD3-zeta chain. In some such aspects, the first receptor exhibits low affinity and/or specific binding by the receptor does not induce a particular activity in the cell, such as cytotoxic activity and/or proliferation and/or cytokine production. In some aspects, the second receptor is a costimulatory receptor, which does not include such an activation domain but includes a costimulatory domain, e.g., which enhances the signal induced by ligation of the first receptor. In some aspects, the normal cells also express or can express the antigen recognized by the activating receptor.

(20) In some embodiments, the cell includes multiple genetically engineered antigen receptors recognizing different antigens and also includes a gene disruption, for example, disruption in a gene encoding the antigen targeted by one or more of the antigen receptors. In some embodiments, the gene disruption is carried out prior to the introduction of the antigen receptor(s); in some embodiments, it is carried out simultaneously to introduction of the antigen receptor(s). In some aspects, the introduction of the antigen receptor(s) effects the gene disruption, such as by insertion into the disrupted gene locus by homologous recombination.

(21) Also provided are methods, compounds, and compositions for producing the engineered cells. Provided are methods for cell isolation, genetic engineering and gene disruption. Provided are nucleic acids, such as constructs, e.g., viral vectors encoding the genetically engineered antigen receptors and/or encoding nucleic acids and/or proteins for targeted gene disruption, and methods for introducing such nucleic acids into the cells, such as by transduction. Also provided are compositions containing the engineered cells, and methods, kits, and devices for administering the cells and compositions to subjects, such as for adoptive cell therapy. In some aspects, the cells are isolated from a subject, engineered, and administered to the same subject. In other aspects, they are isolated from one subject, engineered, and administered to another subject.

(22) A. Cells, Cell Preparation and Culture

(23) In some embodiments, the cells, e.g., engineered cells, are eukaryotic cells, such as mammalian cells, e.g., human cells. In some embodiments, the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, are cells of the immune system, such as cells of the innate or adaptive immunity, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells. Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs). In some aspects, the cells are human cells. The cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen. In some embodiments, the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4+ cells, CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation. With reference to the subject to be treated, the cells may be allogeneic and/or autologous. Among the methods include off-the-shelf methods. In some aspects, such as for off-the-shelf technologies, the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs). In some embodiments, the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation.

(24) Among the sub-types and subpopulations of T cells and/or of CD4+ and/or of CD8+ T cells are nave T (T.sub.N) cells, effector T cells (T.sub.EFF), memory T cells and sub-types thereof, such as stem cell memory T (T.sub.SCM), central memory T (T.sub.CM), effector memory T (T.sub.EM), or terminally differentiated effector memory T cells, tumor-infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.

(25) In some embodiments, one or more of the T cell populations is enriched for or depleted of cells that are positive for (marker.sup.+) or express high levels (marker.sup.high) of one or more particular markers, such as surface markers, or that are negative for (marker.sup.) or express relatively low levels (marker.sup.low) of one or more markers. In some cases, such markers are those that are absent or expressed at relatively low levels on certain populations of T cells (such as non-memory cells) but are present or expressed at relatively higher levels on certain other populations of T cells (such as memory cells). In one embodiment, the cells (such as the CD8.sup.+ cells or the T cells, e.g., CD3.sup.+ cells) are enriched for (i.e., positively selected for) cells that are positive or expressing high surface levels of CD45RO, CCR7, CD28, CD27, CD44, CD127, and/or CD62L and/or depleted of (e.g., negatively selected for) cells that are positive for or express high surface levels of CD45RA. In some embodiments, cells are enriched for or depleted of cells positive or expressing high surface levels of CD122, CD95, CD25, CD27, and/or IL7-R (CD127). In some examples, CD8+ T cells are enriched for cells positive for CD45RO (or negative for CD45RA) and for CD62L.

(26) In some embodiments, a CD4+ T cell population and a CD8+ T cell sub-population, e.g., a sub-population enriched for central memory (T.sub.CM) cells.

(27) In some embodiments, the cells are natural killer (NK) cells. In some embodiments, the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.

(28) Cell Preparation

(29) The cells and compositions containing the cells for engineering typically are isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject. In some embodiments, the subject from which the cell is isolated as one having a particular disease or condition or in need of a cell therapy or to which cell therapy will be administered. The subject in some embodiments is a mammal, such as a human, such as a subject in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered.

(30) Accordingly, the cells in some embodiments are primary cells, e.g., primary human cells. The samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation. The biological sample can be a sample obtained directly from a biological source or a sample that is processed. Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.

(31) In some aspects, the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product. Exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom. Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.

(32) In some embodiments, the cells are derived from cell lines, e.g., T cell lines. The cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, and pig.

(33) Cell Processing, Preparation, and Non-Affinity-Based Separation

(34) In some embodiments, isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps. In some examples, cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted components, enrich for desired components, lyse or remove cells sensitive to particular reagents. In some examples, cells are separated based on one or more property, such as density, adherent properties, size, sensitivity and/or resistance to particular components.

(35) In some examples, cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis. The samples, in some aspects, contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contains cells other than red blood cells and platelets.

(36) In some embodiments, the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In some embodiments, the wash solution lacks calcium and/or magnesium and/or many or all divalent cations. In some aspects, a washing step is accomplished a semi-automated flow-through centrifuge (for example, the Cobe 2991 cell processor, Baxter) according to the manufacturer's instructions. In some aspects, a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions. In some embodiments, the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca.sup.++/Mg.sup.++ free PBS. In certain embodiments, components of a blood cell sample are removed and the cells directly resuspended in culture media.

(37) In some embodiments, the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.

(38) Separation Based on Affinity and/or Marker Profile

(39) In some embodiments, the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In some embodiments, any known method for separation based on such markers may be used. In some embodiments, the separation is affinity- or immunoaffinity-based separation. For example, the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.

(40) Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.

(41) The separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker. For example, positive selection of or enrichment for cells of a particular type, such as those expressing a marker, refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker. Likewise, negative selection, removal, or depletion of cells of a particular type, such as those expressing a marker, refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.

(42) In some examples, multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection. In some examples, a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection. Likewise, multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.

(43) For example, in some aspects, specific subpopulations of T cells, such as cells positive or expressing high levels of one or more surface markers, e.g., CD28.sup.+, CD62L.sup.+, CCR7.sup.+, CD27.sup.+, CD127.sup.+, CD4.sup.+, CD8.sup.+, CD45RA.sup.+, and/or CD45RO.sup.+ T cells, are isolated by positive or negative selection techniques.

(44) For example, CD3.sup.+, CD28.sup.+ T cells can be positively selected using CD3/CD28 conjugated magnetic beads (e.g., DYNABEADS M-450 CD3/CD28 T Cell Expander).

(45) In some embodiments, isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection. In some embodiments, positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker.sup.+) at a relatively higher level (marker.sup.high) on the positively or negatively selected cells, respectively.

(46) In some embodiments, T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD14. In some aspects, a CD4.sup.+ or CD8.sup.+ selection step is used to separate CD4.sup.+ helper and CD8.sup.+ cytotoxic T cells. Such CD4.sup.+ and CD8.sup.+ populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.

(47) In some embodiments, CD8.sup.+ cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation. In some embodiments, enrichment for central memory T (T.sub.CM) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakura et al. (2012) Blood.1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701. In some embodiments, combining T.sub.CM-enriched CD8.sup.+ T cells and CD4.sup.+ T cells further enhances efficacy.

(48) In embodiments, memory T cells are present in both CD62L.sup.+ and CD62L-subsets of CD8.sup.+ peripheral blood lymphocytes. PBMC can be enriched for or depleted of CD62L-CD8.sup.+ and/or CD62L.sup.+CD8.sup.+ fractions, such as using anti-CD8 and anti-CD62L antibodies.

(49) In some embodiments, the enrichment for central memory T (T.sub.CM) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it is based on negative selection for cells expressing or highly expressing CD45RA and/or granzyme B. In some aspects, isolation of a CD8.sup.+ population enriched for T.sub.CM cells is carried out by depletion of cells expressing CD4, CD14, CD45RA, and positive selection or enrichment for cells expressing CD62L. In one aspect, enrichment for central memory T (T.sub.CM) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD14 and CD45RA, and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order. In some aspects, the same CD4 expression-based selection step used in preparing the CD8.sup.+ cell population or subpopulation, also is used to generate the CD4.sup.+ cell population or sub-population, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.

(50) In a particular example, a sample of PBMCs or other white blood cell sample is subjected to selection of CD4.sup.+ cells, where both the negative and positive fractions are retained. The negative fraction then is subjected to negative selection based on expression of CD14 and CD45RA or CD19, and positive selection based on a marker characteristic of central memory T cells, such as CD62L or CCR7, where the positive and negative selections are carried out in either order.

(51) CD4.sup.+ T helper cells are sorted into nave, central memory, and effector cells by identifying cell populations that have cell surface antigens. CD4.sup.+ lymphocytes can be obtained by standard methods. In some embodiments, naive CD4.sup.+ T lymphocytes are CD45RO.sup., CD45RA.sup.+, CD62L.sup.+, CD4.sup.+ T cells. In some embodiments, central memory CD4.sup.+ cells are CD62L.sup.+ and CD45RO.sup.+. In some embodiments, effector CD4.sup.+ cells are CD62L.sup. and CD45RO.sup..

(52) In one example, to enrich for CD4.sup.+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8. In some embodiments, the antibody or binding partner is bound to a solid support or matrix, such as a magnetic bead or paramagnetic bead, to allow for separation of cells for positive and/or negative selection. For example, in some embodiments, the cells and cell populations are separated or isolated using immunomagnetic (or affinitymagnetic) separation techniques (reviewed in Methods in Molecular Medicine, vol. 58: Metastasis Research Protocols, Vol. 2: Cell Behavior In Vitro and In Vivo, p 17-25 Edited by: S. A. Brooks and U. Schumacher Humana Press Inc., Totowa, N.J.).

(53) In some aspects, the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microparticles, such as paramagnetic beads (e.g., such as Dynalbeads or MACS beads). The magnetically responsive material, e.g., particle, generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.

(54) In some embodiments, the magnetic particle or bead comprises a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner. There are many well-known magnetically responsive materials used in magnetic separation methods. Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby incorporated by reference. Colloidal sized particles, such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084 are other examples.

(55) The incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.

(56) In some aspects, the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells. For positive selection, cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained. In some aspects, a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.

(57) In certain embodiments, the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin. In certain embodiments, the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers. In certain embodiments, the cells, rather than the beads, are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added. In certain embodiments, streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.

(58) In some embodiments, the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient. In some embodiments, the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, magnetizable particles or antibodies conjugated to cleavable linkers, etc. In some embodiments, the magnetizable particles are biodegradable.

(59) In some embodiments, the affinity-based selection is via magnetic-activated cell sorting (MACS) (Miltenyi Biotech, Auburn, Calif.). Magnetic Activated Cell Sorting (MACS) systems are capable of high-purity selection of cells having magnetized particles attached thereto. In certain embodiments, MACS operates in a mode wherein the non-target and target species are sequentially eluted after the application of the external magnetic field. That is, the cells attached to magnetized particles are held in place while the unattached species are eluted. Then, after this first elution step is completed, the species that were trapped in the magnetic field and were prevented from being eluted are freed in some manner such that they can be eluted and recovered. In certain embodiments, the non-target cells are labelled and depleted from the heterogeneous population of cells.

(60) In certain embodiments, the isolation or separation is carried out using a system, device, or apparatus that carries out one or more of the isolation, cell preparation, separation, processing, incubation, culture, and/or formulation steps of the methods. In some aspects, the system is used to carry out each of these steps in a closed or sterile environment, for example, to minimize error, user handling and/or contamination. In one example, the system is a system as described in International Patent Application, Publication Number WO2009/072003, or US 20110003380 A1.

(61) In some embodiments, the system or apparatus carries out one or more, e.g., all, of the isolation, processing, engineering, and formulation steps in an integrated or self-contained system, and/or in an automated or programmable fashion. In some aspects, the system or apparatus includes a computer and/or computer program in communication with the system or apparatus, which allows a user to program, control, assess the outcome of, and/or adjust various aspects of the processing, isolation, engineering, and formulation steps.

(62) In some aspects, the separation and/or other steps is carried out using CliniMACS system (Miltenyi Biotic), for example, for automated separation of cells on a clinical-scale level in a closed and sterile system. Components can include an integrated microcomputer, magnetic separation unit, peristaltic pump, and various pinch valves. The integrated computer in some aspects controls all components of the instrument and directs the system to perform repeated procedures in a standardized sequence. The magnetic separation unit in some aspects includes a movable permanent magnet and a holder for the selection column. The peristaltic pump controls the flow rate throughout the tubing set and, together with the pinch valves, ensures the controlled flow of buffer through the system and continual suspension of cells.

(63) The CliniMACS system in some aspects uses antibody-coupled magnetizable particles that are supplied in a sterile, non-pyrogenic solution. In some embodiments, after labelling of cells with magnetic particles the cells are washed to remove excess particles. A cell preparation bag is then connected to the tubing set, which in turn is connected to a bag containing buffer and a cell collection bag. The tubing set consists of pre-assembled sterile tubing, including a pre-column and a separation column, and are for single use only. After initiation of the separation program, the system automatically applies the cell sample onto the separation column. Labelled cells are retained within the column, while unlabeled cells are removed by a series of washing steps. In some embodiments, the cell populations for use with the methods described herein are unlabeled and are not retained in the column. In some embodiments, the cell populations for use with the methods described herein are labeled and are retained in the column. In some embodiments, the cell populations for use with the methods described herein are eluted from the column after removal of the magnetic field, and are collected within the cell collection bag.

(64) In certain embodiments, separation and/or other steps are carried out using the CliniMACS Prodigy system (Miltenyi Biotec). The CliniMACS Prodigy system in some aspects is equipped with a cell processing unity that permits automated washing and fractionation of cells by centrifugation. The CliniMACS Prodigy system can also include an onboard camera and image recognition software that determines the optimal cell fractionation endpoint by discerning the macroscopic layers of the source cell product. For example, peripheral blood is automatically separated into erythrocytes, white blood cells and plasma layers. The CliniMACS Prodigy system can also include an integrated cell cultivation chamber which accomplishes cell culture protocols such as, e.g., cell differentiation and expansion, antigen loading, and long-term cell culture. Input ports can allow for the sterile removal and replenishment of media and cells can be monitored using an integrated microscope. See, e.g., Klebanoff et al.(2012) J Immunother. 35(9): 651-660, Terakura et al. (2012) Blood.1:72-82, and Wang et al. (2012) J Immunother. 35(9):689-701.

(65) In some embodiments, a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream. In some embodiments, a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting. In certain embodiments, a cell population described herein is collected and enriched (or depleted) by use of microelectromechanical systems (MEMS) chips in combination with a FACS-based detection system (see, e.g., WO 2010/033140, Cho et al. (2010) Lab Chip 10, 1567-1573; and Godin et al. (2008) J Biophoton. 1(5):355-376. In both cases, cells can be labeled with multiple markers, allowing for the isolation of well-defined T cell subsets at high purity.

(66) In some embodiments, the antibodies or binding partners are labeled with one or more detectable marker, to facilitate separation for positive and/or negative selection. For example, separation may be based on binding to fluorescently labeled antibodies. In some examples, separation of cells based on binding of antibodies or other binding partners specific for one or more cell surface markers are carried in a fluidic stream, such as by fluorescence-activated cell sorting (FACS), including preparative scale (FACS) and/or microelectromechanical systems (MEMS) chips, e.g., in combination with a flow-cytometric detection system. Such methods allow for positive and negative selection based on multiple markers simultaneously.

(67) Cryopreservation

(68) In some embodiments, the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering. In some embodiments, the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population. In some embodiments, the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used. One example involves using PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1:1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively. The cells are then frozen to 80 C. at a rate of 1 per minute and stored in the vapor phase of a liquid nitrogen storage tank.

(69) In some embodiments, the provided methods include cultivation, incubation, culture, and/or genetic engineering steps. For example, in some embodiments, provided are methods for incubating and/or engineering the depleted cell populations and culture-initiating compositions.

(70) Thus, in some embodiments, the cell populations are incubated in a culture-initiating composition. The incubation and/or engineering may be carried out in a culture vessel, such as a unit, chamber, well, column, tube, tubing set, valve, vial, culture dish, bag, or other container for culture or cultivating cells.

(71) Incubation and Culture

(72) In some embodiments, the cells are incubated and/or cultured prior to or in connection with genetic engineering. The incubation steps can include culture, cultivation, stimulation, activation, and/or propagation. In some embodiments, the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a genetically engineered antigen receptor.

(73) The conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.

(74) In some embodiments, the stimulating conditions or agents include one or more agent, e.g., ligand, which is capable of activating an intracellular signaling domain of a TCR complex. In some aspects, the agent turns on or initiates TCR/CD3 intracellular signaling cascade in a T cell. Such agents can include antibodies, such as those specific for a TCR component and/or costimulatory receptor, e.g., anti-CD3, anti-CD28, for example, bound to solid support such as a bead, and/or one or more cytokines. Optionally, the expansion method may further comprise the step of adding anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at a concentration of at least about 0.5 ng/ml). In some embodiments, the stimulating agents include 1L-2 and/or IL-15, for example, an IL-2 concentration of at least about 10 units/mL.

(75) In some aspects, incubation is carried out in accordance with techniques such as those described in U.S. Pat. No. 6,040,177 to Riddell et al., Klebanoff et al.(2012) J Immunother. 35(9): 651-660, Terakura et al. (2012) Blood.1:72-82, and/or Wang et al. (2012) J Immunother. 35(9):689-701.

(76) In some embodiments, the T cells are expanded by adding to the culture-initiating composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells). In some aspects, the non-dividing feeder cells can comprise gamma-irradiated PBMC feeder cells. In some embodiments, the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division. In some aspects, the feeder cells are added to culture medium prior to the addition of the populations of T cells.

(77) In some embodiments, the stimulating conditions include temperature suitable for the growth of human T lymphocytes, for example, at least about 25 degrees Celsius, generally at least about 30 degrees, and generally at or about 37 degrees Celsius. Optionally, the incubation may further comprise adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells. LCL can be irradiated with gamma rays in the range of about 6000 to 10,000 rads. The LCL feeder cells in some aspects is provided in any suitable amount, such as a ratio of LCL feeder cells to initial T lymphocytes of at least about 10:1.

(78) In embodiments, antigen-specific T cells, such as antigen-specific CD4+ and/or CD8+ T cells, are obtained by stimulating naive or antigen specific T lymphocytes with antigen. For example, antigen-specific T cell lines or clones can be generated to cytomegalovirus antigens by isolating T cells from infected subjects and stimulating the cells in vitro with the same antigen.

(79) In some aspects, the methods include assessing expression of one or more markers on the surface of the engineered cells or cells being engineered. In one embodiment, the methods include assessing surface expression of one or more target antigen (e.g., antigen recognized by the genetically engineered antigen receptor) sought to be targeted by the adoptive cell therapy, for example, by affinity-based detection methods such as by flow cytometry. In some aspects, where the method reveals surface expression of the antigen or other marker, the gene encoding the antigen or other marker is disrupted or expression otherwise repressed for example, using the methods described herein.

(80) B. Genetically Engineered Antigen Receptors

(81) In some embodiments, the cells comprise one or more nucleic acids introduced via genetic engineering that encode one or more antigen receptors, and genetically engineered products of such nucleic acids. In some embodiments, the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived. In some embodiments, the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types.

(82) Among the genetically engineered products are genetically engineered antigen receptors. Among such antigen receptors are genetically engineered T cell receptors (TCRs) and components thereof, and functional non-TCR antigen receptors, such as chimeric antigen receptors (CAR), including chimeric activating receptors and chimeric costimulatory receptors. In some embodiments, the CAR contains an extracellular antigen-recognition domain that specifically binds to an antigen. In some embodiments, the antigen is a protein expressed on the surface of cells. In some embodiments, the CAR is a TCR-like CAR and the antigen is a processed peptide antigen, such as a peptide antigen of an intracellular protein, which, like a TCR, is recognized on the cell surface in the context of a major histocompatibility complex (MHC) molecule.

(83) Exemplary antigen receptors, including CARs and recombinant TCRs, as well as methods for engineering and introducing the receptors into cells, include those described, for example, in international patent application publication numbers WO200014257, WO2013126726, WO2012/129514, WO2014031687, WO2013/166321, WO2013/071154, WO2013/123061 U.S. patent application publication numbers US2002131960, US2013287748, US20130149337, U.S. Pat. Nos. 6,451,995, 7,446,190, 8,252,592, 8,339,645, 8,398,282, 7,446,179, 6,410,319, 7,070,995, 7,265,209, 7,354,762, 7,446,191, 8,324,353, and 8,479,118, and European patent application number EP2537416, and/or those described by Sadelain et al., Cancer Discov. 2013 April; 3(4): 388-398; Davila et al. (2013) PLoS ONE 8(4): e61338; Turtle et al., Curr. Opin. Immunol., 2012 October; 24(5): 633-39; Wu et al., Cancer, 2012 March 18(2): 160-75. In some aspects, the genetically engineered antigen receptors include a CAR as described in U.S. Pat. No. 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 A1.

(84) Chimeric Antigen Receptors (CARs)

(85) In some embodiments, the engineered antigen receptors include chimeric antigen receptors (CARs), including activating or stimulatory CARs, costimulatory CARs (see WO2014/055668), and/or inhibitory CARs (iCARs, see Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013). The CARs generally include an extracellular antigen (or ligand) binding domain linked to one or more intracellular signaling components, in some aspects via linkers and/or transmembrane domain(s). Such molecules typically mimic or approximate a signal through a natural antigen receptor, a signal through such a receptor in combination with a costimulatory receptor, and/or a signal through a costimulatory receptor alone.

(86) In some embodiments, CAR is constructed with a specificity for a particular antigen (or marker or ligand), such as an antigen expressed in a particular cell type to be targeted by adoptive therapy, e.g., a cancer marker, and/or an antigen intended to induce a dampening response, such as an antigen expressed on a normal or non-diseased cell type. Thus, the CAR typically includes in its extracellular portion one or more antigen binding molecules, such as one or more antigen-binding fragment, domain, or portion, or one or more antibody variable domains, and/or antibody molecules. In some embodiments, the CAR includes an antigen-binding portion or portions of an antibody molecule, such as a single-chain antibody fragment (scFv) derived from the variable heavy (VH) and variable light (VL) chains of a monoclonal antibody (mAb).

(87) The term antibody herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen-binding) antibody fragments, including fragment antigen binding (Fab) fragments, F(ab).sub.2 fragments, Fab fragments, Fv fragments, recombinant IgG (rIgG) fragments, variable heavy chain (V.sub.H) regions capable of specifically binding the antigen, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv. Unless otherwise stated, the term antibody should be understood to encompass functional antibody fragments thereof. The term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.

(88) In some embodiments, the antigen-binding proteins, antibodies and antigen binding fragments thereof specifically recognize an antigen of a full-length antibody. In some embodiments, the heavy and light chains of an antibody can be full-length or can be an antigen-binding portion (a Fab, F(ab)2, Fv or a single chain Fv fragment (scFv)). In other embodiments, the antibody heavy chain constant region is chosen from, e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE, particularly chosen from, e.g., IgG1, IgG2, IgG3, and IgG4, more particularly, IgG1 (e.g., human IgG1). In another embodiment, the antibody light chain constant region is chosen from, e.g., kappa or lambda, particularly kappa.

(89) Among the provided antibodies are antibody fragments. An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab, Fab-SH, F(ab).sub.2; diabodies; linear antibodies; variable heavy chain (V.sub.H) regions, single-chain antibody molecules such as scFvs and single-domain V.sub.H single antibodies; and multispecific antibodies formed from antibody fragments. In particular embodiments, the antibodies are single-chain antibody fragments comprising a variable heavy chain region and/or a variable light chain region, such as scFvs.

(90) The term variable region or variable domain refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (V.sub.H and V.sub.L, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three CDRs. (See, e.g., Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007). A single V.sub.H or V.sub.L domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a V.sub.H or V.sub.L domain from an antibody that binds the antigen to screen a library of complementary V.sub.L or V.sub.H domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).

(91) Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody. In some embodiments, the CAR comprises an antibody heavy chain domain that specifically binds the antigen, such as a cancer marker or cell surface antigen of a cell or disease to be targeted, such as a tumor cell or a cancer cell, such as any of the target antigens described herein or known in the art.

(92) Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells. In some embodiments, the antibodies are recombinantly-produced fragments, such as fragments comprising arrangements that do not occur naturally, such as those with two or more antibody regions or chains joined by synthetic linkers, e.g., peptide linkers, and/or that are may not be produced by enzyme digestion of a naturally-occurring intact antibody. In some aspects, the antibody fragments are scFvs.

(93) A humanized antibody is an antibody in which all or substantially all CDR amino acid residues are derived from non-human CDRs and all or substantially all FR amino acid residues are derived from human FRs. A humanized antibody optionally may include at least a portion of an antibody constant region derived from a human antibody. A humanized form of a non-human antibody, refers to a variant of the non-human antibody that has undergone humanization, typically to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the CDR residues are derived), e.g., to restore or improve antibody specificity or affinity.

(94) In some embodiments, the CAR contains an antibody or an antigen-binding fragment (e.g. scFv) that specifically recognizes an antigen, such as an intact antigen, expressed on the surface of a cell, such as a disease-specific antigen. In some embodiments, the CAR further recognizes or binds to, e.g., is cross-reactive with, one or more antigens that are related to, such as by way of sharing similarity or identity in sequence, epitope, or structure, the target antigen that the CAR was designed to recognize, such as the disease-specific antigen.

(95) In some embodiments, the CAR contains a TCR-like antibody, such as an antibody or an antigen-binding fragment (e.g. scFv) that specifically recognizes an intracellular antigen, such as a tumor-associated antigen, presented on the cell surface as a MHC-peptide complex. In some embodiments, an antibody or antigen-binding portion thereof that recognizes an MHC-peptide complex can be expressed on cells as part of a recombinant receptor, such as an antigen receptor. Among the antigen receptors are functional non-TCR antigen receptors, such as chimeric antigen receptors (CARs). Generally, a CAR containing an antibody or antigen-binding fragment that exhibits TCR-like specificity directed against peptide-MHC complexes also may be referred to as a TCR-like CAR.

(96) Reference to Major histocompatibility complex (MHC) refers to a protein, generally a glycoprotein, that contains a polymorphic peptide binding site or binding groove that can, in some cases, complex with peptide antigens of polypeptides, including peptide antigens processed by the cell machinery. In some cases, MHC molecules can be displayed or expressed on the cell surface, including as a complex with peptide, i.e. MHC-peptide complex, for presentation of an antigen in a conformation recognizable by an antigen receptor on T cells, such as a TCRs or TCR-like antibody. Generally, MHC class I molecules are heterodimers having a membrane spanning chain, in some cases with three a domains, and a non-covalently associated (32 microglobulin. Generally, MHC class II molecules are composed of two transmembrane glycoproteins, and , both of which typically span the membrane. An MHC molecule can include an effective portion of an MHC that contains an antigen binding site or sites for binding a peptide and the sequences necessary for recognition by the appropriate antigen receptor. In some embodiments, MHC class I molecules deliver peptides originating in the cytosol to the cell surface, where a MHC-peptide complex is recognized by T cells, such as generally CD8.sup.+ T cells, but in some cases CD4+ T cells. In some embodiments, MHC class II molecules deliver peptides originating in the vesicular system to the cell surface, where they are typically recognized by CD4.sup.+ T cells. Generally, MHC molecules are encoded by a group of linked loci, which are collectively termed H-2 in the mouse and human leukocyte antigen (HLA) in humans. Hence, typically human MHC can also be referred to as human leukocyte antigen (HLA).

(97) The term MHC-peptide complex or peptide-MHC complex or variations thereof, refers to a complex or association of a peptide antigen and an MHC molecule, such as, generally, by non-covalent interactions of the peptide in the binding groove or cleft of the MHC molecule. In some embodiments, the MHC-peptide complex is present or displayed on the surface of cells. In some embodiments, the MHC-peptide complex can be specifically recognized by an antigen receptor, such as a TCR, TCR-like CAR or antigen-binding portions thereof.

(98) The term peptide antigen or peptide epitope refers to a peptide of a polypeptide that can associate with an MHC molecule, such as for recognition by an antigen receptor. Generally, the peptide is derived from or based on a fragment of a longer biological molecule, such as a polypeptide or protein. In some embodiments, the peptide typically is about 8 to about 24 amino acids in length. In some embodiments, a peptide has a length of from or from about 9 to 22 amino acids for recognition in the MHC Class II complex. In some embodiments, a peptide has a length of from or from about 8 to 13 amino acids for recognition in the MHC Class I complex. In some embodiments, upon recognition of the peptide in the context of an MHC molecule, such as MHC-peptide complex, the antigen receptor, such as TCR or TCR-like CAR, produces or triggers an activation signal to the T cell that induces a T cell response, such as T cell proliferation, cytokine production, a cytotoxic T cell response or other response.

(99) In some embodiments, an antibody or antigen-binding portion thereof that specifically binds to a MHC-peptide complex, can be produced by immunizing a host with an effective amount of an immunogen containing a specific MHC-peptide complex. In some cases, the peptide of the MHC-peptide complex is an epitope of antigen capable of binding to the MHC, such as a tumor antigen, for example a universal tumor antigen, or a family member thereof, myeloma antigen or other antigen as described below. In some embodiments, an effective amount of the immunogen is then administered to a host for eliciting an immune response, wherein the immunogen retains a three-dimensional form thereof for a period of time sufficient to elicit an immune response against the three-dimensional presentation of the peptide in the binding groove of the MHC molecule. Serum collected from the host is then assayed to determine if desired antibodies that recognize a three-dimensional presentation of the peptide in the binding groove of the MHC molecule is being produced. In some embodiments, the produced antibodies can be assessed to confirm that the antibody can differentiate the MHC-peptide complex from the MHC molecule alone, the peptide of interest alone, and a complex of MHC and irrelevant peptide. The desired antibodies can then be isolated.

(100) In some embodiments, an antibody or antigen-binding portion thereof that specifically binds to an MHC-peptide complex can be produced by employing antibody library display methods, such as phage antibody libraries. In some embodiments, phage display libraries of mutant Fab, scFV or other antibody forms can be generated, for example, in which members of the library are mutated at one or more residues of a CDR or CDRs. Exemplary of such methods are known in the art (see e.g. US published application No. US20020150914, US2014/0294841; and Cohen C J. et al. (2003) J Mol. Recogn. 16:324-332).

(101) In some aspects, the antigen-specific binding, or recognition component is linked to one or more transmembrane and intracellular signaling domains. In some embodiments, the CAR includes a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, the transmembrane domain that naturally is associated with one of the domains in the CAR is used. In some instances, the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.

(102) The transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein. Transmembrane regions include those derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, e.g., CD8alpha, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, and CD 154. Alternatively the transmembrane domain in some embodiments is synthetic. In some aspects, the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine. In some aspects, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.

(103) In some embodiments, a short oligo- or polypeptide linker, for example, a linker of between 2 and 10 amino acids in length, such as one containing glycines and serines, e.g., glycine-serine doublet, is present and forms a linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.

(104) The CAR generally includes at least one intracellular signaling component or components. In some embodiments, the CAR includes an intracellular component of the TCR complex, such as a TCR CD3.sup.+ chain that mediates T-cell activation and cytotoxicity, e.g., CD3 zeta chain. Thus, in some aspects, the antigen binding molecule is linked to one or more cell signaling modules. In some embodiments, cell signaling modules include CD3 transmembrane domain, CD3 intracellular signaling domains, and/or other CD transmembrane domains. In some embodiments, the CAR further includes a portion of one or more additional molecules such as Fc receptor , CD8, CD4, CD25, or CD16. For example, in some aspects, the CAR includes a chimeric molecule containing signaling domains of CD3-zeta (CD3-) or Fc receptor and signaling domains or transmembrane domains of CD8, CD4, CD25 and/or CD16.

(105) In some embodiments, upon ligation of the CAR, the cytoplasmic domain or intracellular signaling domain of the CAR activates at least one of the normal effector functions or responses of the immune cell, e.g., T cell engineered to express the cell. For example, in some contexts, the CAR induces a function of a T cell such as cytolytic activity or T-helper activity, such as secretion of cytokines or other factors. In some embodiments, a truncated portion of an intracellular signaling domain of an antigen receptor component or costimulatory molecule. Such truncated portion in some aspects is used in place of an intact immunostimulatory chain, for example, if it transduces the effector function signal. In some embodiments, the intracellular signaling domain or domains include the cytoplasmic sequences of the T cell receptor (TCR), and in some aspects also those of co-receptors that in the natural context act in concert with such receptor to initiate signal transduction following antigen receptor engagement, and/or any derivative or variant of such molecules, and/or any synthetic sequence that has the same functional capability.

(106) In the context of a natural TCR, full activation generally requires not only signaling through the TCR, but also a costimulatory signal. Thus, in some embodiments, to promote full activation, a component for generating secondary or co-stimulatory signal is also included in the CAR. In other embodiments, the CAR does not include a component for generating a costimulatory signal. In some aspects, an additional CAR is expressed in the same cell and provides the component for generating the secondary or costimulatory signal. In some aspects, the cell comprises a first CAR which contains signaling domains to induce the primary signal and a second CAR which binds to a second antigen and contains the component for generating a costimulatory signal. For example, a first CAR can be an activating CAR and the second CAR can be a costimulatory CAR. In some aspects, both CARs must be ligated in order to induce a particular effector function in the cell, which can provide specificity and selectivity for the cell type being targeted.

(107) T cell activation is in some aspects described as being mediated by two classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences), and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences). In some aspects, the CAR includes one or both of such signaling components.

(108) In some aspects, the CAR includes a primary cytoplasmic signaling sequence that regulates primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Examples of ITAM containing primary cytoplasmic signaling sequences include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD79a, and CD79b. In some embodiments, cytoplasmic signaling molecule(s) in the CAR contain(s) a cytoplasmic signaling domain, portion thereof, or sequence derived from CD3 zeta.

(109) In some embodiments, the CAR includes a signaling domain and/or transmembrane portion of a costimulatory receptor, such as CD28, 4-1BB, OX40, DAP10, and ICOS. In some aspects, the same CAR includes both the activating and costimulatory components; in other aspects, the activating domain is provided by one CAR whereas the costimulatory component is provided by another CAR recognizing another antigen.

(110) In certain embodiments, the intracellular signaling domain comprises a CD28 transmembrane and signaling domain linked to a CD3 (e.g., CD3-zeta) intracellular domain. In some embodiments, the intracellular signaling domain comprises a chimeric CD28 and CD137 (4-1BB, TNFRSF9) co-stimulatory domains, linked to a CD3 zeta or other primary or activating intracellular domain.

(111) In some embodiments, the CAR encompasses two or more costimulatory domain combined with an activation domain, e.g., primary activation domain, in the cytoplasmic portion. One example is a receptor including intracellular components of CD3-zeta, CD28, and 4-1BB.

(112) In some embodiments, the CAR or other antigen receptor further includes a marker to confirm transduction or engineering of the cell to express the receptor, such as a truncated version of a cell surface receptor, such as truncated EGFR, EGFRt). In some aspects, the marker is under the control of the same promoter or regulatory element such as enhancer as the CAR or other receptor. In some aspects, where multi-targeting approaches are used, multiple markers are used for each different receptor.

(113) In some cases, CARs are referred to as first, second, and/or third generation CARs. In some aspects, a first generation CAR is one that solely provides a CD3-chain induced signal upon antigen binding; in some aspects, a second-generation CARs is one that provides such a signal and costimulatory signal, such as one including an intracellular signaling domain from a costimulatory receptor such as CD28 or CD137; in some aspects, a third generation CAR in some aspects is one that include multiple costimulatory domains of different costimulatory receptors.

(114) In some aspects, the CAR or other antigen receptor is an inhibitory CAR (e.g. iCAR) and includes intracellular components that dampen or suppress a response, such as an immune response, such as an ITAM- and/or costimulatory-promoted response in the cell. Exemplary of such intracellular signaling components are those found on immune checkpoint molecules, including PD-1, CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1, PGE2 receptors, EP2/4 Adenosine receptors including A2AR. In some aspects, the engineered cell includes an inhibitory CAR including a signaling domain of or derived from such an inhibitory molecule, such that it serves to dampen the response of the cell, for example, that induced by an activating and/or costimulatory CAR. Such CARs are used, for example, to reduce the likelihood of off-target effects in the context in which the antigen recognized by the activating receptor, e.g, CAR, is also expressed or may also be expressed on the surface of normal cells. In some aspects, an inhibitory receptor, e.g., iCAR is introduced which recognizes a marker specific to the normal cell. In some aspects, where such an antigen or antigen related thereto is also expressed on the engineered cell, the antigen is the target of gene editing or disruption approaches provided herein. In some aspects, such disruption avoids dampening of the engineered cells' response induced by the engineered cells themselves.

(115) TCRs

(116) In some embodiments, the genetically engineered antigen receptors include recombinant T cell receptors (TCRs) and/or TCRs cloned from naturally occurring T cells and/or pairs of chains of TCRs cloned from naturally occurring T cells.

(117) In general, TCRs contain a variable and chains (also known as TCR and TCR, respectively) or a variable and chain (also known as TCR and TCR, respectively) or antigen-binding portion(s) thereof, and in general are capable of specifically binding to an antigen peptide bound to a MHC receptor. In some embodiments, the TCR is in the form. Typically, TCRs that exist in and forms are generally structurally similar, but T cells expressing them may have distinct anatomical locations or functions. A TCR can be found on the surface of a cell or in soluble form. Generally, a TCR is found on the surface of T cells (or T lymphocytes) where it is generally responsible for recognizing antigens bound to major histocompatibility complex (MHC) molecules. In some embodiments, a TCR also can contain a constant domain, a transmembrane domain and/or a short cytoplasmic tail (see, e.g., Janeway et al., Immunobiology: The Immune System in Health and Disease, 3.sup.rd Ed., Current Biology Publications, p. 4:33, 1997). For example, in some aspects, each chain of the TCR can possess one N-terminal immunoglobulin variable domain, one immunoglobulin constant domain, a transmembrane region, and a short cytoplasmic tail at the C-terminal end. In some embodiments, a TCR is associated with invariant proteins of the CD3 complex involved in mediating signal transduction. Unless otherwise stated, the term TCR should be understood to encompass functional TCR fragments thereof. The term also encompasses intact or full-length TCRs, including TCRs in the form or form.

(118) Thus, for purposes herein, reference to a TCR includes any TCR or functional fragment, such as an antigen-binding portion of a TCR that binds to a specific antigenic peptide bound in an MHC molecule, i.e. MHC-peptide complex. An antigen-binding portion or antigen-binding fragment of a TCR, which can be used interchangeably, refers to a molecule that contains a portion of the structural domains of a TCR, but that binds the antigen (e.g. MHC-peptide complex) to which the full TCR binds. In some cases, an antigen-binding portion contains the variable domains of a TCR, such as variable chain and variable chain of a TCR, sufficient to form a binding site for binding to a specific MHC-peptide complex, such as generally where each chain contains three complementarity determining regions.

(119) In some embodiments, the variable domains of the TCR chains associate to form loops, or complementarity determining regions (CDRs) analogous to immunoglobulins, which confer antigen recognition and determine peptide specificity by forming the binding site of the TCR molecule and determine peptide specificity. Typically, like immunoglobulins, the CDRs are separated by framework regions (FRs) (see, e.g., Jores et al., Proc. Nat'l Acad. Sci. U.S.A. 87:9138, 1990; Chothia et al., EMBO J. 7:3745, 1988; see also Lefranc et al., Dev. Comp. Immunol. 27:55, 2003). In some embodiments, CDR3 is the main CDR responsible for recognizing processed antigen, although CDR1 of the alpha chain has also been shown to interact with the N-terminal part of the antigenic peptide, whereas CDR1 of the beta chain interacts with the C-terminal part of the peptide. CDR2 is thought to recognize the MHC molecule. In some embodiments, the variable region of the -chain can contain a further hypervariability (HV4) region.

(120) In some embodiments, the TCR chains contain a constant domain. For example, like immunoglobulins, the extracellular portion of TCR chains (e.g., -chain, -chain) can contain two immunoglobulin domains, a variable domain (e.g., V.sub. or V.sub.; typically amino acids 1 to 116 based on Kabat numbering Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Dept. Health and Human Services, Public Health Service National Institutes of Health, 1991, 5.sup.th ed.) at the N-terminus, and one constant domain (e.g., -chain constant domain or C.sub., typically amino acids 117 to 259 based on Kabat, -chain constant domain or C.sub., typically amino acids 117 to 295 based on Kabat) adjacent to the cell membrane. For example, in some cases, the extracellular portion of the TCR formed by the two chains contains two membrane-proximal constant domains, and two membrane-distal variable domains containing CDRs. The constant domain of the TCR domain contains short connecting sequences in which a cysteine residue forms a disulfide bond, making a link between the two chains. In some embodiments, a TCR may have an additional cysteine residue in each of the and chains such that the TCR contains two disulfide bonds in the constant domains.

(121) In some embodiments, the TCR chains can contain a transmembrane domain. In some embodiments, the transmembrane domain is positively charged. In some cases, the TCR chains contains a cytoplasmic tail. In some cases, the structure allows the TCR to associate with other molecules like CD3. For example, a TCR containing constant domains with a transmembrane region can anchor the protein in the cell membrane and associate with invariant subunits of the CD3 signaling apparatus or complex.

(122) Generally, CD3 is a multi-protein complex that can possess three distinct chains (, , and ) in mammals and the -chain. For example, in mammals the complex can contain a CD3 chain, a CD3 chain, two CD3 chains, and a homodimer of CD3 chains. The CD3, CD3, and CD3 chains are highly related cell surface proteins of the immunoglobulin superfamily containing a single immunoglobulin domain. The transmembrane regions of the CD3, CD3, and CD3 chains are negatively charged, which is a characteristic that allows these chains to associate with the positively charged T cell receptor chains. The intracellular tails of the CD3, CD3, and CD3 chains each contain a single conserved motif known as an immunoreceptor tyrosine-based activation motif or ITAM, whereas each CD3 chain has three. Generally, ITAMs are involved in the signaling capacity of the TCR complex. These accessory molecules have negatively charged transmembrane regions and play a role in propagating the signal from the TCR into the cell. The CD3- and -chains, together with the TCR, form what is known as the T cell receptor complex.

(123) In some embodiments, the TCR may be a heterodimer of two chains and (or optionally and ) or it may be a single chain TCR construct. In some embodiments, the TCR is a heterodimer containing two separate chains ( and chains or and chains) that are linked, such as by a disulfide bond or disulfide bonds.

(124) In some embodiments, a TCR for a target antigen (e.g., a cancer antigen) is identified and introduced into the cells. In some embodiments, a TCR for a target antigen also specifically binds to, e.g., is cross-reactive with, one or more peptide epitopes of one or more other antigens, such as those that are related to (e.g., by way of sharing sequence or structural similarity with) the target antigen. The cross-reactive antigen may have an epitope that is the same as or has one or more amino acid differences as compared to the target antigen, such as one, two, or three differences. In some embodiments, nucleic acid encoding the TCR can be obtained from a variety of sources, such as by polymerase chain reaction (PCR) amplification of publicly available TCR DNA sequences. In some embodiments, the TCR is obtained from a biological source, such as from cells such as from a T cell (e.g. cytotoxic T cell), T-cell hybridomas or other publicly available source. In some embodiments, the T-cells can be obtained from in vivo isolated cells. In some embodiments, a such as a high-affinity T cell clone can be isolated from a patient, and the TCR isolated. In some embodiments, the T-cells can be a cultured T-cell hybridoma or clone. In some embodiments, the TCR clone for a target antigen has been generated in transgenic mice engineered with human immune system genes (e.g., the human leukocyte antigen system, or HLA). See, e.g., tumor antigens (see, e.g., Parkhurst et al. (2009) Clin Cancer Res. 15:169-180 and Cohen et al. (2005) J Immunol. 175:5799-5808. In some embodiments, phage display is used to isolate TCRs against a target antigen (see, e.g., Varela-Rohena et al. (2008) Nat Med. 14:1390-1395 and Li (2005) Nat Biotechnol. 23:349-354. In some embodiments, the TCR or antigen-binding portion thereof can be synthetically generated from knowledge of the sequence of the TCR.

(125) In some embodiments, after the T-cell clone is obtained, the TCR alpha and beta chains are isolated and cloned into a gene expression vector. In some embodiments, the TCR alpha and beta genes are linked via a picornavirus 2A ribosomal skip peptide so that both chains are coexpression. In some embodiments, genetic transfer of the TCR is accomplished via retroviral or lentiviral vectors, or via transposons (see, e.g., Baum et al. (2006) Molecular Therapy: The Journal of the American Society of Gene Therapy. 13:1050-1063; Frecha et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:1748-1757; an Hackett et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:674-683.

(126) Antigens

(127) Among the antigens targeted by the genetically engineered antigen receptors are those expressed in the context of (e.g., that are specifically expressed on or in, overexpressed on or in, or associated with) a disease, condition, or cell type to be targeted via the adoptive cell therapy. In some embodiments, such antigens are referred to as disease-specific antigens, disease-specific targets and/or disease-specific target antigens. In some embodiments, the disease-specific target antigen differs from a non-disease-specific target antigen by only an epitope or relatively small change, e.g., an epitope that is exposed or present only in the disease or condition. Among the diseases and conditions are proliferative, neoplastic, and malignant diseases and disorders, including cancers and tumors, including hematologic cancers, cancers of the immune system, such as lymphomas, leukemias, and/or myelomas, such as B, T, and myeloid leukemias, lymphomas, and multiple myelomas.

(128) In some embodiments, the antigen is a polypeptide. In some embodiments, it is a carbohydrate or other molecule. In some embodiments, the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues. In other embodiments, the antigen is expressed on normal cells and/or is expressed on the engineered cells. In some such embodiments, a multi-targeting and/or gene disruption approach as provided herein is used to improve specificity and/or efficacy.

(129) In some embodiments, the antigen is a universal tumor antigen, or a family member thereof. The term universal tumor antigen refers to an immunogenic molecule, such as a protein, that is, generally, expressed at a higher level in tumor cells than in non-tumor cells and also is expressed in tumors of different origins. In some embodiments, the universal tumor antigen is expressed in more than 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90% or more of human cancers. In some embodiments, the universal tumor antigen is expressed in at least three, at least four, at least five, at least six, at least seven, at least eight or more different types of tumors. In some cases, the universal tumor antigen may be expressed in non-tumor cells, such as normal cells, but at lower levels than it is expressed in tumor cells. In some cases, the universal tumor antigen is not expressed at all in non-tumor cells, such as not expressed in normal cells. Exemplary universal tumor antigens include, for example, human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53, cyclin (D1). Peptide epitopes of tumor antigens, including universal tumor antigens, are known in the art and, in some aspects, can be used to generate MHC-restricted antigen receptors, such as TCRs or TCR-like CARs (see e.g. published PCT application No. WO2011009173 or WO2012135854 and published U.S. application No. US20140065708).

(130) In some aspects, the target antigen is or includes a disease-specific antigen such as a tumor antigen, which is not expressed naturally on or in the engineered cells and/or is not upregulated on or in activated T cells or activated cells of a type used to generate the engineered cells. In some such aspects, however, the receptor further binds to or recognizes, or has the potential to bind to or recognize (such as by cross-reactivity) another antigen, such as an antigen that is related to the target antigen, e.g., by way of sequence or structural similarity, and in some aspects that is expressed naturally on or in the engineered cells or activated types or forms thereof thereof and/or is upregulated on or in activated T cells or activated cells of the type being used. For example, in some such cases, if a T cell or activated T cell expresses or is suspected of expressing or upregulating an antigen that is related to a tumor antigen, an antibody or binding protein that binds to the tumor antigen but may also bind to and be cross-reactive to the antigen expressed in the T cell. In some aspects, the target antigen is or is a family member of BCMA, TACI, or BAFFR. For example, in some aspects, the target antigen is BCMA and the cells may express TACI and/or BAFFR and in some examples the receptor may cross-react therewith.

(131) An exemplary description of one or more antigens that are related to or a family member of a target antigen includes antigens that exhibit structural and/or sequence similarity to a target antigen, e.g., by having the same or a similar epitope(s), for example in some cases, such that antibodies, receptors, engineered receptors, or other binding agents or ligands that bind to the target antigen also bind to (e.g. are cross-reactive to) the related antigen. For example, an agent, such as an engineered receptor such as an engineered antigen receptor, that specifically binds to and/or recognizes BCMA may in some aspects be cross-reactive to TACI, for example, such as an agent as described in WO 2002/066516, and/or BAFF-R. Likewise, agents that bind to and/or recognize TACI may be cross-reactive to BCMA or BAFF-R. Antigens that are related to or a family member of a target antigen may be evolutionarily related and/or related by structure and/or sequence. Antigens that are related to or a family member of a target antigen may exhibit a percent sequence identity to the target antigen by nucleic acid and/or amino acid sequence. Antigens that are related to or a family member of a target antigen may in some aspects exhibit at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to the target antigen either by nucleic acid or amino acid sequence. In some aspects, they may exhibit 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity over a portion comprising an epitope, such as an epitope recognized by the receptor. In some aspects, such a portion may include at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids, such as contiguous amino acids. In some embodiments, the related antigens may not exhibit a high degree of similarity in sequence over a contiguous stretch of amino acids but may share a similar or the same epitope within the respective folded proteins, such as an epitope comprising multiple contiguous portions. In some embodiments, the related antigens bind to, e.g., specifically bind to, the same ligand or receptor. In some embodiments, an antigen that is related to or a family member of a target antigen may exhibit a certain percentage sequence identity or structural similarity over only a portion of the full-length sequence or structure of the antigen, such as over a series of predicted epitopes. For example, a target antigen may comprise a number of peptide epitopes that are recognized by the engineered binding proteins described herein. In some embodiments, an antigen that is related to a target antigen may comprise epitopes that are structurally and/or sequentially similar to a relevant epitope of a target antigen. In some embodiments, these epitopes are peptides of about 8 to about 24 amino acids in length.

(132) In some embodiments, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is hTERT. hTERT is a tumor antigen that is widely expressed in various cancers. In some aspects, hTERT has or contains a sequence of amino acids set forth in SEQ ID NO:3 (GenBank Accession No. NP_937983.2) and encoded by a sequence of nucleotides set forth in SEQ ID NO:4 (GenBank Accession No. NM_198253.2). Generally, hTERT is a reverse transcriptase that is part of the human telomerase complex, which is a complex that can maintain the telomeric ends of linear chromosomes and, in some cases, protects chromosomes from degradation and end-to-end fusion. In some aspects, hTERT expression results in teleomere synthesis from an RNA template, and its expression can correlate with telomerase activity because it is the rate-limiting component of the complex. Generally, hTERT is not expressed in most human cells, including normal cells, but is expressed or upregulated in tumors and cancer cells. For example, more than 85% of human tumors express hTERT. Thus, in some aspects, hTERT can be a universal tumor antigen. HLA-restricted peptide epitopes of hTERT are known (see e.g. U.S. Pat. No. 7,718,777, and published PCT application Nos. WO2000025813 and WO2013135553), and, in some aspects, such can be used to generate or identify antigen receptors against hTERT. Non-limiting examples of hTERT peptide epitopes include any set forth in any of SEQ ID NOS: 7-19. Antigen receptors against hTERT, such as TCR or TCR-like antibodies, have been generated and are known in the art (see e.g., U.S. Pat. No. 7,718,777 and published U.S. patent applications US20090226474 and US20030223994; see also Ugel et al. (2010) Blood, 115:1374-1384).

(133) In some embodiments, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is survivin (also called baculoviral inhibitor of apoptosis repeat-containing 5, BRCS). In some aspects, survivin has or contains a sequence of amino acids set forth in SEQ ID NO:5 (GenBank Accession No. NP_001159) and encoded by a sequence of nucleotides set forth in SEQ ID NO:6 (GenBank Accession No. NM_001168.2). In some cases, other transcript isoforms can exist, such as that have or contain an amino acid or nucleotide sequence referenced at GenBank Accession No. NP_001012270 or NM_001012270, respectively, or NP_001012271.1 or NM_001012271.1, respectively. Generally, survivin is a member of the family of inhibitors of apoptosis proteins (IAPs). In some cases, survivin is upregulated in many types of cancers, such as lung, colon, breast, pancreas, prostate, melanoma and others, but it is not generally expressed or upregulated in normal cells or tissues. In some aspects, the expression of survivin in cancer may be related to a general role of apoptosis inhibition in tumor progression. Thus, in some aspects, survivin can be a universal tumor antigen. HLA-restricted peptide epitopes of survivn are known (see e.g. U.S. Pat. No. 7,892,559 and published U.S. patent application No. US20090004214), and, in some cases, such peptide epitopes can be used to generate or identify antigen receptors against survivin, including TCRs or TCR-like CARs. Non-limiting examples of survivin peptide epitopes include any set forth in any of SEQ ID NOS: 20-30. Antigen receptors against survivin, such as TCR or TCR-like antibodies, have been generated and are known in the art (see e.g., published PCT application No. WO2010075417).

(134) In some aspects, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is expressed on multiple myeloma, such as CD38, CD138, and/or CS-1 and/or such as BCMA, BAFF-R, TACI, and/or FcRH5. Other exemplary multiple myeloma antigens include CD56, TIM-3, CD33, CD123, and/or CD44. Antibodies or antigen-binding fragments directed against such antigens are known and include, for example, those described in U.S. Pat. Nos. 8,153,765; 8,603,477, 8,008,450; U.S. published application No. US20120189622 or US20100260748A1; and/or published international PCT application Nos. WO2006099875, WO2009080829 or WO2012092612 or WO2014210064A1. In some embodiments, such antibodies or antigen-binding fragments thereof (e.g. scFv) can be used to generate a CAR.

(135) In some embodiments, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is a CD38 antigen that is a human CD38. In some aspects, the CD38 has or contains an amino acid sequence referenced at GenBank Accession No.: BAA18966, e.g., at BAA18966.1, or that is referenced at GI:1911103. In some aspects, it has or contains the following sequence: mancefspvs gdkpccrlsr raq1clgvsi lvlilvvvla vvvprwrqqw sgpgttkrfp etvlarcvky teihpemrhv dcqsvwdafk gafiskhpcn iteedyqplm klgtqtvpcn killwsrikd lahqftqvqr dmftledtll gyladdltwc gefntskiny qscpdwrkdc snnpvsvfwk tvsrrfaeaa cdvvhvmlng srskifdkns tfgsvevhnl qpekvqtlea wvihggreds rdlcqdptik elesiiskrn iqfsckniyr pdkflqcvkn pedssctsei (SEQ ID NO:1). In some aspects, the CD38 antigen can be encoded by the sequence of nucleotides set forth in SEQ ID NO:2. In some embodiments, the portion of the antigen to which the antigen-binding domain specifically binds typically is within the extracellular region of the antigen. For example, with reference to SEQ ID NO:1, the extracellular region corresponds to amino acid residues 43-300 of SEQ ID NO:1, In some embodiments, the antigen may be one that is expressed or upregulated on cancer or tumor cells, but that also may be expressed in an immune cell, such as a resting or activated T cell. For example, in some cases, expression of hTERT, survivin and other universal tumor antigens are reported to be present in lymphocytes, including activated T lymphocytes (see e.g., Weng et al. (1996) J Exp. Med., 183:2471-2479; Hathcock et al. (1998) J Immunol., 160:5702-5706; Liu et al. (1999) Proc. Natl Acad Sci., 96:5147-5152; Turksma et al. (2013) Journal of Translational Medicine, 11:152). Likewise, in some cases, CD38 and other tumor antigens also can be expressed in immune cells, such as T cells, such as upregulated in activated T cells.

(136) In some aspects, the antigen may be expressed (or upregulated) only in activated T cells and not in resting T cells or not in a certain percentage of resting cells. For example, in some aspects, the target antigen or the related antigen, such as the tumor-specific antigen, is a BCMA and/or a BCMA family member, such as TACI or BAFF-R, which in some aspects is (or a family member thereof is) or is at risk of being expressed not only in B cells or in other tumor cells but also in activated T cells. See, e.g., Wang et al., (2001) Nat Immunol, 2:7; Mariette, X, (2011) Sjgren's Syndrome; Salzer et al., (2005) Curr Opin Allergy Clin Immunol, 5:6. In some aspects of such embodiments and/or of other embodiments herein, by further providing for the disruption of a gene encoding the target antigen(s) and/or one or more antigen related thereto, the provided embodiments permit a multi-targeting strategy in which multiple receptors are targeted even if potentially expressed on the engineered cells, and/or permit the use of an engineered receptor that not only binds to the target antigen but also cross-reacts with the one or more related antigens such as the one or more related family members, which may also be expressed on the disease or condition.

(137) For example, in some aspects, CD38 is a known T cell activation marker. In some embodiments as provided herein, an immune cell, such as a T cell, can be engineered to repress or disrupt the gene encoding the antigen in the immune cell so that the expressed genetically engineered antigen receptor does not specifically bind the antigen in the context of its expression on the immune cell itself. Thus, in some aspects, this may avoid off-target effects, such as binding of the engineered immune cells to themselves, which may reduce the efficacy of the engineered in the immune cells, for example, in connection with adoptive cell therapy.

(138) In some embodiments, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is a B cell maturation antigen (BCMA; also called tumor necrosis factor receptor superfamily 17, TNFRSF17) or antigen belonging to the same family thereof or binding to the same ligand. In some aspects, the BCMA has or contains the sequence of amino acids set forth in SEQ ID NO:31 and/or is encoded by the sequence of nucleotides set forth in SEQ ID NO:32, or is a splice variant or isoform, allelic variant or other variant thereof, such as any expressed by an immune cell (e.g. T cell, such as activated T cell). In some embodiments, an antibody or antigen-binding fragment thereof (e.g. scFv) against such antigen can be used to generate a CAR. In some aspects, the antigen such as the BCMA or BCMA family member is expressed in cancers other than multiple myeloma, such as glioma. See Kimberley et al., (2008) J Cellular Physiology, 218:1; Pelekanou, et al., (2013) PloS One, 8:12.

(139) In some embodiments, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is a Transmembrane activator and CAML interactor (TACI; also called tumor necrosis factor receptor superfamily member 13B, TNFRSF13B). In some aspects, the TACI has or contains the sequence of amino acids set forth in SEQ ID NO:33 and/or is encoded by the sequence of nucleotides set forth in SEQ ID NO:34, or is a splice variant or isoform, allelic variant or other variant thereof, such as any expressed by an immune cell (e.g. T cell, such as activated T cell). In some embodiments, an antibody or antigen-binding fragment thereof (e.g. scFv) against such antigen can be used to generate a CAR.

(140) In some embodiments, the antigen, e.g., the target antigen, such as the disease-specific antigen and/or related antigen, is a B-cell-activating factor receptor (BAFF receptor, also called tumor necrosis factor receptor superfamily member 13C, TNFRSF13C). In some aspects, the BAFF receptor has or contains a sequence of amino acids set forth in SEQ ID NO:35 and/or is encoded by the sequence of nucleotides set forth in SEQ ID NO:36, or is a splice variant or isoform, allelic variant or other variant thereof, such as any expressed by an immune cell (e.g. T cell, such as activated T cell). In some embodiments, an antibody or antigen-binding fragment thereof (e.g. scFv) against such antigen can be used to generate a CAR.

(141) In some embodiments, the antigen is Fc receptor homolog 5 (FcRH5, also called FcR-like protein 5, FcRL5). In some aspects, FcRH5 has or contains a sequence of amino acids set forth in SEQ ID NO:55 and/or is encoded by the sequence of nucleotides set forth in SEQ ID NO:56, or is a splice variant or isoform, allelic variant or other variant thereof, such as any expressed by an immune cell (e.g. T cell, such as activated T cell). In some embodiments, an antibody or antigen-binding fragment thereof (e.g. scFv) against such antigen can be used to generate a CAR. In some embodiments, FcRH5 and/or a related antigen such as a homolog or family member, such as one sharing one or more domains, similarity in sequence or structure and/or epitopes therewith, such as one that is expressed or may be expressed on the cells or activated forms thereof, such as FcRH3, e.g., which may be expressed in non-disease cells such as engineered cells or activated forms thereof such as T cells or NK Cells. In some embodiments, the target antigen or related antigen and/or the antigen to be deleted is FcRH3. See Polson A G et al., Int. Immunol. 2006 Sep. 18(9): 1368-73.

(142) In some embodiments, such as in the case of an inhibitory CAR, the target is an off-target marker, such as an antigen not expressed on the diseased cell or cell to be targeted, but that is expressed on a normal or non-diseased cell which also expresses a disease-specific target being targeted by an activating or stimulatory receptor in the same engineered cell. Exemplary such antigens are MHC molecules, such as MHC class I molecules, for example, in connection with treating diseases or conditions in which such molecules become downregulated but remain expressed in non-targeted cells. In some embodiments, the engineered immune cells can contain an antigen that targets one or more other antigens. In some embodiments, the one or more other antigens is a tumor antigen or cancer marker. Other antigen targeted by antigen receptors on the provided immune cells can, in some embodiments, include orphan tyrosine kinase receptor ROR1, tEGFR, Her2, L1-CAM, CD19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gp100, oncofetal antigen, ROR1, TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, estrogen receptor, progesterone receptor, ephrinB2, CD123, CS-1, c-Met, GD-2, and MAGE A3, CE7, Wilms Tumor 1 (WT-1), a cyclin, such as cyclin A1 (CCNA1), and/or biotinylated molecules, and/or molecules expressed by HIV, HCV, HBV or other pathogens.

(143) In some embodiments, the engineered immune cells contain or are suspected of being at risk for containing and/or upregulating (such as upon activation or stimulation) an antigen that is related to any target antigen described herein such that the engineered receptor (CAR or TCR, for example) is cross-reactive with the engineered immune cells and the target antigen.

(144) In some embodiments, the receptor, e.g., the CAR binds a pathogen-specific antigen. In some embodiments, the CAR is specific for viral antigens (such as HIV, HCV, HBV, etc.), bacterial antigens, and/or parasitic antigens. In some embodiments, the receptor, e.g., the CAR, is specific for an inflammatory marker.

(145) Multi-Targeting

(146) In some embodiments, the cells and methods include multi-targeting strategies, such as in some aspects, expression of two or more genetically engineered receptors on the cell, each recognizing a different antigen and in some aspects, each including a different intracellular signaling component. The receptors may be encoded by the same or a different vector, under the same or a different promoter, and be associated with the expression of one or more of the same or different expression markers. In some aspects, the multi-targeting approaches encompass the administration of multiple cells each expressing different such engineered receptors, such as different receptors recognizing different antigens. In some aspects, the cells are in the same composition; in other aspects, they are in different compositions, which may be administered at the same time or sequentially. In some embodiments, a composition administered comprises cells expressing one of the two or more receptors and other cells expressing another one of (but not the first one of) the two or more receptors, and other cells expressing both receptors.

(147) Certain multi-targeting strategies for use with embodiments provided herein are described, for example, in International Patent Application, Publication No.: WO 2014055668 A1 (describing combinations of activating and costimulatory CARs, e.g., targeting two different antigens present individually on off-target, e.g., normal cells, but present together only on cells of the disease or condition to be treated) and Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013) (describing cells expressing an activating and an inhibitory CAR, such as those in which the activating CAR binds to one antigen expressed on both normal or non-diseased cells and cells of the disease or condition to be treated, and the inhibitory CAR binds to another antigen expressed only on the normal cells or cells which it is not desired to treat).

(148) In some embodiments, the multi-targeting strategy is employed in a case where an antigen associated with a particular disease or condition is expressed on a non-diseased cell and/or is expressed on the engineered cell itself, either transiently (e.g., upon stimulation in association with genetic engineering) or permanently. In such cases, by requiring ligation of two separate and individually specific antigen receptors, specificity, selectivity, and/or efficacy may be improved.

(149) For example, in some embodiments, the cells include a receptor expressing a first genetically engineered antigen receptor (e.g., CAR or TCR) which is capable of inducing an activating signal to the cell, generally upon specific binding to the antigen recognized by the first receptor, e.g., the first antigen. In some embodiments, the cell further includes a second genetically engineered antigen receptor (e.g., CAR or TCR), e.g., a chimeric costimulatory receptor, which is capable of inducing a costimulatory signal to the immune cell, generally upon specific binding to a second antigen recognized by the second receptor. In some aspects, the first receptor includes an intracellular signaling component containing ITAM or ITAM-like motifs. In some aspects, the second receptor includes intracellular signaling domains of costimulatory receptors such as CD28, CD137 (4-1 BB), OX40, and/or ICOS.

(150) In some embodiments, the activation induced by the first receptor involves a signal transduction or change in protein expression in the cell resulting in initiation of an immune response, such as ITAM phosphorylation and/or initiation of ITAM-mediated signal transduction cascade, formation of an immunological synapse and/or clustering of molecules near the bound receptor (e.g. CD4 or CD8, etc.), activation of one or more transcription factors, such as NF-B and/or AP-1, and/or induction of gene expression of factors such as cytokines, proliferation, and/or survival.

(151) In some embodiments, the costimulatory signal induced by the second receptor, in combination with the signal induced by the first receptor, is one that results in an immune response, such as a robust and sustained immune response, such as increased gene expression, secretion of cytokines and other factors, and T cell mediated effector functions such as cell killing.

(152) In some embodiments, neither ligation of the first receptor alone nor ligation of the second receptor alone induces a robust immune response. In some aspects, if only one receptor is ligated, the cell becomes tolerized or unresponsive to antigen, or inhibited, and/or is not induced to proliferate or secrete factors or carry out effector functions. In some such embodiments, however, when the plurality of receptors are ligated, such as upon encounter of a cell expressing the first and second antigens, a desired response is achieved, such as full immune activation or stimulation, e.g., as indicated by secretion of one or more cytokine, proliferation, persistence, and/or carrying out an immune effector function such as cytotoxic killing of a target cell.

(153) In some embodiments, the plurality of antigens, e.g., the first and second antigens, are expressed on the cell, tissue, or disease or condition being targeted, such as on the cancer cell. In some aspects, the cell, tissue, disease or condition is multiple myeloma or a multiple myeloma cell. One or more of the plurality of antigens generally also is expressed on a cell which it is not desired to target with the cell therapy, such as a normal or non-diseased cell or tissue, and/or the engineered cells themselves. In such embodiments, by requiring ligation of multiple receptors to achieve a response of the cell, specificity and/or efficacy is achieved.

(154) In some embodiments, among the combinations of antigens for multi-targeting strategies includes those in which at least one of the antigens is a universal tumor antigen, or a family member thereof, such as hTERT, survivin, MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53, cyclin (D1), each individually in combination with a second antigen that also targets an antigen expressed on a tumor. In some embodiments, the universal tumor antigen and the second antigen target an antigen on the same tumor type. In some embodiments, the second antigen may also be another different universal tumor antigen or may be a tumor antigen specific to the tumor type. In some embodiments, the second antigen may be a tumor antigen, such as ROR1, tEGFR, Her2, L1-CAM, CD19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gp100, oncofetal antigen, ROR1, TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, estrogen receptor, progesterone receptor, ephrinB2, CD123, CS-1, c-Met, GD-2, and MAGE A3, CE7, Wilms Tumor 1 (WT-1), a cyclin, such as cyclin A1 (CCNA1), and/or biotinylated molecules, and/or molecules expressed by HIV, HCV, HBV or other pathogens, and in some aspects, neoepitopes or neoantigens thereof.

(155) In some embodiments, among the combinations of antigens for multi-targeting strategies include those expressed on multiple myeloma, such as CD38 (cyclic ADP ribose hydrolase), CD138 (syndecan-1, syndecan, SYN-1), and CS-1 (CS1, CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24), each individually in combination with a second antigen that is also expressed in multiple myeloma. In some embodiments, the plurality of antigens, such as those recognized by activating and costimulatory engineered receptors, respectively (or those targeted by other multi-targeting approaches such as those using two different receptors each having a costimulatory and primary or activating signaling ability, on the same or different cells), are CD38 and CD138, CD38 and CS-1, CD138 and CD38, CD138 and CS-1, CS-1 and CD38, and/or CS-1 and CD138. In some embodiments, the plurality of antigens, such as those recognized by activating and costimulatory engineered receptors, respectively, are BCMA and TACI, BCMA and BAFFR, BCMA and FcRH5, BCMA and CS-1, BCMA and CD38, BCMA and CD138, and/or any combination thereof. Additional multiple-myeloma-specific antigens include CD20, CD40, CD56, CD74, CD200, EGFR, and 2-Microglobulin, HM1.24, IGF-1R, IL-6R, TRAIL-R1, and the activin receptor type IIA (ActRIIA). See Benson and Byrd, Journal of Clinical Oncology, Jun. 1, 2012, 30(16): 2013-15; Tao and Anderson, Bone Marrow Research, Volume 2011 (2011), Article ID 924058, 14 pages; Chu et al., Leukemia (26 September 2013) 2014 April; 28(4):917-27; Garfall et al., Discov Med. 2014 January; 17(91):37-46. In some embodiments, the antigens include those present on lymphoid tumors, myeloma, AIDS-associated lymphoma, and/or post-transplant lymphoproliferations, such as CD38.

(156) In some embodiments, one or more of the multiple antigen receptors recognizes or binds to its antigen with relatively low affinity. In some aspects, the receptor binds to its antigen with a dissociation constant (K.sub.D) of at least at or about 10.sup.8M, at least at or about 10.sup.7 M, at least at or about 10.sup.6M, at least at or about 10.sup.5 M, and/or at least at or about 10.sup.4 M. In some such embodiments, a relatively lower affinity of the antigen receptor for the antigen helps ensure that a full response is not achieved by ligation of only one of the multiple genetically engineered antigen receptor. In some embodiments, the CD38-targeting receptor includes an antigen binding domain as disclosed, for example, in U.S. Patent Application, Publication No.: US20120189622 A1, such as antigen binding portion(s) of the antibody designated as OKT10 and of other antibodies described in Table 1 of the application, and of antibodies binding to similar or the same epitopes.

(157) In some embodiments, the two receptors induce, respectively, an activating and an inhibitory signal to the cell, such that binding by one of the receptor to its antigen activates the cell or induces a response, but binding by the second inhibitory receptor to its antigen induces a signal that suppresses or dampens that response. Examples are combinations of activating CARs and inhibitory CARs or iCARs. Such a strategy may be used, for example, in which the activating CAR binds an antigen expressed in a disease or condition but which is also expressed on normal cells, and the inhibitory receptor binds to a separate antigen which is expressed on the normal cells but not cells of the disease or condition.

(158) Vectors and Methods for Genetic Engineering

(159) Also provided are methods, nucleic acids, compositions, and kits, for producing the genetically engineered cells. In some aspects, the genetic engineering involves introduction of a nucleic acid encoding the genetically engineered component or other component for introduction into the cell, such as a component encoding a gene-disruption protein or nucleic acid.

(160) In some embodiments, gene transfer is accomplished by first stimulating cell growth, e.g., T cell growth, proliferation, and/or activation, followed by transduction of the activated cells, and expansion in culture to numbers sufficient for clinical applications.

(161) In some contexts, overexpression of a stimulatory factor (for example, a lymphokine or a cytokine) may be toxic to a subject. Thus, in some contexts, the engineered cells include gene segments that cause the cells to be susceptible to negative selection in vivo, such as upon administration in adoptive immunotherapy. For example in some aspects, the cells are engineered so that they can be eliminated as a result of a change in the in vivo condition of the patient to which they are administered. The negative selectable phenotype may result from the insertion of a gene that confers sensitivity to an administered agent, for example, a compound. Negative selectable genes include the Herpes simplex virus type I thymidine kinase (HSV-I TK) gene (Wigler et al., Cell II:223, 1977) which confers ganciclovir sensitivity; the cellular hypoxanthine phosphribosyltransferase (HPRT)gene, the cellular adenine phosphoribosyltransferase (APRT) gene, bacterial cytosine deaminase, (Mullen et al., Proc. Natl. Acad. Sci. USA. 89:33 (1992)).

(162) In some aspects, the cells further are engineered to promote expression of cytokines or other factors. Various methods for the introduction of genetically engineered components, e.g., antigen receptors, e.g., CARs, are well known and may be used with the provided methods and compositions. Exemplary methods include those for transfer of nucleic acids encoding the receptors, including via viral, e.g., retroviral or lentiviral, transduction, transposons, and electroporation.

(163) In some embodiments, recombinant nucleic acids are transferred into cells using recombinant infectious virus particles, such as, e.g., vectors derived from simian virus 40 (SV40), adenoviruses, adeno-associated virus (AAV). In some embodiments, recombinant nucleic acids are transferred into T cells using recombinant lentiviral vectors or retroviral vectors, such as gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene Therapy 2014 April 3. doi: 10.1038/gt.2014.25; Carlens et al. (2000) Exp Hematol 28(10): 1137-46; Alonso-Camino et al. (2013) Mol Ther Nucl Acids 2, e93; Park et al., Trends Biotechnol. 2011 November; 29(11): 550-557.

(164) In some embodiments, the retroviral vector has a long terminal repeat sequence (LTR), e.g., a retroviral vector derived from the Moloney murine leukemia virus (MoMLV), myeloproliferative sarcoma virus (MPSV), murine embryonic stem cell virus (MESV), murine stem cell virus (MSCV), spleen focus forming virus (SFFV), or adeno-associated virus (AAV). Most retroviral vectors are derived from murine retroviruses. In some embodiments, the retroviruses include those derived from any avian or mammalian cell source. The retroviruses typically are amphotropic, meaning that they are capable of infecting host cells of several species, including humans. In one embodiment, the gene to be expressed replaces the retroviral gag, pol and/or env sequences. A number of illustrative retroviral systems have been described (e.g., U.S. Pat. Nos. 5,219,740; 6,207,453; 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3:102-109.

(165) Methods of lentiviral transduction are known. Exemplary methods are described in, e.g., Wang et al. (2012) J. Immunother. 35(9): 689-701; Cooper et al. (2003) Blood. 101:1637-1644; Verhoeyen et al. (2009) Methods Mol Biol. 506: 97-114; and Cavalieri et al. (2003) Blood. 102(2): 497-505.

(166) In some embodiments, recombinant nucleic acids are transferred into T cells via electroporation (see, e.g., Chicaybam et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16): 1431-1437). In some embodiments, recombinant nucleic acids are transferred into T cells via transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506: 115-126). Other methods of introducing and expressing genetic material in immune cells include calcium phosphate transfection (e.g., as described in Current Protocols in Molecular Biology, John Wiley & Sons, New York. N.Y.), protoplast fusion, cationic liposome-mediated transfection; tungsten particle-facilitated microparticle bombardment (Johnston, Nature, 346: 776-777 (1990)); and strontium phosphate DNA co-precipitation (Brash et al., Mol. Cell Biol., 7: 2031-2034 (1987)).

(167) In other embodiments, the cells, e.g., T cells, are not engineered to express recombinant receptors, but rather include naturally occurring antigen receptors specific for desired antigens, such as tumor-infiltrating lymphocytes and/or T cells cultured in vitro or ex vivo, e.g., during the incubation step(s), to promote expansion of cells having particular antigen specificity. For example, in some embodiments, the cells are produced for adoptive cell therapy by isolation of tumor-specific T cells, e.g. autologous tumor infiltrating lymphocytes (TIL). The direct targeting of human tumors using autologous tumor infiltrating lymphocytes can in some cases mediate tumor regression (see Rosenberg S A, et al.(1988) N Engl J Med. 319:1676-1680). In some embodiments, lymphocytes are extracted from resected tumors. In some embodiments, such lymphocytes are expanded in vitro. In some embodiments, such lymphocytes are cultured with lymphokines (e.g., IL-2). In some embodiments, such lymphocytes mediate specific lysis of autologous tumor cells but not allogeneic tumor or autologous normal cells.

(168) Other approaches and vectors for transfer of the genetically engineered nucleic acids encoding the genetically engineered products are those described, e.g., in international patent application, Publication No.: WO2014055668, and U.S. Pat. No. 7,446,190.

(169) Among additional nucleic acids, e.g., genes for introduction are those to improve the efficacy of therapy, such as by promoting viability and/or function of transferred cells; genes to provide a genetic marker for selection and/or evaluation of the cells, such as to assess in vivo survival or localization; genes to improve safety, for example, by making the cell susceptible to negative selection in vivo as described by Lupton S. D. et al., Mol. and Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy 3:319-338 (1992); see also the publications of PCT/US91/08442 and PCT/US94/05601 by Lupton et al. describing the use of bifunctional selectable fusion genes derived from fusing a dominant positive selectable marker with a negative selectable marker. See, e.g., Riddell et al., U.S. Pat. No. 6,040,177, at columns 14-17.

(170) C. Repression of Gene Expression, Activity, or Function

(171) Among the provided immune cells are immune cells in which the expression, activity, and/or function of one or more genes encoding an antigen of a genetically engineered antigen receptor is repressed in the cell. In some cases, a particular antigen of interest may be one that is expressed in a disease or condition, such as a tumor or cancer, but that may also be expressed by the immune cell, such as a T cell or activated T cell. In some aspects, expression of the antigen by the immune cell may be undesirable, such as in the context of engineering the immune cell with a genetically engineered antigen receptor for the antigen, for example, in the context of adoptive immunotherapy. Thus, in some embodiments, provided are immune cells, such as T cells, that contains a genetically engineered antigen receptor specific for a target antigen in a disease or condition, for example a tumor or cancer, and that also contains a disruption or repression of an endogenous gene in the cell encoding the antigen.

(172) Also provided are methods for effecting such gene repression. In some embodiments, the gene repression is carried out by effecting a disruption in the gene, such as a knock-out, insertion, mis sense or frameshift mutation, such as a biallelic frameshift mutation, deletion of all or part of the gene, e.g., one or more exon or portion thereof, and/or knock-in. Such disruptions in some embodiments are effected by sequence-specific or targeted nucleases, including DNA-binding targeted nucleases such as zinc finger nucleases (ZFN) and transcription activator-like effector nucleases (TALENs), and RNA-guided nucleases such as a CRISPR-associated nuclease (Cas), specifically designed to be targeted to the sequence of a gene or a portion thereof.

(173) In some embodiments, the methods of repressing or disrupting a gene in the cell can be performed prior, simultaneous or subsequent to the methods of introducing a nucleic acid molecule encoding a genetically engineered antigen receptor into the cells. For example, in some cases, the methods of repressing or disrupting a gene in the cell is performed prior to introducing a nucleic acid molecule encoding a genetically engineered antigen receptor into the cell.

(174) Repressed/Disrupted Genes

(175) In some embodiments, the gene repressed and/or disrupted encodes a product capable of having or contributing to an inhibitory effect on the engineered cell, such as inhibiting an immune response by the cell. For example, in some cases, the gene repressed and/or disrupted encodes an antigen recognized by a genetically engineered antigen receptor that is or is planned to be expressed on the immune cells, such as T cells.

(176) In some embodiments, the gene encodes a target antigen specifically bound by an antigen receptor on the engineered cell, such as a genetically engineered antigen receptor, e.g., CAR. Thus, in some aspects, the gene being repressed encodes the target antigen of a CAR or other antigen receptor. Such aspects typically arise in the case of a target antigen expressed in a particular disease or condition but that is expressed on the cell type being engineered, or a subset thereof, such as upon activation of the engineered cell. Exemplary antigens are those expressed on activated or stimulated T cells or NK cells, and subsets thereof, particularly activated cells produced by stimulatory conditions used to promote the introduction of the nucleic acid encoding the CAR or other engineered receptor. In some embodiments, by disrupting or otherwise repressing expression of the antigen on the engineered cells, the methods and compositions provided here avoid or reduce the likelihood of killing of the engineered cells by the engineered cells themselves, thereby promoting efficacy.

(177) In some embodiments, the gene encodes an antigen that is an activating and/or costimulatory CAR target. In some embodiments, the gene encodes an antigen that is a target in a multi-targeting strategy employing two or more genetically engineered antigen receptors, where at least one of the receptors is specific for an antigen that may be or is expressed on the immune cell, such as T cell or activated T cell.

(178) In some embodiments, the gene disrupted or the expression or function of which is otherwise repressed is any that encodes a universal tumor antigen, or a family member thereof, and particularly a universal tumor antigen, or a family member thereof, that is expressed or upregulated on the immune cell, such as on a T cell or an activated T cells. In some embodiments, the gene that is disrupted or repressed is one that encodes hTERT or survivin. In some cases, other exemplary genes that can be disrupted or repressed include those encoding the antigens MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53, cyclin (D1), BCMA, BAFFR, or TACI. In some embodiments, a targeted nuclease is targeted to a gene encoding hTERT, survivin, p53 or other universal tumor antigen, or a family member thereof. In some aspects, the targeting disrupts the gene, e.g., decreases or abolishes the expression of hTERT, survivin, p53 or other targeted universal tumor antigen, or a family member thereof, in the cell.

(179) For example, in some embodiments, provided are immune cells, such as T cells, that contain a genetically engineered antigen receptor that specifically binds an antigen from among hTERT, survivin MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53, cyclin (D1), BCMA, BAFFR, or TACI and that contains disruption or expression of the corresponding endogenous gene in the immune cells. In some aspects, provided are immune cells, such as T cells, that contain a genetically engineered antigen receptor that specifically binds to an hTERT antigen and that contains disruption or repression of the corresponding endogenous hTERT gene in the cell. In other aspects, provided are immune cells, such as T cells, that contain a genetically engineered antigen receptor that specifically binds to a survivin gene and that contains disruption or repression of the corresponding endogenous survivin gene in the cell.

(180) In particular embodiments, the gene disrupted or the expression or function of which is otherwise repressed encodes CD38, such as in a cell expressing an anti-CD38 engineered receptor, such as an anti-CD38 CAR. Other exemplary genes include those encoding antigens CD33 and TIM-3. See Mardiros et al., Blood 122 (18) (Oct. 31, 2013). Other exemplary genes include those encoding the antigens CD26, CD30, CD53, CD92, CD100, CD148, CD150, CD200, CD261, CD262, and CD362. In some embodiments, a targeted nuclease is targeted to a CD38 gene on the engineered cell. In some aspects, the targeting disrupts the CD38 gene, e.g., decreases or abolishes the expression of CD38 on the engineered cell. In some aspects, provided are immune cells, such as T cells, that contain a genetically engineered antigen receptor that specifically binds to CD38 antigen and that contains disruption or repression of the corresponding endogenous CD38 gene in the cell.

(181) In some embodiments, the gene is an inhibitory CAR target. For example, in the context of an antigen that binds to an inhibitory CAR, gene disruption in some contexts prevents or reduces the likelihood of a molecule that is expressed by the engineered cells themselves inducing a dampening effect on a response of the engineered cells. Exemplary of such antigens are those expressed on normal or non-targeted or off-target cells (such that an inhibitory CAR molecule is included to prevent off-target effects), but is also expressed on the cell type used for genetic engineering, such as the T cell or NK cell. Exemplary antigens are MHC molecules, such as MHC-class I molecules, which can in some cases be downregulated in the context of immune evasion, cancer, or infection, but are generally expressed on nucleated cells. Other examples are any inhibitory CAR target that is also expressed on a T cell, NK cell, or other cell engineered for cell therapy.

(182) In some embodiments, the gene encodes an immunoinhibitory molecule or other product that dampens or prevents activation or stimulation or other effector function of the engineered cell, such as its ability to proliferate, survive, secrete one or more factors, or recruit or carry out cell killing, for example, in response to binding via the engineered antigen receptor.

(183) In some embodiments, the gene repressed encodes a protein that suppresses the immune system. In some embodiments, the repression reduces the suppressive effects of the gene product on the immune system. In some aspects, this increases the immune response to tumor cells. In some embodiments, the gene encodes an adenosine receptor, such as A2AR. Thus, in some embodiments, the expression, activity, and/or function of A2AR is repressed.

(184) Techniques for Gene Repression

(185) In some embodiments, the repression of the expression, activity, and/or function of the gene is carried out by disrupting the gene. In some aspects, the gene is disrupted so that its expression is reduced by at least at or about 20, 30, or 40%, generally at least at or about 50, 60, 70, 80, 90, or 95% as compared to the expression in the absence of the gene disruption or in the absence of the components introduced to effect the disruption.

(186) In some embodiments, gene disruption is carried out by induction of one or more double-stranded breaks and/or one or more single-stranded breaks in the gene, typically in a targeted manner. In some embodiments, the double-stranded or single-stranded breaks are made by a nuclease, e.g. an endonuclease, such as a gene-targeted nuclease. In some aspects, the breaks are induced in the coding region of the gene, e.g. in an exon. For example, in some embodiments, the induction occurs near the N-terminal portion of the coding region, e.g. in the first exon, in the second exon, or in a subsequent exon.

(187) In some aspects, the double-stranded or single-stranded breaks undergo repair via a cellular repair process, such as by non-homologous end-joining (NHEJ) or homology-directed repair (HDR). In some aspects, the repair process is error-prone and results in disruption of the gene, such as a frameshift mutation, e.g., biallelic frameshift mutation, which can result in complete knockout of the gene. For example, in some aspects, the disruption comprises inducing a deletion, mutation, and/or insertion. In some embodiments, the disruption results in the presence of an early stop codon. In some aspects, the presence of an insertion, deletion, translocation, frameshift mutation, and/or a premature stop codon results in repression of the expression, activity, and/or function of the gene.

(188) In some embodiments, the repression is transient or reversible, such that expression of the gene is restored at a later time. In other embodiments, the repression is not reversible or transient, e.g., is permanent.

(189) In some embodiments, gene repression is achieved using antisense techniques, such as by RNA interference (RNAi), short interfering RNA (siRNA), short hairpin (shRNA), and/or ribozymes are used to selectively suppress or repress expression of the gene. siRNA technology includes that based on RNAi utilizing a double-stranded RNA molecule having a sequence homologous with the nucleotide sequence of mRNA which is transcribed from the gene, and a sequence complementary with the nucleotide sequence. siRNA generally is homologous/complementary with one region of mRNA which is transcribed from the gene, or may be siRNA including a plurality of RNA molecules which are homologous/complementary with different regions.

(190) DNA-Targeting Molecules and Complexes; Targeted Endonucleases

(191) In some embodiments, the repression is achieved using a DNA-targeting molecule, such as a DNA-binding protein or DNA-binding nucleic acid, or complex, compound, or composition, containing the same, which specifically binds to or hybridizes to the gene. In some embodiments, the DNA-targeting molecule comprises a DNA-binding domain, e.g., a zinc finger protein (ZFP) DNA-binding domain, a transcription activator-like protein (TAL) or TAL effector (TALE) DNA-binding domain, a clustered regularly interspaced short palindromic repeats (CRISPR) DNA-binding domain, or a DNA-binding domain from a meganuclease.

(192) Zinc finger, TALE, and CRISPR system binding domains can be engineered to bind to a predetermined nucleotide sequence, for example via engineering (altering one or more amino acids) of the recognition helix region of a naturally occurring zinc finger or TALE protein. Engineered DNA binding proteins (zinc fingers or TALEs) are proteins that are non-naturally occurring. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP and/or TALE designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; and 6,534,261; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496 and U.S. Publication No. 20110301073.

(193) In some embodiments, the DNA-targeting molecule, complex, or combination contains a DNA-binding molecule and one or more additional domain, such as an effector domain to facilitate the repression or disruption of the gene. For example, in some embodiments, the gene disruption is carried out by fusion proteins that comprise DNA-binding proteins and a heterologous regulatory domain or functional fragment thereof. In some aspects, domains include, e.g., transcription factor domains such as activators, repressors, co-activators, co-repressors, silencers, oncogenes, DNA repair enzymes and their associated factors and modifiers, DNA rearrangement enzymes and their associated factors and modifiers, chromatin associated proteins and their modifiers, e.g. kinases, acetylases and deacetylases, and DNA modifying enzymes, e.g. methyltransferases, topoisomerases, helicases, ligases, kinases, phosphatases, polymerases, endonucleases, and their associated factors and modifiers. See, for example, U.S. Patent Application Publication Nos. 20050064474; 20060188987 and 2007/0218528, incorporated by reference in their entireties herein, for details regarding fusions of DNA-binding domains and nuclease cleavage domains. In some aspects, the additional domain is a nuclease domain. Thus, in some embodiments, gene disruption is facilitated by gene or genome editing, using engineered proteins, such as nucleases and nuclease-containing complexes or fusion proteins, composed of sequence-specific DNA-binding domains fused to or complexed with non-specific DNA-cleavage molecules such as nucleases.

(194) In some aspects, these targeted chimeric nucleases or nuclease-containing complexes carry out precise genetic modifications by inducing targeted double-stranded breaks or single-stranded breaks, stimulating the cellular DNA-repair mechanisms, including error-prone non-homologous end joining (NHEJ) and homology-directed repair (HDR). In some embodiments the nuclease is an endonuclease, such as a zinc finger nuclease (ZFN), TALE nuclease (TALEN), an RNA-guided endonuclease (RGEN), such as a CRISPR-associated (Cas) protein, or a meganuclease.

(195) In some embodiments, a donor nucleic acid, e.g., a donor plasmid or nucleic acid encoding the genetically engineered antigen receptor, is provided and is inserted by HDR at the site of gene editing following the introduction of the DSBs. Thus, in some embodiments, the disruption of the gene and the introduction of the antigen receptor, e.g., CAR, are carried out simultaneously, whereby the gene is disrupted in part by knock-in or insertion of the CAR-encoding nucleic acid.

(196) In some embodiments, no donor nucleic acid is provided. In some aspects, NHEJ-mediated repair following introduction of DSBs results in insertion or deletion mutations that can cause gene disruption, e.g., by creating missense mutations or frameshifts.

(197) ZFPs and ZFNs; TALs, TALEs, and TALENs

(198) In some embodiments, the DNA-targeting molecule includes a DNA-binding protein such as one or more zinc finger protein (ZFP) or transcription activator-like protein (TAL), fused to an effector protein such as an endonuclease. Examples include ZFNs, TALEs, and TALENs. See Lloyd et al., Fronteirs in Immunology, 4(221), 1-7 (2013).

(199) In some embodiments, the DNA-targeting molecule comprises one or more zinc-finger proteins (ZFPs) or domains thereof that bind to DNA in a sequence-specific manner. A ZFP or domain thereof is a protein or domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. The term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP.

(200) Among the ZFPs are artificial ZFP domains targeting specific DNA sequences, typically 9-18 nucleotides long, generated by assembly of individual fingers.

(201) ZFPs include those in which a single finger domain is approximately 30 amino acids in length and contains an alpha helix containing two invariant histidine residues coordinated through zinc with two cysteines of a single beta turn, and having two, three, four, five, or six fingers. Generally, sequence-specificity of a ZFP may be altered by making amino acid substitutions at the four helix positions (1, 2, 3 and 6) on a zinc finger recognition helix. Thus, in some embodiments, the ZFP or ZFP-containing molecule is non-naturally occurring, e.g., is engineered to bind to a target site of choice. See, for example, Beerli et al. (2002) Nature Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nature Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; U.S. Pat. Nos. 6,453,242; 6,534,261; 6,599,692; 6,503,717; 6,689,558; 7,030,215; 6,794,136; 7,067,317; 7,262,054; 7,070,934; 7,361,635; 7,253,273; and U.S. Patent Publication Nos. 2005/0064474; 2007/0218528; 2005/0267061, all incorporated herein by reference in their entireties.

(202) In some aspects, repression of the gene is carried out by contacting a first target site in the gene with a first ZFP, thereby repressing the gene. In some embodiments, the target site in the gene is contacted with a fusion ZFP comprising six fingers and the regulatory domain, thereby inhibiting expression of the gene.

(203) In some embodiments, the step of contacting further comprises contacting a second target site in the gene with a second ZFP. In some aspects, the first and second target sites are adjacent. In some embodiments, the first and second ZFPs are covalently linked. In some aspects, the first ZFP is a fusion protein comprising a regulatory domain or at least two regulatory domains. In some embodiments, the first and second ZFPs are fusion proteins, each comprising a regulatory domain or each comprising at least two regulatory domains. In some embodiments, the regulatory domain is a transcriptional repressor, a transcriptional activator, an endonuclease, a methyl transferase, a histone acetyltransferase, or a histone deacetylase.

(204) In some embodiments, the ZFP is encoded by a ZFP nucleic acid operably linked to a promoter. In some aspects, the method further comprises the step of first administering the nucleic acid to the cell in a lipid:nucleic acid complex or as naked nucleic acid. In some embodiments, the ZFP is encoded by an expression vector comprising a ZFP nucleic acid operably linked to a promoter. In some embodiments, the ZFP is encoded by a nucleic acid operably linked to an inducible promoter. In some aspects, the ZFP is encoded by a nucleic acid operably linked to a weak promoter.

(205) In some embodiments, the target site is upstream of a transcription initiation site of the gene. In some aspects, the target site is adjacent to a transcription initiation site of the gene. In some aspects, the target site is adjacent to an RNA polymerase pause site downstream of a transcription initiation site of the gene.

(206) In some embodiments, the DNA-targeting molecule is or comprises a zinc-finger DNA binding domain fused to a DNA cleavage domain to form a zinc-finger nuclease (ZFN). In some embodiments, fusion proteins comprise the cleavage domain (or cleavage half-domain) from at least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered. In some embodiments, the cleavage domain is from the Type IIS restriction endonuclease Fok I. Fok I generally catalyzes double-stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al. (1992) Proc. Natl. Acad. Sci. USA 89:4275-4279; Li et al. (1993) Proc. Natl. Acad. Sci. USA 90:2764-2768; Kim et al. (1994a) Proc. Natl. Acad. Sci. USA 91:883-887; Kim et al. (1994b) J. Biol. Chem. 269:31,978-31,982.]

(207) In some embodiments, ZFNs target a gene present in the engineered cell. In some aspects, the ZFNs efficiently generate a double strand break (DSB), for example at a predetermined site in the coding region of the gene. Typical regions targeted include exons, regions encoding N-terminal regions, first exon, second exon, and promoter or enhancer regions. In some embodiments, transient expression of the ZFNs promotes highly efficient and permanent disruption of the target gene in the engineered cells. In particular, in some embodiments, delivery of the ZFNs results in the permanent disruption of the gene with efficiencies surpassing 50%.

(208) Many gene-specific engineered zinc fingers are available commercially. For example, Sangamo Biosciences (Richmond, Calif., USA) has developed a platform (CompoZr) for zinc-finger construction in partnership with Sigma-Aldrich (St. Louis, Mo., USA), allowing investigators to bypass zinc-finger construction and validation altogether, and provides specifically targeted zinc fingers for thousands of proteins. Gaj et al., Trends in Biotechnology, 2013, 31(7), 397-405. In some embodiments, commercially available zinc fingers are used or are custom designed. (See, for example, Sigma-Aldrich catalog numbers CSTZFND, CSTZFN, CTI1-1KT, and PZD0020).

(209) TALEs and TALENs

(210) In some embodiments, the DNA-targeting molecule comprises a naturally occurring or engineered (non-naturally occurring) transcription activator-like protein (TAL) DNA binding domain, such as in a transcription activator-like protein effector (TALE) protein, See, e.g., U.S. Patent Publication No. 20110301073, incorporated by reference in its entirety herein.

(211) A TALE DNA binding domain or TALE is a polypeptide comprising one or more TALE repeat domains/units. The repeat domains are involved in binding of the TALE to its cognate target DNA sequence. A single repeat unit (also referred to as a repeat) is typically 33-35 amino acids in length and exhibits at least some sequence homology with other TALE repeat sequences within a naturally occurring TALE protein. Each TALE repeat unit includes 1 or 2 DNA-binding residues making up the Repeat Variable Diresidue (RVD), typically at positions 12 and/or 13 of the repeat. The natural (canonical) code for DNA recognition of these TALEs has been determined such that an HD sequence at positions 12 and 13 leads to a binding to cytosine (C), NG binds to T, NI to A, NN binds to G or A, and NG binds to T and non-canonical (atypical) RVDs are also known. See, U.S. Patent Publication No. 20110301073. In some embodiments, TALEs may be targeted to any gene by design of TAL arrays with specificity to the target DNA sequence. The target sequence generally begins with a thymidine.

(212) In some embodiments, the molecule is a DNA binding endonuclease, such as a TALE-nuclease (TALEN). In some aspects the TALEN is a fusion protein comprising a DNA-binding domain derived from a TALE and a nuclease catalytic domain to cleave a nucleic acid target sequence. In some embodiments, the TALE DNA-binding domain has been engineered to bind a target sequence within genes that encode the target antigen and/or the immunosuppressive molecule. For example, in some aspects, the TALE DNA-binding domain may target CD38 and/or an adenosine receptor, such as A2AR.

(213) In some embodiments, the TALEN recognizes and cleaves the target sequence in the gene. In some aspects, cleavage of the DNA results in double-stranded breaks. In some aspects the breaks stimulate the rate of homologous recombination or non-homologous end joining (NHEJ). Generally, NHEJ is an imperfect repair process that often results in changes to the DNA sequence at the site of the cleavage. In some aspects, repair mechanisms involve rejoining of what remains of the two DNA ends through direct re-ligation (Critchlow and Jackson, Trends Biochem Sci. 1998 October; 23(10):394-8) or via the so-called microhomology-mediated end joining. In some embodiments, repair via NHEJ results in small insertions or deletions and can be used to disrupt and thereby repress the gene. In some embodiments, the modification may be a substitution, deletion, or addition of at least one nucleotide. In some aspects, cells in which a cleavage-induced mutagenesis event, i.e. a mutagenesis event consecutive to an NHEJ event, has occurred can be identified and/or selected by well-known methods in the art.

(214) In some embodiments, TALE repeats are assembled to specifically target a gene. (Gaj et al., Trends in Biotechnology, 2013, 31(7), 397-405). A library of TALENs targeting 18,740 human protein-coding genes has been constructed (Kim et al., Nature Biotechnology. 31, 251-258 (2013)). Custom-designed TALE arrays are commercially available through Cellectis Bioresearch (Paris, France), Transposagen Biopharmaceuticals (Lexington, Ky., USA), and Life Technologies (Grand Island, N.Y., USA). Specifically, TALENs that target CD38 are commercially available (See Gencopoeia, catalog numbers HTN222870-1, HTN222870-2, and HTN222870-3, available on the World Wide Web at www.genecopoeia.com/product/search/detail.php?prt=26&cid=&key=HTN222870). Exemplary molecules are described, e.g., in U.S. Patent Publication Nos. US 2014/0120622, and 2013/0315884.

(215) In some embodiments the TALENs are introduced as transgenes encoded by one or more plasmid vectors. In some aspects, the plasmid vector can contain a selection marker which provides for identification and/or selection of cells which received said vector.

(216) RGENs (CRISPR/Cas Systems)

(217) In some embodiments, the repression is carried out using one or more DNA-binding nucleic acids, such as disruption via an RNA-guided endonuclease (RGEN), or other form of repression by another RNA-guided effector molecule. For example, in some embodiments, the repression is carried out using clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated (Cas) proteins. See Sander and Joung, Nature Biotechnology, 32(4): 347-355.

(218) In general, CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (Cas) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a direct repeat and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a spacer in the context of an endogenous CRISPR system), and/or other sequences and transcripts from a CRISPR locus.

(219) In some embodiments, the CRISPR/Cas nuclease or CRISPR/Cas nuclease system includes a non-coding RNA molecule (guide) RNA, which sequence-specifically binds to DNA, and a Cas protein (e.g., Cas9), with nuclease functionality (e.g., two nuclease domains).

(220) In some embodiments, one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes or Staphylococcus aureus.

(221) In some embodiments, a Cas nuclease and gRNA (including a fusion of crRNA specific for the target sequence and fixed tracrRNA) are introduced into the cell. In general, target sites at the 5 end of the gRNA target the Cas nuclease to the target site, e.g., the gene, using complementary base pairing. In some embodiments, the target site is selected based on its location immediately 5 of a protospacer adjacent motif (PAM) sequence, such as typically NGG, or NAG. In this respect, the gRNA is targeted to the desired sequence by modifying the first 20 nucleotides of the guide RNA to correspond to the target DNA sequence.

(222) In some embodiments, the CRISPR system induces DSBs at the target site, followed by disruptions as discussed herein. In other embodiments, Cas9 variants, deemed nickases are used to nick a single strand at the target site. In some aspects, paired nickases are used, e.g., to improve specificity, each directed by a pair of different gRNAs targeting sequences such that upon introduction of the nicks simultaneously, a 5 overhang is introduced. In other embodiments, catalytically inactive Cas9 is fused to a heterologous effector domain such as a transcriptional repressor or activator, to affect gene expression.

(223) In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence. Typically, the In the context of formation of a CRISPR complex, target sequence generally refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between the target sequence and a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex.

(224) The target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. In some embodiments, the target sequence is located in the nucleus or cytoplasm of the cell. In some embodiments, the target sequence may be within an organelle of the cell. Generally, a sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an editing template or editing polynucleotide or editing sequence. In some aspects, an exogenous template polynucleotide may be referred to as an editing template. In some aspects, the recombination is homologous recombination.

(225) Typically, in the context of an endogenous CRISPR system, formation of the CRISPR complex (comprising the guide sequence hybridized to the target sequence and complexed with one or more Cas proteins) results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence. Without wishing to be bound by theory, the tracr sequence, which may comprise or consist of all or a portion of a wild-type tracr sequence (e.g. about or more than about 20, 26, 32, 45, 48, 54, 63, 67, 85, or more nucleotides of a wild-type tracr sequence), may also form part of the CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operably linked to the guide sequence. In some embodiments, the tracr sequence has sufficient complementarity to a tracr mate sequence to hybridize and participate in formation of the CRISPR complex.

(226) As with the target sequence, in some embodiments, complete complementarity is not necessarily needed. In some embodiments, the tracr sequence has at least 50%, 60%, 70%, 80%, 90%, 95% or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned. In some embodiments, one or more vectors driving expression of one or more elements of the CRISPR system are introduced into the cell such that expression of the elements of the CRISPR system direct formation of the CRISPR complex at one or more target sites. For example, a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors. Alternatively, two or more of the elements expressed from the same or different regulatory elements, may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector. In some embodiments, CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5 with respect to (upstream of) or 3 with respect to (downstream of) a second element. The coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction. In some embodiments, a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron). In some embodiments, the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.

(227) In some embodiments, a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a cloning site). In some embodiments, one or more insertion sites (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites) are located upstream and/or downstream of one or more sequence elements of one or more vectors. In some embodiments, a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of the CRISPR complex to a target sequence in a eukaryotic cell. In some embodiments, a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site. In such an arrangement, the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these. When multiple different guide sequences are used, a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell. For example, a single vector may comprise about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to the cell.

(228) In some embodiments, a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding the CRISPR enzyme, such as a Cas protein. Non-limiting examples of Cas proteins include Cas 1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csxl, Csx15, Csf1, Csf2, Csf3, Csf4, homologs thereof, or modified versions thereof. These enzymes are known; for example, the amino acid sequence of S. pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2. In some embodiments, the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9. In some embodiments the CRISPR enzyme is Cas9, and may be Cas9 from S. pyogenes, S. aureus or S. pneumoniae. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.

(229) In some embodiments, a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme. Non-limiting examples of mutations in a Cas9 protein are known in the art (see e.g. WO2015/161276), any of which can be included in a CRISPR/Cas9 system in accord with the provided methods. In some embodiments, the CRISPR enzyme is mutated such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence. For example, an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand). In some embodiments, a Cas9 nickase may be used in combination with guide sequence(s), e.g., two guide sequences, which target respectively sense and antisense strands of the DNA target. This combination allows both strands to be nicked and used to induce NHEJ.

(230) In some embodiments, an enzyme coding sequence encoding the CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. In some embodiments, one or more codons (e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding the CRISPR enzyme corresponds to the most frequently used codon for a particular amino acid.

(231) In general, a guide sequence includes a targeting domain comprising a polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of the CRISPR complex to the target sequence. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. In some examples, the targeting domain of the gRNA is complementary, e.g., at least 80, 85, 90, 95, 98 or 99% complementary, e.g., fully complementary, to the target sequence on the target nucleic acid.

(232) Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). In some embodiments, a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of the CRISPR complex to a target sequence may be assessed by any suitable assay. For example, the components of the CRISPR system sufficient to form the CRISPR complex, including the guide sequence to be tested, may be provided to the cell having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein. Similarly, cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of the CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions.

(233) A guide sequence may be selected to target any target sequence. In some embodiments, the target sequence is a sequence within a genome of a cell. Exemplary target sequences include those that are unique in the target genome. In some embodiments, a guide sequence is selected to reduce the degree of secondary structure within the guide sequence. Secondary structure may be determined by any suitable polynucleotide folding algorithm.

(234) In general, a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence. In general, degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences.

(235) Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence. In some embodiments, the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin. In some aspects, loop forming sequences for use in hairpin structures are four nucleotides in length, and have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences. In some embodiments, the sequences include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG. In some embodiments, the transcript or transcribed polynucleotide sequence has at least two or more hairpins. In some embodiments, the transcript has two, three, four or five hairpins. In a further embodiment, the transcript has at most five hairpins. In some embodiments, the single transcript further includes a transcription termination sequence, such as a polyT sequence, for example six T nucleotides.

(236) In some embodiments, the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme). A CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains. Examples of protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporter genes include, but are not limited to, glutathione-5-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP). A CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4A DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CR ISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.

(237) In some embodiments, a CRISPR enzyme in combination with (and optionally complexed with) a guide sequence is delivered to the cell. In some embodiments, methods for introducing a protein component into a cell according to the present disclosure (e.g. Cas9/gRNA RNPs) may be via physical delivery methods (e.g. electroporation, particle gun, Calcium Phosphate transfection, cell compression or squeezing), liposomes or nanoparticles.

(238) For example, CRISPR/Cas9 technology may be used to knock-down gene expression of the target antigen in the engineered cells. In an exemplary method, Cas9 nuclease (e.g., that encoded by mRNA from Staphylococcus aureus or from Stretpococcus pyogenes, e.g. pCW-Cas9, Addgene #50661, Wang et al. (2014) Science, 3:343-80-4; or nuclease or nickase lentiviral vectors available from Applied Biological Materials (ABM; Canada) as Cat. No. K002, K003, K005 or K006) and a guide RNA specific to the target antigen gene are introduced into cells, for example, using lentiviral delivery vectors or any of a number of known delivery method or vehicle for transfer to cells, such as any of a number of known methods or vehicles for delivering Cas9 molecules and guide RNAs. Non-specific or empty vector control T cells also are generated. Degree of Knockout of a gene (e.g., 24 to 72 hours after transfer) is assessed using any of a number of well-known assays for assessing gene disruption in cells.

(239) It is within the level of a skilled artisan to design or identify a gRNA sequence that is or comprises a sequence targeting a target antigen of interest, such as any described herein, including the exon sequence and sequences of regulatory regions, including promoters and activators. A genome-wide gRNA database for CRISPR genome editing is publicly available, which contains exemplary single guide RNA (sgRNA) target sequences in constitutive exons of genes in the human genome or mouse genome (see e.g., genescript.com/gRNA-database.html; see also, Sanjana et al. (2014) Nat. Methods, 11:783-4; http://www.e-crisp.org/E-CRISP/; http://crispr.mit.edu/; https://www.dna20.com/eCommerce/cas9/input). In some embodiments, the gRNA sequence is or comprises a sequence with minimal off-target binding to a non-target gene.

(240) Commercially available kits, gRNA vectors and donor vectors, for knockout of a universal tumor antigen or other target antigen, or a family member thereof, such any as described herein, for example one or more of MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53, cyclin (D1), BCMA, BAFFR, or TACI are available, for example, from Origene (Rockville, Md.), GenScript (Atlanta, Ga.), Applied Biological Materials (ABM; Richmond, British Colombia), BioCat (Heidelberg, Germany) or others. For example, commercially available kits for knockout of hTERT via CRISPR include, for example, those available as catalog numbers K0009801, K0009802, K009803 and/or K0009804 each available from ABM. Commercially available kits for knockout of survivin via CRISPR include, for example, catalog numbers KN205935 available from Origene and catalog numbers K0184401, K0184402, K0184403, K0184404 each available from ABM. Commercially available kits for knockout of MDM2 via CRISPR include, for example, KN219518 from Origene and catalog number K1283521 from ABM. Commercially available kits for knockout of Her2/neu via CRISPR include, for example, KN212583 from Origene. Commercially available kits for knockout of Cyp1B1 via CRISPR include, for example, KN204074-OR available from BioCat. Commercially available kits for knockout of WT1 via CRISPR include, for example, KN220079 from Origine.

(241) Commercially available kits, gRNA vectors and donor vectors, for knockout of CD38 via CRISPR are available, for example, from OriGene. See www.origene.com/CRISPR-CAS9/Product.aspx?SKU=KN203179; catalog numbers KN203179G1, KN203179G2, KN203179D.

(242) Commercially available kits, gRNA vectors and donor vectors for knockout of BCMA, TACI or BAFF receptor, FcRH5 or other antigen as described are available, for example, from Santa Cruz Biotechnology (Dallas, Tex.), Origene (Rockville, Md.), GenScript (Piscataway, N.J.). In some embodiments, gRNA sequences for CRISPR knockout of BCMA include, for example, any set forth in any of SEQ ID NOS: 37-42, which, in some cases, can be used with a Cas9 nuclease to introduce a double stranded break by gene editing (see e.g. Sanjana et al. (2014) Nat. Methods, 11:783-4). Commercially available kits for knockout of BCMA via CRISPR include, for example, catalog number KN208851 from Origene. In some embodiments, gRNA sequences for CRISPR knockout of TACI include, for example, any set forth in any of SEQ ID NOS: 43-48, which, in some cases, can be used with a Cas9 nuclease to introduce a double stranded break by gene editing. Commercially available kits for knockout of TACI via CRISPR include, for example, catalog number KN204672 from Origene. In some embodiments, gRNA sequences for CRISPR knockout of BAFF receptor include, for example, any set forth in any of SEQ ID NOS: 49-54, which, in some cases, can be used with a Cas9 nuclease to introduce a double stranded break by gene editing. Commercially available kits for knockout of BAFF receptor via CRISPR include, for example, catalog number KN211270 from Origene.

(243) In some embodiments, gRNA sequences for CRISPR knockout of FcRH5 include, for example, any set forth in any of SEQ ID NOS: 57-62, which, in some cases, can be used with a Cas9 nuclease to introduce a double stranded break by gene editing. Commercially available kits for knockout of FcRH5 via CRISPR include, for example, catalog number KN221468 from Origene.

(244) In some embodiments, design gRNA guide sequences and/or vectors for any of the antigens as described herein are generated using any of a number of known methods, such as those for use in gene knockdown via CRISPR-mediated, TALEN-mediated and/or related methods.

(245) In some aspects, target polynucleotides are modified in a eukaryotic cell. In some embodiments, the method comprises allowing the CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises the CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.

(246) In some aspects, the methods include modifying expression of a polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing the CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.

(247) In some embodiments, a CRISPR/Cas system can be used for knocking down, such as reducing or suppressing, the expression of a target sequence. Exemplary features of CRISPR/Cas systems are described below and can be adapted for use in reducing or suppressing expression of a molecule, rather than disrupting or deleting a gene encoding the molecule, by using an enzymatically inactive nuclease. In some embodiments, a guide RNA (gRNA) targeting a gene of interest, such as any described herein, or the promoter, enhancer or other cis- or trans-acting regulatory regions associated therewith, can be introduced in combination with a modified Cas9 protein or a fusion protein containing the modified Cas9 protein, to suppress the expression of, e.g., knock-down, of the gene(s). In some embodiments, the Cas9 molecule is an enzymatically inactive Cas9 (eiCas9) molecule, which comprises a mutation, e.g., a point mutation, that causes the Cas9 molecule to be inactive, e.g., a mutation that eliminates or substantially reduces the Cas9 molecule cleavage activity (see e.g. WO2015/161276). In some embodiments, the eiCas9 molecule is fused, directly or indirectly to, a transcription activator or repressor protein.

(248) Delivery of Nucleic Acids Encoding the Gene Disrupting Molecules and Complexes

(249) In some aspects, a nucleic acid encoding the DNA-targeting molecule, complex thereof (e.g. Cas9/gRNA RNPs), or combination, is administered or introduced to the cell. In some embodiments, such nucleic acid molecule or complex thereof can be introduced into cells, such as T cells, by methods well known in the art. Such methods include, but are not limited to, introduction in the form of recombinant viral vectors (e.g. retroviruses, lentiviruses, adenoviruses), liposomes or nanoparticles. In some embodiments, methods can include microinjection, electroporation, particle bombardment, Calcium Phosphate transfection, cell compression, or squeezing. In some embodiments, such nucleic acid molecule or complex thereof can be introduced in the form of an expression vector, such as a viral expression vector. In some aspects, the expression vector is a retroviral expression vector, an adenoviral expression vector, a DNA plasmid expression vector, or an AAV expression vector. In some aspects, one or more polynucleotides encoding the disruption molecule or complex, such as the DNA-targeting molecule, is delivered to the cell. In some aspects, the delivery is by delivery of one or more vectors, one or more transcripts thereof, and/or one or proteins transcribed therefrom, is delivered to the cell.

(250) In some embodiments, the polypeptides are synthesized in situ in the cell as a result of the introduction of polynucleotides encoding the polypeptides into the cell. In some aspects, the polypeptides could be produced outside the cell and then introduced thereto. Methods for introducing a polynucleotide construct into animal cells are known and include, as non-limiting examples stable transformation methods wherein the polynucleotide construct is integrated into the genome of the cell, transient transformation methods wherein the polynucleotide construct is not integrated into the genome of the cell, and virus mediated methods. In some embodiments, the polynucleotides may be introduced into the cell by for example, recombinant viral vectors (e.g. retroviruses, adenoviruses), liposome and the like. For example, in some aspects, transient transformation methods include microinjection, electroporation, or particle bombardment. In some embodiments, the polynucleotides may be included in vectors, more particularly plasmids or virus, in view of being expressed in the cells.

(251) In some embodiments, viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding components of a CRISPR, ZFP, ZFN, TALE, and/or TALEN system to cells in culture, or in a host organism. Non-viral vector delivery systems include DNA plasmids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome. Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon. TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10): 1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bohm (eds) (1995); and Yu et al., Gene Therapy 1:13-26 (1994).

(252) Methods of non-viral delivery of nucleic acids include lipofection, nucleofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam and Lipofectin). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration).

(253) In some embodiments, delivery is via the use of RNA or DNA viral based systems for the delivery of nucleic acids. Viral vectors in some aspects may be administered directly to patients (in vivo) or they can be used to treat cells in vitro or ex vivo, and then administered to patients. Viral-based systems in some embodiments include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer.

(254) In some aspects, a reporter gene which includes but is not limited to glutathione-5-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP), may be introduced into the cell to encode a gene product which serves as a marker by which to measure the alteration or modification of expression of the gene product. In a further embodiment, the DNA molecule encoding the gene product may be introduced into the cell via a vector. In some embodiments, the gene product is luciferase. In a further embodiment, the expression of the gene product is decreased.

(255) In some embodiments, an agent capable of inducing a genetic disruption, such as a knockdown or a knockout of a target gene or genes, such as any encoding an antigen described herein, is introduced as a complex, such as a ribonucleoprotein (RNP) complex. RNP complexes include a sequence of ribonucleotides, such as an RNA or a gRNA molecule, and a polypeptide, such as a Cas9 protein or variant thereof. In some embodiments, the Cas9 protein is delivered as an RNP complex that comprises a Cas9 protein and a gRNA molecule, e.g., a gRNA targeted for a gene encoding the target antigen. In some embodiments, the RNP that includes one or more gRNA molecules targeted for a gene encoding the target antigen, and a Cas9 enzyme or variant thereof, is directly introduced into the cell via physical delivery (e.g., electroporation, particle gun, Calcium Phosphate transfection, cell compression or squeezing), liposomes or nanoparticles. In particular embodiments, the RNP includes one or more gRNA molecules targeted for a gene encoding the target antigen and a Cas9 enzyme or variant thereof is introduced via electroporation.

(256) In some embodiments, the degree of knockout of a gene, such as any encoding an antigen described herein, at various time points, e.g., 24 to 72 hours after introduction of agent, can be assessed using any of a number of well-known assays for assessing gene disruption in cells. Degree of knockdown of a gene at various time points, e.g., 24 to 72 hours after introduction of agent, can be assessed using any of a number of well-known assays for assessing gene expression in cells, such as assays to determine the level of transcription or protein expression or cell surface expression.

II. COMPOSITIONS, FORMULATIONS, KITS, DEVICES, METHODS, AND USES

(257) Also provided are cells, cell populations, and compositions containing the cells produced by the provided methods. Among the compositions are pharmaceutical compositions and formulations for administration, such as for adoptive cell therapy. Also provided are therapeutic methods for administrating the cells and compositions to subjects, e.g., patients.

(258) Provided are methods and uses of the cells, including therapeutic methods and uses, such as in adoptive cell therapy. In some embodiments, the methods include administration of the cells or a composition containing the cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having a disease, condition or disorder. In some embodiments, the methods treat cancers and other diseases, conditions, and disorders. In some embodiments, the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy. In some embodiments, the cells or compositions are administered to the subject, such as a subject having or at risk for the disease or condition. In some aspects, the methods thereby treat, e.g., ameliorate one or more symptom of, the disease or condition, such as by lessening tumor burden in a cancer expressing an antigen recognized by the engineered cell.

(259) Methods for administration of cells for adoptive cell therapy are known and may be used in connection with the provided methods and compositions. For example, adoptive T cell therapy methods are described, e.g., in US Patent Application Publication No. 2003/0170238 to Gruenberg et al; U.S. Pat. No. 4,690,915 to Rosenberg; Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85). See, e.g., Themeli et al. (2013) Nat Biotechnol. 31(10): 928-933; Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1): 84-9; Davila et al. (2013) PLoS ONE 8(4): e61338.

(260) In some embodiments, the cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is carried out by autologous transfer, in which the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject. Thus, in some aspects, the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, following isolation and processing are administered to the same subject.

(261) In some embodiments, the cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is carried out by allogeneic transfer, in which the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject. In such embodiments, the cells then are administered to a different subject, e.g., a second subject, of the same species. In some embodiments, the first and second subjects are genetically identical. In some embodiments, the first and second subjects are genetically similar. In some embodiments, the second subject expresses the same HLA class or supertype as the first subject.

(262) In some embodiments, the subject, e.g., patient, to whom the cells, cell populations, or compositions are administered is a mammal, typically a primate, such as a human. In some embodiments, the primate is a monkey or an ape. The subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects. In some embodiments, the subject is a non-primate mammal, such as a rodent. In some examples, the patient or subject is a validated animal model for disease, adoptive cell therapy, and/or for assessing toxic outcomes such as cytokine release syndrome (CRS).

(263) Also provided are pharmaceutical compositions for use in such methods.

(264) Among the diseases, conditions, and disorders are tumors, including solid tumors, hematologic malignancies, and melanomas, and infectious diseases, such as infection with a virus or other pathogen, e.g., HIV, HCV, HBV, CMV, and parasitic disease. In some embodiments, the disease or condition is a tumor, cancer, malignancy, neoplasm, or other proliferative disease. Such diseases include but are not limited to cancers of the immune system, leukemia, lymphoma, e.g., chronic lymphocytic leukemia (CLL), ALL, non-Hodgkin's lymphoma, acute myeloid leukemia, multiple myeloma, refractory follicular lymphoma, mantle cell lymphoma, indolent B cell lymphoma, B cell malignancies, cancers of the colon, lung, liver, breast, prostate, ovarian, skin (including melanoma), bone, and brain cancer, ovarian cancer, epithelial cancers, renal cell carcinoma, pancreatic adenocarcinoma, Hodgkin lymphoma, cervical carcinoma, colorectal cancer, glioblastoma, glioma, neuroblastoma, Ewing sarcoma, medulloblastoma, osteosarcoma, synovial sarcoma, and/or mesothelioma. In one embodiment, the disease or condition is or is associated with multiple myeloma.

(265) In some embodiments, the disease or condition is an infectious disease or condition, such as, but not limited to, viral, retroviral, bacterial, and protozoal infections, immunodeficiency, Cytomegalovirus (CMV), Epstein-Barr virus (EBV), adenovirus, BK polyomavirus. In some embodiments, the disease or condition is an autoimmune or inflammatory disease or condition, such as arthritis, e.g., rheumatoid arthritis (RA), Type I diabetes, systemic lupus erythematosus (SLE), inflammatory bowel disease, psoriasis, scleroderma, autoimmune thyroid disease, Grave's disease, Crohn's disease multiple sclerosis, asthma, and/or a disease or condition associated with transplant.

(266) In some embodiments, the one or more genetically engineered antigen receptors specifically binds to a target antigen associated with the disease or disorder. In some embodiments, the one or more genetically engineered antigen receptors binds to a target antigen as well as one or more antigens related to the target antigen. In some cases, two more genetically engineered antigen receptors bind to two or more different antigens associated with the disease or disorder, or related antigens thereof. In some embodiments, at least one antigen associated with the disease or disorder is a universal tumor antigen, or a family member thereof. For example, in some cases the antigen is hTERT, survivin, MDM2, CYP1B, HER2/neu, WT1, livin, AFP, CEA, MUC16, MUC1, PSMA, p53, cyclin (D1), BCMA, BAFFR, or TACI. For example, the universal tumor antigen is hTERT or survivin. In some embodiments, at least one antigen associated with the disease or disorder is a myeloma antigen. For example, in some cases, the myeloma antigen is CD38, CD138, CS-1, CD56, TIM-3, CD33, CD123 or CD44. For example, the myeloma antigen is CD38.

(267) In some embodiments, one or more other antigens associated with the disease or disorder is selected from the group consisting of orphan tyrosine kinase receptor ROR1, EGFR, Her2, L1-CAM, CD19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, OEPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gp100, oncofetal antigen, ROR1, TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, estrogen receptor, progesterone receptor, ephrinB2, CD123, CS-1, c-Met, GD-2, and MAGE A3, CE7, Wilms Tumor 1 (WT-1), a cyclin, such as cyclin A1 (CCNA1), and/or biotinylated molecules, and/or molecules expressed by HIV, HCV, HBV or other pathogens. The antigens include proteins, carbohydrates, and other molecules.

(268) In some embodiments, the cells and cell populations are administered to a subject in the form of a composition, such as a pharmaceutical composition. In some embodiments, the pharmaceutical composition further comprises other pharmaceutically active agents or drugs, such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. In some embodiments, the cell populations are administered in the form of a salt, e.g., a pharmaceutically acceptable salt. Suitable pharmaceutically acceptable acid addition salts include those derived from mineral acids, such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids, and organic acids, such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and arylsulphonic acids, for example, p-toluenesulphonic acid.

(269) In some aspects, the choice of carrier can in the pharmaceutical composition is determined in part by the particular engineered CAR or TCR, vector, or cells expressing the CAR or TCR, as well as by the particular method used to administer the vector or host cells expressing the CAR. Accordingly, there are a variety of suitable formulations. For example, the pharmaceutical composition can contain preservatives. Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. In some aspects, a mixture of two or more preservatives is used. The preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition.

(270) In addition, buffering agents in some aspects are included in the composition. Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some aspects, a mixture of two or more buffering agents is used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001% to about 4% by weight of the total composition. Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005).

(271) In certain embodiments, a pharmaceutical composition comprising a cell population described herein can be formulated as an inclusion complex, such as cyclodextrin inclusion complex, or as a liposome. Liposomes can serve to target the host cells (e.g., T-cells or NK cells) to a particular tissue. Many methods are available for preparing liposomes, such as those described in, for example, Szoka et al., Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S. Pat. Nos. 4,235,871, 4,501,728, 4,837,028, and 5,019,369.

(272) The pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. Many types of release delivery systems are available and known to those of ordinary skill in the art. Such systems can avoid repeated administrations of the composition, thereby increasing convenience to the subject and the physician.

(273) The pharmaceutical composition in some embodiments comprises the cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactically effective amount. Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and can be determined. The desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.

(274) In certain embodiments, a subject is administered the range of about one million to about 100 billion cells, such as, e.g., 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), and in some cases about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells) or any value in between these ranges.

(275) The cells and compositions in some embodiments are administered using standard administration techniques, formulations, and/or devices. Provided are formulations and devices, such as syringes and vials, for storage and administration of the compositions. Administration can be autologous or heterologous. For example, immunoresponsive cells or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject. Peripheral blood derived immunoresponsive cells of the invention or their progeny (e.g., in vivo, ex vivo or in vitro derived) can be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration. When administering a therapeutic composition of the present invention (e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell), it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).

(276) Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. In some embodiments, the cell populations are administered parenterally. The term parenteral, as used herein, includes intravenous, intramuscular, subcutaneous, rectal, vaginal, and intraperitoneal administration. In some embodiments, the cell populations are administered to a subject using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection.

(277) Compositions of the cells in some embodiments are provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH. Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues. Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyoi (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.

(278) Sterile injectable solutions can be prepared by incorporating the genetically engineered in a solvent, such as in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts may in some aspects be consulted to prepare suitable preparations.

(279) Various additives which enhance the stability and sterility of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.

(280) The cells in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order. In some contexts, the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa. In some embodiments, the cell populations are administered prior to the one or more additional therapeutic agents. In some embodiments, the cell populations are administered after to the one or more additional therapeutic agents.

(281) Once the cells are administered to a mammal (e.g., a human), the biological activity of the engineered cell populations in some aspects is measured by any of a number of known methods. Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry. In certain embodiments, the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J. Immunological Methods, 285(1): 25-40 (2004). In certain embodiments, the biological activity of the cells also can be measured by assaying expression and/or secretion of certain cytokines, such as CD 107a, IFN, IL-2, and TNF. In some aspects the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load.

(282) In certain embodiments, engineered cells are modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased. For example, the engineered CAR or TCR expressed by the population can be conjugated either directly or indirectly through a linker to a targeting moiety. The practice of conjugating compounds, e.g., the CAR or TCR, to targeting moieties is known in the art. See, for instance, Wadwa et al., J. Drug Targeting 3: 1 1 1 (1995), and U.S. Pat. No. 5,087,616.

III. DEFINITIONS

(283) As used herein, repression of gene expression refers to the elimination or reduction of expression of one or more gene products encoded by the subject gene in a cell, compared to the level of expression of the gene product in the absence of the repression. Exemplary gene products include mRNA and protein products encoded by the gene. Repression in some cases is transient or reversible and in other cases is permanent. Repression in some cases is of a functional or full-length protein or mRNA, despite the fact that a truncated or non-functional product may be produced. In some embodiments herein, gene activity or function, as opposed to expression, is repressed. Gene repression is generally induced by artificial methods, i.e., by addition or introduction of a compound, molecule, complex, or composition, and/or by disruption of nucleic acid of or associated with the gene, such as at the DNA level. Exemplary methods for gene repression include gene silencing, knockdown, knockout, and/or gene disruption techniques, such as gene editing. Examples include antisense technology, such as RNAi, siRNA, shRNA, and/or ribozymes, which generally result in transient reduction of expression, as well as gene editing techniques which result in targeted gene inactivation or disruption, e.g., by induction of breaks and/or homologous recombination.

(284) As used herein, a disruption of a gene refers to a change in the sequence of the gene, at the DNA level. Examples include insertions, mutations, and deletions. The disruptions typically result in the repression and/or complete absence of expression of a normal or wild type product encoded by the gene. Exemplary of such gene disruptions are insertions, frameshift and missense mutations, deletions, knock-in, and knock-out of the gene or part of the gene, including deletions of the entire gene. Such disruptions can occur in the coding region, e.g., in one or more exons, resulting in the inability to produce a full-length product, functional product, or any product, such as by insertion of a stop codon. Such disruptions may also occur by disruptions in the promoter or enhancer or other region affecting activation of transcription, so as to prevent transcription of the gene. Gene disruptions include gene targeting, including targeted gene inactivation by homologous recombination.

(285) As used herein, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. For example, a or an means at least one or one or more.

(286) Throughout this disclosure, various aspects of the claimed subject matter are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the claimed subject matter. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, where a range of values is provided, it is understood that each intervening value, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the claimed subject matter. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the claimed subject matter, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the claimed subject matter. This applies regardless of the breadth of the range.

(287) The term about as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to about a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.

(288) As used herein, a subject includes any living organism, such as humans and other mammals. Mammals include, but are not limited to, humans, and non-human animals, including farm animals, sport animals, rodents and pets.

(289) As used herein, a composition refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.

(290) As used herein, the terms treatment, treat, and treating, refer to complete or partial amelioration or reduction of a disease or condition or disorder, or a symptom, adverse effect or outcome, or phenotype associated therewith. In certain embodiments, the effect is therapeutic, such that it partially or completely cures a disease or condition or adverse symptom attributable thereto.

(291) As used herein, a therapeutically effective amount of a compound or composition or combination refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result, such as for treatment of a disease, condition, or disorder, and/or pharmacokinetic or pharmacodynamic effect of the treatment. The therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the subject, and the populations of cells administered.

(292) As used herein, a statement that a cell or population of cells is positive for a particular marker refers to the detectable presence on or in the cell of a particular marker, typically a surface marker. When referring to a surface marker, the term refers to the presence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is detectable by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions and/or at a level substantially similar to that for cell known to be positive for the marker, and/or at a level substantially higher than that for a cell known to be negative for the marker.

(293) As used herein, a statement that a cell or population of cells is negative for a particular marker refers to the absence of substantial detectable presence on or in the cell of a particular marker, typically a surface marker. When referring to a surface marker, the term refers to the absence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is not detected by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions, and/or at a level substantially lower than that for cell known to be positive for the marker, and/or at a level substantially similar as compared to that for a cell known to be negative for the marker.

(294) In some embodiments, a decrease in expression of one or markers refers to loss of 1 log.sup.10 in the mean fluorescence intensity and/or decrease of percentage of cells that exhibit the marker of at least about 20% of the cells, 25% of-the cells, 30% of the cells, 35% of the cells, 40% of the cells, 45% of the cells, 50% of the cells, 55% of the cells, 60% of the cells, 65% of the cells, 70% of the cells, 75% of the cells, 80% of the cells, 85% of the cells, 90% of the cell, 95% of the cells, and 100% of the cells and any % between 20 and 100% when compared to a reference cell population. In some embodiments, a cell population positive for one or markers refers to a percentage of cells that exhibit the marker of at least about 50% of the cells, 55% of the cells, 60% of the cells, 65% of the cells, 70% of the cells, 75% of the cells, 80% of the cells, 85% of the cells, 90% of the cell, 95% of the cells, and 100% of the cells and any % between 50 and 100% when compared to a reference cell population.

(295) Unless defined otherwise, all terms of art, notations and other technical and scientific terms or terminology used herein are intended to have the same meaning as is commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.

(296) All publications, including patent documents, scientific articles and databases, referred to in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication were individually incorporated by reference. If a definition set forth herein is contrary to or otherwise inconsistent with a definition set forth in the patents, applications, published applications and other publications that are herein incorporated by reference, the definition set forth herein prevails over the definition that is incorporated herein by reference.

(297) The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

IV. EXEMPLARY EMBODIMENTS

(298) Among the embodiments provided herein are:

(299) 1. An engineered immune cell comprising:

(300) a genetically engineered antigen receptor that specifically binds to a target antigen that is a universal tumor antigen; and

(301) a genetic disruption resulting in reduced expression of the target antigen in the engineered immune cell.

(302) 2. The engineered cell of embodiment 1, wherein the universal tumor antigen is a human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53 or cyclin (D1).

(303) 3. The engineered cell of embodiment 1 or embodiment 2, wherein the universal tumor antigen is hTERT or survivin.

(304) 4. An engineered immune cell comprising:

(305) a genetically engineered antigen receptor that specifically binds to a target antigen, wherein the target antigen is B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI) or B-cell activating factor receptor (BAFF-R); and

(306) a genetic disruption resulting in reduced expression of the target antigen in the engineered immune cell.

(307) 5. The engineered immune cell of any of embodiments 1-4, wherein the genetic disruption comprises a disruption in a gene encoding the target antigen.

(308) 6. The engineered immune cell of any of embodiments 1-5, wherein the target antigen is a gene product that is capable of being naturally expressed in the cell type of the engineered immune cell.

(309) 7. The engineered immune cell of any of embodiments 1-6, wherein the target antigen is an antigen expressed by resting T cells, activated T cells, or both.

(310) 8. The engineered immune cell of any of embodiments 1-7, wherein the target antigen is an antigen expressed by activated T cells and expressed at a reduced level by resting T cells.

(311) 9. The engineered immune cell of embodiment 8, wherein expression of the target antigen by activated T cells at a level that is more than 50%, 60%, 70%, 80%, 90%, 95% or more and/or 1-fold, 1.5-fold, 2-fold, 3-fold or more compared to resting or non-activated T cells.

(312) 10. The engineered immune cell of embodiment 8 or embodiment 9, wherein the target antigen is not expressed on resting T cells.

(313) 11. An engineered immune cell comprising:

(314) a genetically engineered antigen receptor that specifically binds to a disease-specific target antigen, wherein the receptor also binds or is suspected of binding to a related antigen, which is related to the target antigen; and

(315) a genetic disruption in a gene encoding the related antigen and/or a genetic disruption that results in or is capable of resulting in reduced or repressed expression of the related antigen in the engineered immune cell.

(316) 12. The engineered immune cell of embodiment 11, wherein the target antigen is a B cell maturation antigen (BCMA) and the related antigen is a different BCMA family member.

(317) 13. The engineered immune cell of embodiment 12, wherein the BCMA family member is TACI or BAFF-R.

(318) 14. The engineered immune cell of any of embodiments 11-13, wherein the target antigen is a gene product that is not naturally expressed in the cell type of the engineered immune cell and the related antigen is a gene product that is naturally expressed in the cell type of the engineered immune cell.

(319) 15. The engineered immune cell of any of embodiments 1-14, wherein the immune cell is a T cell or an NK cell.

(320) 16. The engineered immune cell of any of embodiments 1-15, wherein the immune cell is a T cell that is a CD4+ or CD8+ T cell.

(321) 17. The engineered immune cell of any of embodiments 11-12, wherein the related antigen is an antigen that is expressed by resting T cells, activated T cells, or both.

(322) 18. The engineered immune cell of any of embodiments 11-17, wherein the related antigen is an antigen expressed by activated T cells and expressed at a reduced level by resting T cells.

(323) 19. The engineered immune cell of embodiment 18, wherein expression of the related antigen by activated T cells at a level that is more than 50%, 60%, 70%, 80%, 90%, 95% or more and/or 1-fold, 1.5-fold, 2-fold, 3-fold or more compared to resting or non-activated T cells.

(324) 20. The engineered immune cell of embodiment 18 or embodiment 19, wherein the related antigen is not expressed on resting T cells.

(325) 21. The engineered immune cell of any of embodiments 8-10 or 17-19, wherein:

(326) the activated T cells are surface positive for a T cell activation marker selected from the group consisting of HLA-DR, CD25, CD69, CD71, CD40L (CD154) and 4-1BB (CD137) and/or contain intracellular expression of a cytokine selected from the group consisting of IL-2, IFNgamma and TNF-alpha; and/or

(327) the resting T cells are surface negative for a T cell activation marker selected from the group consisting of HLA-DR, CD25, CD69, CD71, CD40L (CD154) and 4-1BB (CD137) or lack intracellular expression of a cytokine selected from the group consisting of IL-2, IFNgamma and TNF-alpha.

(328) 22. The cell of any of embodiments 1-21, wherein expression of the target antigen or the related antigen in the engineered immune cell is reduced by at least 50, 60, 70, 80, 90, or 95% as compared to the expression in the immune cell in the absence of said disruption.

(329) 23. The engineered immune cell of any of embodiments 1-22, wherein:

(330) the target antigen is expressed on the cell surface in a cancer; or

(331) the target antigen is expressed on or in a cell or tissue of a cancer.

(332) 24. The engineered immune cell of embodiment 23, wherein the cancer is a hematologic cancer, an immune cancer, a leukemia, a lymphoma, and/or a myeloma, which optionally is multiple myeloma.

(333) 25. The engineered immune cell of any of embodiments 1-24, wherein the genetically engineered antigen receptor is a T cell receptor (TCR) or a functional non-TCR antigen recognition receptor.

(334) 26. The engineered immune cell of any of embodiments 1-25, wherein the genetically engineered antigen receptor is a chimeric antigen receptor (CAR) comprising an extracellular antigen-recognition domain that specifically binds to the target antigen.

(335) 27. The engineered immune cell of any of embodiments 1-26, wherein the genetically engineered antigen receptor is a chimeric antigen receptor (CAR) comprising an extracellular antigen-recognition domain that specifically binds to a peptide of the target antigen in the context of a major histocompatibility complex (MHC) molecule.

(336) 28. The engineered immune cell of any of embodiments 1-27, wherein the genetically engineered antigen receptor is capable of inducing an activating signal to the engineered immune cell.

(337) 29. The engineered immune cell of embodiment 28, wherein the genetically engineered antigen receptor comprises an intracellular domain with an ITAM-containing motif.

(338) 30. The engineered immune cell of embodiment 29, wherein the intracellular signaling domain comprises an intracellular domain of a CD3-zeta (CD3) chain.

(339) 31. The engineered immune cell of any of embodiments 28-30, wherein the genetically engineered receptor is a CAR and further comprises a costimulatory signaling region.

(340) 32. The engineered immune cell of embodiment 31, wherein the costimulatory signaling region comprises a signaling domain of CD28.

(341) 33. The engineered immune cell of any of embodiments 1-32, further comprising another genetically engineered antigen receptor, which is a chimeric costimulatory receptor that specifically binds to another antigen and is capable of inducing a costimulatory signal to the cell.

(342) 34. The engineered immune cell of any of embodiments 1-32, further comprising another genetically engineered antigen receptor, which is a chimeric inhibitory receptor that specifically binds to a second target antigen and is capable of inducing an inhibitory or immunosuppressive or repressive signal to the cell upon recognition of the other target antigen.

(343) 35. The engineered immune cell of embodiment 34, wherein the second target antigen is an antigen that is not expressed on the surface of a cancer cell or infected cell or the expression of which is downregulated on a cancer cell or an infected cell.

(344) 36. The engineered immune cell of embodiment 34 or embodiment 35, wherein the second target antigen is an MHC-class I molecule.

(345) 37. The engineered immune cell of any of embodiments 34-36, wherein the genetically engineered antigen receptor is a chimeric antigen receptor (CAR).

(346) 38. The engineered immune cell of embodiment 37, wherein the CAR comprises an extracellular antigen-recognition domain that specifically binds to the target antigen and an intracellular signaling domain that comprises a signaling portion of an immune checkpoint molecule.

(347) 39. The engineered immune cell of embodiment 38, wherein the immune checkpoint molecule is PD-1 or CTLA4.

(348) 40. A method of producing a genetically engineered immune cell, comprising:

(349) (a) introducing into an immune cell a genetically engineered antigen receptor that specifically binds to a target antigen that is a universal tumor antigen; and

(350) (b) effecting repression of expression of the target antigen in the immune cell,

(351) thereby producing a genetically engineered immune cell in which expression of the target antigen is repressed,

(352) wherein steps (a) and (b) are carried out simultaneously or sequentially in any order.

(353) 41. The method of embodiment 40, wherein the universal tumor antigen is human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53 or cyclin (D1).

(354) 42. The method of embodiment 40 or embodiment 41, wherein the universal tumor antigen is hTERT or survivin.

(355) 43. A method of producing a genetically engineered immune cell, comprising:

(356) (a) introducing into an immune cell a genetically engineered antigen receptor that specifically binds to a target antigen, wherein the target antigen is BCMA, TACI or BAFF receptor; and

(357) (b) effecting repression of expression of the target antigen in the immune cell,

(358) thereby producing a genetically engineered immune cell in which expression of the target antigen is repressed,

(359) wherein steps (a) and (b) are carried out simultaneously or sequentially in any order.

(360) 44. The method of any of embodiments 40-43, wherein the target antigen is a gene product that is capable of being naturally expressed in the cell type of the engineered immune cell.

(361) 45. The method of any of embodiments 40-44, wherein the target antigen is an antigen expressed by resting T cells, activated T cells, or both.

(362) 46. The method of any of embodiments 40-45, wherein the target antigen is an antigen expressed by activated T cells and expressed at a reduced level by resting T cells.

(363) 47. The method of embodiment 46, wherein expression of the target antigen by activated T cells at a level that is more than 50%, 60%, 70%, 80%, 90%, 95% or more and/or 1-fold, 1.5-fold, 2-fold, 3-fold or more compared to resting or non-activated T cells.

(364) 48. The method of embodiment 46 or embodiment 47, wherein the target antigen is not expressed on resting T cells.

(365) 49. A method of producing a genetically engineered immune cell, comprising:

(366) (a) introducing into an immune cell a genetically engineered antigen receptor that specifically binds to a target antigen, wherein the target antigen is BCMA, TACI or BAFF receptor; and

(367) (b) effecting repression of expression of a related antigen in the immune cell, wherein the receptor also binds is suspected of binding to the related antigen, which is related to the target antigen,

(368) thereby producing a genetically engineered immune cell in which expression of the related antigen is repressed,

(369) wherein steps (a) and (b) are carried out simultaneously or sequentially in any order.

(370) 50. The method of embodiment 49, wherein the target antigen is a B cell maturation antigen (BCMA) and the related antigen is a different BCMA family member.

(371) 51. The method of embodiment 50, wherein the BCMA family member is TACI or BAFF-R.

(372) 52. The method of any of embodiments 49-51, wherein the target antigen is a gene product that is not naturally expressed in the cell type of the engineered immune cell and the related antigen is a gene product that is naturally expressed in the cell type of the engineered immune cell.

(373) 53. The method of any of embodiments 40-52, wherein the immune cell is a T cell or an NK cell.

(374) 54. The method of any of embodiments 40-53, wherein the immune cell is a T cell that is a CD4+ or CD8+ T cell.

(375) 55. The method of any of embodiments 49-54, wherein the related antigen is an antigen that is expressed by resting T cells, activated T cells, or both.

(376) 56. The method of any of embodiments 49-55, wherein the related antigen is an antigen expressed by activated T cells and expressed at a reduced level by resting T cells.

(377) 57. The method of embodiment 56, wherein expression of the related antigen by activated T cells is at a level that is more than 50%, 60%, 70%, 80%, 90%, 95% or more and/or 1-fold, 1.5-fold, 2-fold, 3-fold or more compared to resting or non-activated T cells.

(378) 58. The method of embodiment 56 or embodiment 57, wherein the related antigen is not expressed on resting T cells.

(379) 59. The method of any of embodiments 45-48 and 55-58, wherein:

(380) the activated T cells are surface positive for a T cell activation marker selected from the group consisting of HLA-DR, CD25, CD69, CD71, CD40L (CD154) and 4-1BB (CD137) and/or contain intracellular expression of a cytokine selected from the group consisting of IL-2, IFNgamma and TNF-alpha; and/or

(381) the resting T cells are surface negative for a T cell activation marker selected from the group consisting of HLA-DR, CD25, CD69, CD71, CD40L (CD154) and 4-1BB (CD137) or lack intracellular expression of a cytokine selected from the group consisting of IL-2, IFNgamma and TNF-alpha.

(382) 60. The method of any of embodiments 40-59, wherein the effecting in (b) comprises disrupting a gene encoding the target antigen or the related antigen.

(383) 61. The method of embodiment 60, wherein:

(384) the disruption comprises disrupting the gene at the DNA level and/or

(385) the disruption is not reversible; and/or

(386) the disruption is not transient.

(387) 62. The method of embodiment 60 or 61, wherein the disruption comprises introducing into the immune cell a DNA binding protein or DNA-binding nucleic acid that specifically binds to or hybridizes to the gene.

(388) 63. The method of embodiment 62, wherein the disruption comprises introducing: (a) a fusion protein comprising a DNA-targeting protein and a nuclease or (b) an RNA-guided nuclease.

(389) 64. The method of embodiment 63, wherein the DNA-targeting protein or RNA-guided nuclease comprises a zinc finger protein (ZFP), a TAL protein, or a clustered regularly interspaced short palindromic nucleic acid (CRISPR) specific for the gene.

(390) 65. The method of any of embodiments 40-64, wherein the disruption comprises introducing a zinc finger nuclease (ZFN), a TAL-effector nuclease (TALEN), or and a CRISPR-Cas9 combination that specifically binds to, recognizes, or hybridizes to the gene.

(391) 66. The method of any of embodiments 40-65, wherein the target antigen is a gene product that is naturally expressed in the immune cell and/or the expression of which is induced by said introduction of said genetically engineered antigen receptor.

(392) 67. The method of any of embodiments 49-65, wherein the target antigen is a gene product that is not naturally expressed in the cell type of the engineered immune cell and the related antigen is a gene product that is naturally expressed in the cell type of the engineered immune cell.

(393) 68. The method of any of embodiments 40-67, wherein said repression reduces expression of the target antigen or the related antigen in the engineered immune cell by at least 50, 60, 70, 80, 90, or 95% as compared to an engineered cell produced by the method in the absence of the repression.

(394) 69. The method of any of embodiments 40-68, wherein the target antigen is expressed in multiple myeloma.

(395) 70. The method of any of embodiments 40-69, further comprising:

(396) (c) introducing into the immune cell another genetically engineered antigen receptor, which is a chimeric costimulatory receptor that specifically binds to another antigen and is capable of inducing a costimulatory signal to the cell, wherein steps (a), (b) and (c) are carried out simultaneously or sequentially in any order.

(397) 71. The method of any of embodiments 40-70, wherein the genetically engineered antigen receptor is a T cell receptor (TCR) or a functional non-TCR antigen recognition receptor.

(398) 72. The method of any of embodiments 40-71, wherein the genetically engineered antigen receptor is a chimeric antigen receptor (CAR).

(399) 73. A cell produced by the method of any of embodiments 40-72.

(400) 74. A method of producing a genetically engineered immune cell, the method comprising:

(401) (a) introducing into an immune cell a first genetically engineered antigen receptor that specifically binds to a first antigen; and

(402) (b) introducing into the immune cell a second genetically engineered antigen receptor, which is a chimeric costimulatory receptor and specifically binds to a second antigen,

(403) thereby producing the engineered immune cell,

(404) wherein the first and second antigens are distinct and at least the first or the second antigen is a universal tumor antigen and (a) and (b) are carried out simultaneously or sequentially in any order.

(405) 75. The method of embodiment 74, wherein the universal tumor antigen is human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53 or cyclin (D1).

(406) 76. The method of embodiment 74 or embodiment 75, wherein the universal tumor antigen is hTERT or survivin.

(407) 77. A method of producing a genetically engineered immune cell, the method comprising:

(408) (a) introducing into an immune cell a first genetically engineered antigen receptor that specifically binds to a first antigen; and

(409) (b) introducing into the immune cell a second genetically engineered antigen receptor, which is a chimeric costimulatory receptor and specifically binds to a second antigen, thereby producing the engineered immune cell,

(410) wherein the first and second antigens are distinct and at least the first or the second antigen is B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI) or B-cell activating factor receptor (BAFF-R) and (a) and (b) are carried out simultaneously or sequentially in any order.

(411) 78. A method of producing a genetically engineered immune cell, the method comprising:

(412) (a) introducing into an immune cell a first genetically engineered antigen receptor that specifically binds to a first antigen; and

(413) (b) introducing into the immune cell a second genetically engineered antigen receptor that specifically binds to a second antigen,

(414) thereby producing the engineered immune cell,

(415) wherein the first and second antigens are distinct and at least the first or the second antigen is B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI) or B-cell activating factor receptor (BAFF-R) and (a) and (b) are carried out simultaneously or sequentially in any order.

(416) 79. The method of any of embodiments 74-78, wherein the other of the first or second antigen is an antigen expressed in a tumor.

(417) 80. The method of any of embodiments 77-79, wherein the first or second antigen is BCMA.

(418) 81. The method of embodiment 80, wherein the other of the first or second antigen is a BCMA-related family member.

(419) 82. The method of embodiment 81, wherein the BCMA-related family member is TACI or BAFF-R.

(420) 83. The method of any of embodiments 78-82, wherein the other of the first or the second antigen is FcRH5, CS1, CD38 or CD138.

(421) 84. The method of any of embodiments 74-83, further comprising (c) effecting repression of expression of the first and/or second antigen in the immune cell.

(422) 85. The method of embodiment 84, wherein effecting repression comprises introducing into the immune cell a DNA binding protein or DNA-binding nucleic acid that specifically binds to or hybridizes to the gene.

(423) 86. The method of embodiment 84 or embodiment 85, wherein effecting repression comprises introducing a D a zinc finger nuclease (ZFN), a TAL-effector nuclease (TALEN), or and a CRISPR-Cas9 combination that specifically binds to, recognizes, or hybridizes to the gene.

(424) 87. The method of any of embodiments 84-86, wherein said repression reduces expression of the target antigen in the engineered immune cell by at least 50, 60, 70, 80, 90, or 95% as compared to an engineered cell produced by the method in the absence of the repression.

(425) 88. A cell produced by the method of any of embodiments 74-87.

(426) 89. An engineered immune cell, comprising:

(427) (a) a first genetically engineered antigen receptor that specifically binds to a first antigen and is capable of inducing an activating signal to the cell; and

(428) (b) a second genetically engineered antigen receptor which is a chimeric costimulatory receptor that specifically binds to a second antigen and is capable of inducing a costimulatory signal to the cell,

(429) wherein the first and second antigens are distinct and at least one of the first or the second antigen is a universal tumor antigen.

(430) 90. The engineered immune cell of embodiment 89, wherein the universal tumor antigen is human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53 or cyclin (D1).

(431) 91. The engineered immune cell of embodiment 89 or embodiment 90, wherein the universal tumor antigen is hTERT or survivin.

(432) 92. An engineered immune cell, comprising:

(433) (a) a first genetically engineered antigen receptor that specifically binds to a first antigen and is capable of inducing an activating signal to the cell; and

(434) (b) a second genetically engineered antigen receptor which is a chimeric costimulatory receptor that specifically binds to a second antigen and is capable of inducing a costimulatory signal to the cell,

(435) wherein the first and second antigens are distinct and at least one of the first or the second antigen is B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI) or B-cell activating factor receptor (BAFF-R).

(436) 93. An engineered immune cell, comprising:

(437) (a) a first genetically engineered antigen receptor that specifically binds to a first antigen; and

(438) (b) a second genetically engineered antigen receptor that specifically binds to a second antigen;

(439) wherein the first and second antigens are distinct and at least one of the first or the second antigen is a B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI) or B-cell activating factor receptor (BAFF-R).

(440) 94. The engineered immune cell of any of embodiments 89-93, wherein the other of the first or second antigen is an antigen expressed in a tumor.

(441) 95. The engineered immune cell of any of embodiments 92-94, wherein the first or second antigen is BCMA.

(442) 96. The engineered immune cell of any of embodiments 92-95, wherein the other of the first or second antigen is a BCMA-related family member.

(443) 97. The engineered immune cell of embodiment 96, wherein the BCMA related family member is TACI or BAFF-R.

(444) 98. The engineered immune cell of any of embodiments 92-95, wherein the other of the first or the second antigen is FcRH5, CS1, CD38 or CD138.

(445) 99. The engineered immune cell of any of embodiments 89-98, wherein the first genetically engineered antigen receptor comprises an ITAM-containing sequence.

(446) 100. The engineered immune cell of embodiment 99, wherein the first genetically engineered antigen receptor comprises an intracellular signaling domain of a CD3-zeta (CD3) chain.

(447) 101. The engineered immune cell of embodiment 99 or embodiment 100, wherein the first genetically engineered antigen receptor does not comprise a signaling domain from a T cell costimulatory molecule.

(448) 102. The engineered immune cell of any of embodiments 89-101, wherein the receptor comprises an intracellular signaling domain of a T cell costimulatory molecule.

(449) 103. The engineered immune cell of embodiment 102, wherein the T cell costimulatory molecule comprises one or more molecules selected from the group consisting of CD28 and 41BB.

(450) 104. The engineered immune cell of any of embodiments89-103, further comprising a disruption in a gene encoding the first antigen, and/or in a gene encoding the second antigen, said disruption resulting in reduced expression of the first and/or second antigen in the engineered immune cell.

(451) 105. The engineered immune cell of embodiment 104, wherein expression of the first and/or second antigen in the engineered immune cell is reduced by at least 50, 60, 70, 80, 90, or 95% as compared to the expression in the immune cell in the absence of said gene disruption.

(452) 106. The engineered immune cell of any of embodiments 89-105, wherein the immune cell is a T cell.

(453) 107. The engineered immune cell of embodiment 106, wherein the immune cell is a CD4+ or CD8+ T cell.

(454) 108. The engineered immune cell of any of embodiments 89-107, wherein the first genetically engineered antigen receptor is a T cell receptor (TCR) or a functional non-TCR antigen recognition receptor.

(455) 109. The engineered immune cell of embodiment 108, wherein the first genetically engineered antigen receptor is a chimeric antigen receptor (CAR).

(456) 110. A pharmaceutical composition comprising the engineered immune cell of any of embodiments 1-39 and any of embodiments 89-109 and a pharmaceutically acceptable carrier.

(457) 111. A composition or combination, comprising:

(458) (a) a first engineered immune cell expressing a first genetically engineered antigen receptor that specifically binds to a first antigen and not expressing a second engineered antigen receptor that specifically binds to a second antigen; and

(459) (b) a second engineered immune cell expressing the genetically engineered antigen receptor,

(460) wherein the first and second antigens are distinct and at least one of the first or the second antigen is a B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI) or B-cell activating factor receptor (BAFF-R).

(461) 112. The composition or combination of embodiment 111, wherein the first or second antigen is BCMA.

(462) 113. The composition or combination of embodiment 112, wherein the other of the first or second antigen is a BCMA-related family member.

(463) 114. The composition or combination of embodiment 113, wherein the BCMA related family member is TACI or BAFF-R.

(464) 115. The composition or combination of embodiment 111 or 112, wherein the other of the first or the second antigen is FcRH5, CS1, CD38 or CD138.

(465) 116. The composition or combination of any of embodiments 111-115 that is a pharmaceutical composition.

(466) 117. A method of treatment, comprising administering to a subject having a disease or condition the cell of any of embodiments 1-39 and 89-109 or the composition or combiantion of any of embodiments 111-116.

(467) 118. The method of embodiment 117, wherein the genetically engineered antigen receptor or receptors specifically binds to an antigen associated with the disease or condition.

(468) 119. The method of embodiment 117 or embodiment 118, wherein the disease or condition is a cancer.

(469) 120. Use of cells of any of embodiments 1-39 and 89-109, the composition of embodiment 110 or the composition or combination of any of embodiments 111-116 in the manufacture of a medicament for use in a method for treating a disease or condition.

(470) 121. A composition of embodiment 110 or the composition or combination of any of embodiments 111-116 for use in treating a disease or condition.

(471) 122. The use of embodiment 120 or composition or combination of embodiment 121, wherein the genetically engineered antigen receptor or receptors specifically bind to an antigen associated with the disease or condition.

(472) 123. The use, composition or combination of embodiment 121 or embodiment 122, wherein the disease or condition is a tumor or a cancer.

V. EXAMPLES

(473) The following examples are included for illustrative purposes only and are not intended to limit the scope of the invention.

Example 1: Assessment of Cytotoxic Activity of T-Cells Engineered With a Chimeric Antigen Receptor (CAR) Specific for hTERT in the Presence or Absence of Endogenous hTERT Repression

(474) Exemplary studies are carried out to assess of T cells expressing an engineered antigen receptor specific for a particular antigen, which is expressed in or on T cells, following repression of the expression of and/or genetic disruption or knockout of such antigen in the T cells. This exemplary study is carried out by disrupting expression of the universal tumor protein antigen, human telomerase reverse transcriptase (hTERT). In other studies, similar methods are carried out by disrupting other antigen targets of interest (in cells expressing a genetically engineered antigen receptor recognizing such antigen), such as other universal protein antigens (e.g. survivin) and/or other antigens of interest including those naturally expressed in T cells and/or activated T cells (e.g. CD38).

(475) T cells are isolated by immunoaffinity-based selection from a human apheresis product sample from a subject expressing the HLA-A*0201 allele, such as, in some cases, a subject having a cancer. The resulting cells are activated using an anti-CD3/anti-CD28 reagent in the presence of IL-2 (100 IU/mL), for example, for 72 hours at 37 C.

(476) The CRISPR/Cas9 technology is used to knock-down gene expression of hTERT in the activated T cells. In an exemplary method, Cas9 nuclease (e.g., encoded by mRNA from Staphylococcus aureus or from Stretpococcus pyogenes, e.g. pCW-Cas9, Addgene #50661, Wang et al. (2014) Science, 3:343-80-4; or nuclease or nickase lentiviral vectors available from Applied Biological Materials (ABM; Canada) as Cat. No. K002, K003, K005 or K006) and hTERT guide RNA (gRNA, e.g. exemplary gRNA vector available from ABM, Cat. No. K0009811) are introduced into cells, for example, using lentiviral delivery vectors or any of a number of known delivery method or vehicle for transfer to cells, such as any of a number of known methods or vehicles for delivering Cas9 molecules and guide RNAs. Non-specific or empty vector control T cells also are generated. Degree of Knockout of hTERT (e.g., 24 to 72 hours after transfer) is assessed using any of a number of well-known assays for assessing gene disruption in cells.

(477) Within 24 to 96 hours after transduction of CRISPR/Cas9 system, cells (hTERT knock-down and control cells) are transduced with an empty vector or with a viral vector encoding an hTERT antigen receptor, such as a T cell receptor (TCR) or an anti-hTERT chimeric TCR-like antibody or binding fragment thereof (e.g. scFv), that specifically bind an hTERT-derived peptide epitope in the context of HLA-A*0201, e.g. as described in U.S. Pat. No. 7,718,777, including antibody binding molecules specific for any of the peptides set forth in SEQ ID NOS: 7, 8 or 10-14. Thus, in total, four groups of cells are generated as follows: 1) hTERT knockout (without genetically engineered receptor); 2) hTERT knockout/genetically engineered hTERT-antigen receptor; 3) hTERT wildtype T cells/genetically engineered hTERT-antigen receptor; and hTERT wildtype (without genetically engineered receptor) (control).

(478) Following the introduction, cells are further cultured, generally at 37 degrees C., for example, to allow for cell expansion. Antigen-induced cytotoxicity and/or activation of cells in the culture of each group is assessed by performing a cell proliferation assay, a chromium release assay, ELISPOT assay for IFN-, granzyme B and/or perforin and/or an assay for cell viability, such as by using CellTiter-Glo (CTG)-assay or other assay that measures proliferation, viability and/or cytotoxicity of cells. The cytotoxicity of cells is compared among the different groups of generated cells. As a positive control for cytotoxicity or activation or other function, cells known to express hTERT and/or to present a peptide derived therefrom recognize by the cell, are included to confirm the hTERT-specific function(s) of the engineered cells assessed.

(479) In additional studies, cells in the various condition groups are administered to animal subjects and their persistence followed over time and compared, to assess impacts of the knockout on self-killing by such cells and persistence of such cells over time, and efficacy in targeting cells expressing the target antigen, such as tumor cells.

(480) Optionally, autologous hTERT knockout/hTERT-antigen specific T cells engineered as above, which are found to avoid or exhibit reduced potential for self-killing in culture, are administered to the subject to treat the cancer at a dosage of, for example, 110.sup.7 cells to 510.sup.10 cells.

Example 2: Assessment of Cytotoxic Activity of T-Cells Engineered With a Chimeric Antigen Receptor (CAR) Specific for a Disease-Specific Target Antigen in the Presence or Absence of Endogenous Repression of Another Related Antigen

(481) Exemplary studies are carried out to assess activities and properties of T cells expressing an engineered antigen receptor specific for a particular disease-specific target antigen that is known to or that may be cross-reactive to a related antigen that shares similarity or epitopes with the target antigen. The T cells are also engineered to effect repression of the expression and/or genetic disruption or knockout of such related antigen in the T cells. Specifically, in one exemplary study, T cells are engineered to express a chimeric antigen receptor (CAR) that specifically binds BCMA and also are disrupted for expression of one or more other related antigens, such as BAFF-R or TACI.

(482) T cells are isolated by immunoaffinity-based selection from a human apheresis product sample from a subject, such as, in some cases, a subject having a cancer. The resulting cells are activated using an anti-CD3/anti-CD28 reagent in the presence of IL-2 (100 IU/mL), for example, for 72 hours at 37 C.

(483) The CRISPR/Cas9 technology is used to knock-down gene expression of BAFF-R or TACI in the activated T cells. In an exemplary method, Cas9 nuclease (e.g., encoded by mRNA from Staphylococcus aureus or from Stretpococcus pyogenes, e.g. pCW-Cas9, Addgene #50661, Wang et al. (2014) Science, 3:343-80-4; or nuclease or nickase lentiviral vectors available from Applied Biological Materials (ABM; Canada) as Cat. No. K002, K003, K005 or K006) and either TACI guide RNA (gRNA, e.g. exemplary reagents available from Origene, Cat. No. KN204672) or BAFF-R guide RNA (gRNA, e.g. exemplary reagents available from Origene, Cat. No. KN211270) are introduced into cells, for example, using lentiviral delivery vectors or any of a number of known delivery method or vehicle for transfer to cells, such as any of a number of known methods or vehicles for delivering Cas9 molecules and guide RNAs. Non-specific or empty vector control T cells also are generated. Degree of Knockout of TACI or BAFF-R (e.g., 24 to 72 hours after transfer) is assessed using any of a number of well-known assays for assessing gene disruption in cells.

(484) Within 24 to 96 hours after transduction of CRISPR/Cas9 system, cells (TACI knockout, BAFF-R knockout and control cells) are transduced with an empty vector or with a viral vector encoding a BCMA-specific antigen receptor, such as chimeric antigen receptor containing an anti-BCMA antibody or binding fragment thereof (e.g. scFv) that specifically binds BCMA. Thus, in total, six groups of cells are generated as follows: 1) TACI knockout (without genetically engineered receptor); 2) TACI knockout/genetically engineered BCMA-specific antigen receptor; 3) BAFF-R knockout (without genetically engineered receptor); 4) BAFF-R knockout/genetically engineered BCMA-specific antigen receptor; 5) wildtype T cells/genetically engineered BCMA-specific antigen receptor; and 6) wildtype cells (without genetically engineered receptor) (control).

(485) Following the introduction, cells are further cultured, generally at 37 degrees C., for example, to allow for cell expansion. Antigen-induced cytotoxicity and/or activation of cells in the culture of each group is assessed by performing a cell proliferation assay, a chromium release assay, ELISPOT assay for IFN-, granzyme B and/or perforin and/or an assay for cell viability, such as by using CellTiter-Glo (CTG)-assay or other assay that measures proliferation, viability and/or cytotoxicity of cells. The cytotoxicity of cells is compared among the different groups of generated cells. As a positive control for cytotoxicity or activation or other function, cells known to express BCMA are included to confirm the BCMA-specific function(s) of the engineered cells assessed.

(486) In additional studies, cells in the various condition groups are administered to animal subjects and their persistence followed over time and compared, to assess impacts of the knockout on self-killing by such cells and persistence of such cells over time, and efficacy in targeting cells expressing the target antigen, such as tumor cells.

(487) Optionally, autologous TACI and/or BAFF-R knockout and BCMA-specific antigen specific T cells engineered as above, which are found to avoid or exhibit reduced potential for self-killing in culture, are administered to the subject to treat the cancer at a dosage of, for example, 110.sup.7 cells to 510.sup.10 cells.

(488) The present invention is not to be limited in scope by the embodiments disclosed herein, which are intended as single illustrations of individual aspects of the invention, and any that are functionally equivalent are within the scope of the invention. Various modifications to the compositions and methods of the invention, in addition to those described herein, will become apparent to those skilled in the art from the foregoing description and teachings, and are similarly intended to fall within the scope of the invention. Such modifications or other embodiments can be practiced without departing from the true scope and spirit of the invention.

(489) TABLE-US-00001 SEQUENCETABLE SEQ ID NO: Type Sequence Description 1 Protein mancefspvsgdkpccrlsrraqlclgvsilvlilvvvla CD38; vvvprwrqqwsgpgttkrfpetvlarcvkyteihpemrhv GenBank: dcqsvwdafkgafiskhpcniteedyqplmklgtqtvpcn BAA18966 killwsrikdlahqftqvqrdmftledtllgyladdltwc gefntskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaa cdvvhvmlngsrskifdknstfgsvevhnlqpekvqtlea wvihggredsrdlcqdptikelesiiskrniqfsckniyr pdkflqcvknpedssctsei 2 Nucleotide AGTGAAACAGAAGGGGAGGTGCAGTTTCAGAACCCAGCCAGCCTCTCTC CD38; TTGCTGCCTAGCCTCCTGCCG GenBank GCCTCATCTTCGCCCAGCCAACCCCGCCTGGAGCCCTATGGCCAACTGC NM_001775.2 GAGTTCAGCCCGGTGTCCGGG GACAAACCCTGCTGCCGGCTCTCTAGGAGAGCCCAACTCTGTCTTGGCG TCAGTATCCTGGTCCTGATCC TCGTCGTGGTGCTCGCGGTGGTCGTCCCGAGGTGGCGCCAGCAGTGGAG CGGTCCGGGCACCACCAAGCG CTTTCCCGAGACCGTCCTGGCGCGATGCGTCAAGTACACTGAAATTCAT CCTGAGATGAGACATGTAGAC TGCCAAAGTGTATGGGATGCTTTCAAGGGTGCATTTATTTCAAAACATC CTTGCAACATTACTGAAGAAG ACTATCAGCCACTAATGAAGTTGGGAACTCAGACCGTACCTTGCAACAA GATTCTTCTTTGGAGCAGAAT AAAAGATCTGGCCCATCAGTTCACACAGGTCCAGCGGGACATGTTCACC CTGGAGGACACGCTGCTAGGC TACCTTGCTGATGACCTCACATGGTGTGGTGAATTCAACACTTCCAAAA TAAACTATCAATCTTGCCCAG ACTGGAGAAAGGACTGCAGCAACAACCCTGTTTCAGTATTCTGGAAAAC GGTTTCCCGCAGGTTTGCAGA AGCTGCCTGTGATGTGGTCCATGTGATGCTCAATGGATCCCGCAGTAAA ATCTTTGACAAAAACAGCACT TTTGGGAGTGTGGAAGTCCATAATTTGCAACCAGAGAAGGTTCAGACAC TAGAGGCCTGGGTGATACATG GTGGAAGAGAAGATTCCAGAGACTTATGCCAGGATCCCACCATAAAAGA GCTGGAATCGATTATAAGCAA AAGGAATATTCAATTTTCCTGCAAGAATATCTACAGACCTGACAAGTTT CTTCAGTGTGTGAAAAATCCT GAGGATTCATCTTGCACATCTGAGATCTGAGCCAGTCGCTGTGGTTGTT TTAGCTCCTTGACTCCTTGTG GTTTATGTCATCATACATGACTCAGCATACCTGCTGGTGCAGAGCTGAA GATTTTGGAGGGTCCTCCACA ATAAGGTCAATGCCAGAGACGGAAGCCTTTTTCCCCAAAGTCTTAAAAT AACTTATATCATCAGCATACC TTTATTGTGATCTATCAATAGTCAAGAAAAATTATTGTATAAGATTAGA ATGAAAATTGTATGTTAAGTT ACTTCACTTTAATTCTCATGTGATCCTTTTATGTTATTTATATATTGGT AACATCCTTTCTATTGAAAAA TCACCACACCAAACCTCTCTTATTAGAACAGGCAAGTGAAGAAAAGTGA ATGCTCAAGTTTTTCAGAAAG CATTACATTTCCAAATGAATGACCTTGTTGCATGATGTATTTTTGTACC CTTCCTACAGATAGTCAAACC ATAAACTTCATGGTCATGGGTAAA 3 Protein MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRA Telomerase LVAQCLVCVPWDARPPPAAPS reverse FRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSV transcriptase RSYLPNTVTDALRGSGAWGLL (hTERT); LRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPH GenBank ASGPRRRLGCERAWNHSVREA NP_937983.2 GVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHP GRTRGPSDRGFCVVSPARPAE EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETK HFLYSSGDKEQLRPSFLLSSL RPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGN HAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACL RRLVPPGLWGSRHNERRFLRN TKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREE ILAKFLHWLMSVYVVELLRSF FYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQH REARPALLTSRLRFIPKPDGL RPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGAS VLGLDDIHRAWRTFVLRVRAQ DPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQK AAHGHVRKAFKSHVSTLTDLQ PYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVR IRGKSYVQCQGIPQGSILSTL LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVR GVPEYGCVVNLRKTVVNFPVE DEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLT FNRGFKAGRNMRRKLFGVLRL KCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNP TFFLRVISDTASLCYSILKAK NAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTA QTQLSRKLPGTTLTALEAAAN PALPSDFKTILD 4 Nucleotide CAGGCAGCGCTGCGTCCTGCTGCGCACGTGGGAAGCCCTGGCCCCGGCC telomerase ACCCCCGCGATGCCGCGCGCT reverse CCCCGCTGCCGAGCCGTGCGCTCCCTGCTGCGCAGCCACTACCGCGAGG transcriptase TGCTGCCGCTGGCCACGTTCG (hTERT), TGCGGCGCCTGGGGCCCCAGGGCTGGCGGCTGGTGCAGCGCGGGGACCC GenBank GGCGGCTTTCCGCGCGCTGGT NM_198253.2 GGCCCAGTGCCTGGTGTGCGTGCCCTGGGACGCACGGCCGCCCCCCGCC GCCCCCTCCTTCCGCCAGGTG TCCTGCCTGAAGGAGCTGGTGGCCCGAGTGCTGCAGAGGCTGTGCGAGC GCGGCGCGAAGAACGTGCTGG CCTTCGGCTTCGCGCTGCTGGACGGGGCCCGCGGGGGCCCCCCCGAGGC CTTCACCACCAGCGTGCGCAG CTACCTGCCCAACACGGTGACCGACGCACTGCGGGGGAGCGGGGCGTGG GGGCTGCTGCTGCGCCGCGTG GGCGACGACGTGCTGGTTCACCTGCTGGCACGCTGCGCGCTCTTTGTGC TGGTGGCTCCCAGCTGCGCCT ACCAGGTGTGCGGGCCGCCGCTGTACCAGCTCGGCGCTGCCACTCAGGC CCGGCCCCCGCCACACGCTAG TGGACCCCGAAGGCGTCTGGGATGCGAACGGGCCTGGAACCATAGCGTC AGGGAGGCCGGGGTCCCCCTG GGCCTGCCAGCCCCGGGTGCGAGGAGGCGCGGGGGCAGTGCCAGCCGAA GTCTGCCGTTGCCCAAGAGGC CCAGGCGTGGCGCTGCCCCTGAGCCGGAGCGGACGCCCGTTGGGCAGGG GTCCTGGGCCCACCCGGGCAG GACGCGTGGACCGAGTGACCGTGGTTTCTGTGTGGTGTCACCTGCCAGA CCCGCCGAAGAAGCCACCTCT TTGGAGGGTGCGCTCTCTGGCACGCGCCACTCCCACCCATCCGTGGGCC GCCAGCACCACGCGGGCCCCC CATCCACATCGCGGCCACCACGTCCCTGGGACACGCCTTGTCCCCCGGT GTACGCCGAGACCAAGCACTT CCTCTACTCCTCAGGCGACAAGGAGCAGCTGCGGCCCTCCTTCCTACTC AGCTCTCTGAGGCCCAGCCTG ACTGGCGCTCGGAGGCTCGTGGAGACCATCTTTCTGGGTTCCAGGCCCT GGATGCCAGGGACTCCCCGCA GGTTGCCCCGCCTGCCCCAGCGCTACTGGCAAATGCGGCCCCTGTTTCT GGAGCTGCTTGGGAACCACGC GCAGTGCCCCTACGGGGTGCTCCTCAAGACGCACTGCCCGCTGCGAGCT GCGGTCACCCCAGCAGCCGGT GTCTGTGCCCGGGAGAAGCCCCAGGGCTCTGTGGCGGCCCCCGAGGAGG AGGACACAGACCCCCGTCGCC TGGTGCAGCTGCTCCGCCAGCACAGCAGCCCCTGGCAGGTGTACGGCTT CGTGCGGGCCTGCCTGCGCCG GCTGGTGCCCCCAGGCCTCTGGGGCTCCAGGCACAACGAACGCCGCTTC CTCAGGAACACCAAGAAGTTC ATCTCCCTGGGGAAGCATGCCAAGCTCTCGCTGCAGGAGCTGACGTGGA AGATGAGCGTGCGGGACTGCG CTTGGCTGCGCAGGAGCCCAGGGGTTGGCTGTGTTCCGGCCGCAGAGCA CCGTCTGCGTGAGGAGATCCT GGCCAAGTTCCTGCACTGGCTGATGAGTGTGTACGTCGTCGAGCTGCTC AGGTCTTTCTTTTATGTCACG GAGACCACGTTTCAAAAGAACAGGCTCTTTTTCTACCGGAAGAGTGTCT GGAGCAAGTTGCAAAGCATTG GAATCAGACAGCACTTGAAGAGGGTGCAGCTGCGGGAGCTGTCGGAAGC AGAGGTCAGGCAGCATCGGGA AGCCAGGCCCGCCCTGCTGACGTCCAGACTCCGCTTCATCCCCAAGCCT GACGGGCTGCGGCCGATTGTG AACATGGACTACGTCGTGGGAGCCAGAACGTTCCGCAGAGAAAAGAGGG CCGAGCGTCTCACCTCGAGGG TGAAGGCACTGTTCAGCGTGCTCAACTACGAGCGGGCGCGGCGCCCCGG CCTCCTGGGCGCCTCTGTGCT GGGCCTGGACGATATCCACAGGGCCTGGCGCACCTTCGTGCTGCGTGTG CGGGCCCAGGACCCGCCGCCT GAGCTGTACTTTGTCAAGGTGGATGTGACGGGCGCGTACGACACCATCC CCCAGGACAGGCTCACGGAGG TCATCGCCAGCATCATCAAACCCCAGAACACGTACTGCGTGCGTCGGTA TGCCGTGGTCCAGAAGGCCGC CCATGGGCACGTCCGCAAGGCCTTCAAGAGCCACGTCTCTACCTTGACA GACCTCCAGCCGTACATGCGA CAGTTCGTGGCTCACCTGCAGGAGACCAGCCCGCTGAGGGATGCCGTCG TCATCGAGCAGAGCTCCTCCC TGAATGAGGCCAGCAGTGGCCTCTTCGACGTCTTCCTACGCTTCATGTG CCACCACGCCGTGCGCATCAG GGGCAAGTCCTACGTCCAGTGCCAGGGGATCCCGCAGGGCTCCATCCTC TCCACGCTGCTCTGCAGCCTG TGCTACGGCGACATGGAGAACAAGCTGTTTGCGGGGATTCGGCGGGACG GGCTGCTCCTGCGTTTGGTGG ATGATTTCTTGTTGGTGACACCTCACCTCACCCACGCGAAAACCTTCCT CAGGACCCTGGTCCGAGGTGT CCCTGAGTATGGCTGCGTGGTGAACTTGCGGAAGACAGTGGTGAACTTC CCTGTAGAAGACGAGGCCCTG GGTGGCACGGCTTTTGTTCAGATGCCGGCCCACGGCCTATTCCCCTGGT GCGGCCTGCTGCTGGATACCC GGACCCTGGAGGTGCAGAGCGACTACTCCAGCTATGCCCGGACCTCCAT CAGAGCCAGTCTCACCTTCAA CCGCGGCTTCAAGGCTGGGAGGAACATGCGTCGCAAACTCTTTGGGGTC TTGCGGCTGAAGTGTCACAGC CTGTTTCTGGATTTGCAGGTGAACAGCCTCCAGACGGTGTGCACCAACA TCTACAAGATCCTCCTGCTGC AGGCGTACAGGTTTCACGCATGTGTGCTGCAGCTCCCATTTCATCAGCA AGTTTGGAAGAACCCCACATT TTTCCTGCGCGTCATCTCTGACACGGCCTCCCTCTGCTACTCCATCCTG AAAGCCAAGAACGCAGGGATG TCGCTGGGGGCCAAGGGCGCCGCCGGCCCTCTGCCCTCCGAGGCCGTGC AGTGGCTGTGCCACCAAGCAT TCCTGCTCAAGCTGACTCGACACCGTGTCACCTACGTGCCACTCCTGGG GTCACTCAGGACAGCCCAGAC GCAGCTGAGTCGGAAGCTCCCGGGGACGACGCTGACTGCCCTGGAGGCC GCAGCCAACCCGGCACTGCCC TCAGACTTCAAGACCATCCTGGACTGATGGCCACCCGCCCACAGCCAGG CCGAGAGCAGACACCAGCAGC CCTGTCACGCCGGGCTCTACGTCCCAGGGAGGGAGGGGCGGCCCACACC CAGGCCCGCACCGCTGGGAGT CTGAGGCCTGAGTGAGTGTTTGGCCGAGGCCTGCATGTCCGGCTGAAGG CTGAGTGTCCGGCTGAGGCCT GAGCGAGTGTCCAGCCAAGGGCTGAGTGTCCAGCACACCTGCCGTCTTC ACTTCCCCACAGGCTGGCGCT CGGCTCCACCCCAGGGCCAGCTTTTCCTCACCAGGAGCCCGGCTTCCAC TCCCCACATAGGAATAGTCCA TCCCCAGATTCGCCATTGTTCACCCCTCGCCCTGCCCTCCTTTGCCTTC CACCCCCACCATCCAGGTGGA GACCCTGAGAAGGACCCTGGGAGCTCTGGGAATTTGGAGTGACCAAAGG TGTGCCCTGTACACAGGCGAG GACCCTGCACCTGGATGGGGGTCCCTGTGGGTCAAATTGGGGGGAGGTG CTGTGGGAGTAAAATACTGAA TATATGAGTTTTTCAGTTTTGAAAAAAA 5 Protein MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTE BIRC5 NEPDLAQCFFCFKELEGWEPD (survivin) DDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNN GenBank KKKEFEETAEKVRRAIEQLAA NP_001159 MD 6 Nucleotide CCCAGAAGGCCGCGGGGGGTGGACCGCCTAAGAGGGCGTGCGCTCCCGA BIRC5 CATGCCCCGCGGCGCGCCATT (survivin) AACCGCCAGATTTGAATCGCGGGACCCGTTGGCAGAGGTGGCGGCGGCG GenBank GCATGGGTGCCCCGACGTTGC NM_001168.2 CCCCTGCCTGGCAGCCCTTTCTCAAGGACCACCGCATCTCTACATTCAA GAACTGGCCCTTCTTGGAGGG CTGCGCCTGCACCCCGGAGCGGATGGCCGAGGCTGGCTTCATCCACTGC CCCACTGAGAACGAGCCAGAC TTGGCCCAGTGTTTCTTCTGCTTCAAGGAGCTGGAAGGCTGGGAGCCAG ATGACGACCCCATAGAGGAAC ATAAAAAGCATTCGTCCGGTTGCGCTTTCCTTTCTGTCAAGAAGCAGTT TGAAGAATTAACCCTTGGTGA ATTTTTGAAACTGGACAGAGAAAGAGCCAAGAACAAAATTGCAAAGGAA ACCAACAATAAGAAGAAAGAA TTTGAGGAAACTGCGGAGAAAGTGCGCCGTGCCATCGAGCAGCTGGCTG CCATGGATTGAGGCCTCTGGC CGGAGCTGCCTGGTCCCAGAGTGGCTGCACCACTTCCAGGGTTTATTCC CTGGTGCCACCAGCCTTCCTG TGGGCCCCTTAGCAATGTCTTAGGAAAGGAGATCAACATTTTCAAATTA GATGTTTCAACTGTGCTCTTG TTTTGTCTTGAAAGTGGCACCAGAGGTGCTTCTGCCTGTGCAGCGGGTG CTGCTGGTAACAGTGGCTGCT TCTCTCTCTCTCTCTCTTTTTTGGGGGCTCATTTTTGCTGTTTTGATTC CCGGGCTTACCAGGTGAGAAG TGAGGGAGGAAGAAGGCAGTGTCCCTTTTGCTAGAGCTGACAGCTTTGT TCGCGTGGGCAGAGCCTTCCA CAGTGAATGTGTCTGGACCTCATGTTGTTGAGGCTGTCACAGTCCTGAG TGTGGACTTGGCAGGTGCCTG TTGAATCTGAGCTGCAGGTTCCTTATCTGTCACACCTGTGCCTCCTCAG AGGACAGTTTTTTTGTTGTTG TGTTTTTTTGTTTTTTTTTTTTTGGTAGATGCATGACTTGTGTGTGATG AGAGAATGGAGACAGAGTCCC TGGCTCCTCTACTGTTTAACAACATGGCTTTCTTATTTTGTTTGAATTG TTAATTCACAGAATAGCACAA ACTACAATTAAAACTAAGCACAAAGCCATTCTAAGTCATTGGGGAAACG GGGTGAACTTCAGGTGGATGA GGAGACAGAATAGAGTGATAGGAAGCGTCTGGCAGATACTCCTTTTGCC ACTGCTGTGTGATTAGACAGG CCCAGTGAGCCGCGGGGCACATGCTGGCCGCTCCTCCCTCAGAAAAAGG CAGTGGCCTAAATCCTTTTTA AATGACTTGGCTCGATGCTGTGGGGGACTGGCTGGGCTGCTGCAGGCCG TGTGTCTGTCAGCCCAACCTT CACATCTGTCACGTTCTCCACACGGGGGAGAGACGCAGTCCGCCCAGGT CCCCGCTTTCTTTGGAGGCAG CAGCTCCCGCAGGGCTGAAGTCTGGCGTAAGATGATGGATTTGATTCGC CCTCCTCCCTGTCATAGAGCT GCAGGGTGGATTGTTACAGCTTCGCTGGAAACCTCTGGAGGTCATCTCG GCTGTTCCTGAGAAATAAAAA GCCTGTCATTTCAAACACTGCTGTGGACCCTACTGGGTTTTTAAAATAT TGTCAGTTTTTCATCGTCGTC CCTAGCCTGCCAACAGCCATCTGCCCAGACAGCCGCAGTGAGGATGAGC GTCCTGGCAGAGACGCAGTTG TCTCTGGGCGCTTGCCAGAGCCACGAACCCCAGACCTGTTTGTATCATC CGGGCTCCTTCCGGGCAGAAA CAACTGAAAATGCACTTCAGACCCACTTATTTCTGCCACATCTGAGTCG GCCTGAGATAGACTTTTCCCT CTAAACTGGGAGAATATCACAGTGGTTTTTGTTAGCAGAAAATGCACTC CAGCCTCTGTACTCATCTAAG CTGCTTATTTTTGATATTTGTGTCAGTCTGTAAATGGATACTTCACTTT AATAACTGTTGCTTAGTAATT GGCTTTGTAGAGAAGCTGGAAAAAAATGGTTTTGTCTTCAACTCCTTTG CATGCCAGGCGGTGATGTGGA TCTCGGCTTCTGTGAGCCTGTGCTGTGGGCAGGGCTGAGCTGGAGCCGC CCCTCTCAGCCCGCCTGCCAC GGCCTTTCCTTAAAGGCCATCCTTAAAACCAGACCCTCATGGCTACCAG CACCTGAAAGCTTCCTCGACA TCTGTTAATAAAGCCGTAGGCCCTTGTCTAAGTGCAACCGCCTAGACTT TCTTTCAGATACATGTCCACA TGTCCATTTTTCAGGTTCTCTAAGTTGGAGTGGAGTCTGGGAAGGGTTG TGAATGAGGCTTCTGGGCTAT GGGTGAGGTTCCAATGGCAGGTTAGAGCCCCTCGGGCCAACTGCCATCC TGGAAAGTAGAGACAGCAGTG CCCGCTGCCCAGAAGAGACCAGCAAGCCAAACTGGAGCCCCCATTGCAG GCTGTCGCCATGTGGAAAGAG TAACTCACAATTGCCAATAAAGTCTCATGTGGTTTTATCTAAAAAAAAA AAAAAAAAAAAAAAAA 7 ILAKFLHWL hTERT peptide T540HLA- A*0201 8 RLVDDFLLV hTERT peptide peptide T865HLA- A*0201 9 YAETKHFLY hTERT 325-333 HLA-A*0101 10 ALLTSRLRFI hTERT 615-624 HLA-A*0201 11 GLLGASVLGL hTERT 674-683 HLA-A*0201 12 ILAKFLHWL hTERT 540-548 HLA-A*0201 13 RLTSRVKAL hTERT 653-661 HLA-A*0201 14 YLQVNSLQTV hTERT 988-997 HLA-A*0201 15 KLFGVLRLK hTERT 973-981 HLA-A*0301 16 VYAETKHFL hTERT 324-332 HLA-A*2402 17 VYGFVRACL hTERT 461-469 HLA-A*2402 18 APRCRAVRSL hTERT4-13 HLA-B*0702 19 APSFRQVSCL hTERT68-77 HLA-B*0702 20 MAEAGFIHY Survivin 38-46(mod) HLA- A*01:01 21 PTENEPDLAY Survivin 47-56 (mod) HLA-A*01:01 22 ELTLGEFLKL Survivin 95-104 HLA-A*02:01 23 LMLGEFLKL Survivin 96-104 (mod) HLA-A*02:01 24 TLPPAWQPFL Survivin 5-14 HLA-A*02:01 25 RISTFKNWPK Survivin 18-27 (modK) HLA-A*03:01 26 DLAQCFFCFK Survivin 56-62 HLA-A*11:01 27 AYACNTSTL Survivin 80-88 HLA-A*24:02 28 STFKNWPFL Survivin 20-28 HLA-A*24:02 29 LPPAWQPFL Survivin 6-14 HLA-B*07:02 30 EPDLAQCFY Survivin 51-59 HLA-B*35:01 31 Protein MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSV BCMA KGTNAILWTCLGLSLIISLAV (TNFRSF17) FVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGL GenBank EYTVEECTCEDCIKSKPKVDS NP_001183.2 DHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR 32 Nucleotide AAGACTCAAACTTAGAAACTTGAATTAGATGTGGTATTCAAATCCTTAG BCMA CTGCCGCGAAGACACAGACAG (TNFRSF17) CCCCCGTAAGAACCCACGAAGCAGGCGAAGTTCATTGTTCTCAACATTC GenBank TAGCTGCTCTTGCTGCATTTG NM_001192 CTCTGGAATTCTTGTAGAGATATTACTTGTCCTTCCAGGCTGTTCTTTC TGTAGCTCCCTTGTTTTCTTT TTGTGATCATGTTGCAGATGGCTGGGCAGTGCTCCCAAAATGAATATTT TGACAGTTTGTTGCATGCTTG CATACCTTGTCAACTTCGATGTTCTTCTAATACTCCTCCTCTAACATGT CAGCGTTATTGTAATGCAAGT GTGACCAATTCAGTGAAAGGAACGAATGCGATTCTCTGGACCTGTTTGG GACTGAGCTTAATAATTTCTT TGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAACTCTGAACC ATTAAAGGACGAGTTTAAAAA CACAGGATCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGC AGGACTGGTGATGAAATTATT CTTCCGAGAGGCCTCGAGTACACGGTGGAAGAATGCACCTGTGAAGACT GCATCAAGAGCAAACCGAAGG TCGACTCTGACCATTGCTTTCCACTCCCAGCTATGGAGGAAGGCGCAAC CATTCTTGTCACCACGAAAAC GAATGACTATTGCAAGAGCCTGCCAGCTGCTTTGAGTGCTACGGAGATA GAGAAATCAATTTCTGCTAGG TAATTAACCATTTCGACTCGAGCAGTGCCACTTTAAAAATCTTTTGTCA GAATAGATGATGTGTCAGATC TCTTTAGGATGACTGTATTTTTCAGTTGCCGATACAGCTTTTTGTCCTC TAACTGTGGAAACTCTTTATG TTAGATATATTTCTCTAGGTTACTGTTGGGAGCTTAATGGTAGAAACTT CCTTGGTTTCATGATTAAACT CTTTTTTTTCCTGA 33 Protein MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMS TACI CKTICNHQSQRTCAAFCRSLS (TNFRSF13B) CRKEQGKEYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELR GenBank RQRSGEVENNSDNSGRYQGLE NP_036584.1 HRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKR GDPCSCQPRSRPRQSPAKSSQ DHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRW GCHTRTTVLQPCPHIPDSGLG IVCVPAQEGGPGA 34 Nucleotide AGCATCCTGAGTAATGAGTGGCCTGGGCCGGAGCAGGCGAGGTGGCCGG TACI AGCCGTGTGGACCAGGAGGAG (TNFRSF13B) CGCTTTCCACAGGGCCTGTGGACGGGGGTGGCTATGAGATCCTGCCCCG GenBank AAGAGCAGTACTGGGATCCTC NM_012452.2 TGCTGGGTACCTGCATGTCCTGCAAAACCATTTGCAACCATCAGAGCCA GCGCACCTGTGCAGCCTTCTG CAGGTCACTCAGCTGCCGCAAGGAGCAAGGCAAGTTCTATGACCATCTC CTGAGGGACTGCATCAGCTGT GCCTCCATCTGTGGACAGCACCCTAAGCAATGTGCATACTTCTGTGAGA ACAAGCTCAGGAGCCCAGTGA ACCTTCCACCAGAGCTCAGGAGACAGCGGAGTGGAGAAGTTGAAAACAA TTCAGACAACTCGGGAAGGTA CCAAGGATTGGAGCACAGAGGCTCAGAAGCAAGTCCAGCTCTCCCGGGG CTGAAGCTGAGTGCAGATCAG GTGGCCCTGGTCTACAGCACGCTGGGGCTCTGCCTGTGTGCCGTCCTCT GCTGCTTCCTGGTGGCGGTGG CCTGCTTCCTCAAGAAGAGGGGGGATCCCTGCTCCTGCCAGCCCCGCTC AAGGCCCCGTCAAAGTCCGGC CAAGTCTTCCCAGGATCACGCGATGGAAGCCGGCAGCCCTGTGAGCACA TCCCCCGAGCCAGTGGAGACC TGCAGCTTCTGCTTCCCTGAGTGCAGGGCGCCCACGCAGGAGAGCGCAG TCACGCCTGGGACCCCCGACC CCACTTGTGCTGGAAGGTGGGGGTGCCACACCAGGACCACAGTCCTGCA GCCTTGCCCACACATCCCAGA CAGTGGCCTTGGCATTGTGTGTGTGCCTGCCCAGGAGGGGGGCCCAGGT GCATAAATGGGGGTCAGGGAG GGAAAGGAGGAGGGAGAGAGATGGAGAGGAGGGGAGAGAGAAAGAGAGG TGGGGAGAGGGGAGAGAGATA TGAGGAGAGAGAGACAGAGGAGGCAGAGAGGGAGAGAAACAGAGGAGAC AGAGAGGGAGAGAGAGACAGA GGGAGAGAGAGACAGAGGGGAAGAGAGGCAGAGAGGGAAAGAGGCAGAG AAGGAAAGAGACAGGCAGAGA AGGAGAGAGGCAGAGAGGGAGAGAGGCAGAGAGGGAGAGAGGCAGAGAG ACAGAGAGGGAGAGAGGGACA GAGAGAGATAGAGCAGGAGGTCGGGGCACTCTGAGTCCCAGTTCCCAGT GCAGCTGTAGGTCGTCATCAC CTAACCACACGTGCAATAAAGTCCTCGTGCCTGCTGCTCACAGCCCCCG AGAGCCCCTCCTCCTGGAGAA TAAAACCTTTGGCAGCTGCCCTTCCTCAAAAAAAAAAAAAAAAAAAA 35 MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGAS BAFF SPAPRTALQPQESVGAGAGEA Receptor ALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDG (TNFRSF13C) DKDAPEPLDKVIILSPGISDA GenBank TAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ NP_443177.1 36 AGCTCAGCCTCAGTCCCCGCAGCTTGTGCGGCGGCGTCGGCACCATGAG BAFF GCGAGGGCCCCGGAGCCTGCG Receptor GGGCAGGGACGCGCCAGCCCCCACGCCCTGCGTCCCGGCCGAGTGCTTC (TNFRSF13C) GACCTGCTGGTCCGCCACTGC GenBank GTGGCCTGCGGGCTCCTGCGCACGCCGCGGCCGAAACCGGCCGGGGCCA NM_012452.2 GCAGCCCTGCGCCCAGGACGG CGCTGCAGCCGCAGGAGTCGGTGGGCGCGGGGGCCGGCGAGGCGGCGCT GCCCCTGCCCGGGCTGCTCTT TGGCGCCCCCGCGCTGCTGGGCCTGGCACTGGTCCTGGCGCTGGTCCTG GTGGGTCTGGTGAGCTGGAGG CGGCGACAGCGGCGGCTTCGCGGCGCGTCCTCCGCAGAGGCCCCCGACG GAGACAAGGACGCCCCAGAGC CCCTGGACAAGGTCATCATTCTGTCTCCGGGAATCTCTGATGCCACAGC TCCTGCCTGGCCTCCTCCTGG GGAAGACCCAGGAACCACCCCACCTGGCCACAGTGTCCCTGTGCCAGCC ACAGAGCTGGGCTCCACTGAA CTGGTGACCACCAAGACGGCCGGCCCTGAGCAACAATAGCAGGGAGCCG GCAGGAGGTGGCCCCTGCCCT CCCTCTGGACCCCCAGCCAGGGGCTTGGAAATCAAATTCAGCTCTTCAC TCCAGCATGCACATGCCCTCT TTCTGGGACCAGGCTAACTCTGCAGAAGCACAGACACTACAGACCACAG CATTCAGCCCCCATGGAGTTT GGTGTGCTTGCCTTTGGCTTCAGACCTCACCATCTTTGACAGCCCTTGA AGGTGGTAGCCCAGCTCCTGT TCCTGTGCCTTCAAAAGGCTGGGGCACTATGAGTAAAAGACCGCTTTTA AAATGGGGAAGGCACCATTAA GCCAAAATGAATCTGAAAAAAGAC 37 CAATGGTCAGAGTCGACCTT BCMA CRISPR guideRNA 38 ATTCTTCCACCGTGTACTCG BCMA CRISPR guideRNA 39 CAATAACGCTGACATGTTAG BCMA CRISPR guideRNA 40 TATTAAGCTCAGTCCCAAAC BCMA CRISPR guideRNA 41 GGTGTGACCAATTCAGTGAA BCMA CRISPR guideRNA 42 GAAGAACATCGAAGTTGACA BCMA CRISPR guideRNA 43 TCATAGCCACCCCCGTCCAC TACI CRISPR guideRNA 44 CCAGTACTGCTCTTCGGGGC TACI CRISPR guideRNA 45 AGTTCTATGACCATCTCCTG TACI CRISPR guideRNA 46 AGGGTCACTCAGCTGCCGCA TACI CRISPR guideRNA 47 GCTACTCACAGCGCTCCTCC TACI CRISPR guideRNA 48 TCCGGCCACCTCGCCTGCTC TACI CRISPR guideRNA 49 CCCTTACCCGGTTTCGGCCG BAFF receptor CRISPR guideRNA 50 GCGTCGGCACCATGAGGCGA BAFF receptor CRISPR guideRNA 51 CTCACCGTCCTTGTCTCCGT BAFF receptor CRISPR guideRNA 52 TCGCGGCGCGTCCTCCGCAG BAFF receptor CRISPR guideRNA 53 TGAACTGGTGACCACCAAGA BAFF receptor CRISPR guideRNA 54 CTTGGTGGTCACCAGTTCAG BAFF receptor CRISPR guideRNA 55 Protein MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRF FcRH5 YSPQKTKWYHRYLGKEILRET GenBank PDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSV NP_112571.2 VLRCRAKAEVTLNNTIYKNDN VLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPF TRPVLRASSFQPISGNPVTLT CETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYW CKAATMPYSVISDSPRSWIQV QIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLR HKSVRCERGASISFSLTTENS GNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTL HCEAQRGSLPILYQFHHEGAA LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVP VSHPVLTLSSAEALTFEGATV TLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNY YCTADNGFGPQRSEVVSLFVT VPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGS SSAPSGGEASFNLSLTAEHSG NYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELH CEALRGSSPILYWFYHEDVTL GKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPV SRPVLTLRAPGTHAAVGDLLE LHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSC EADNGLGAQRSETVTLYITGL TANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSP SDSDSQEPTYHNVPAWEELQP VYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKV ASTPVSGSLFLASSAPHR 56 Nucleotide AATTCACTAATGCATTCTGCTCTTTTTGAGAGCACAGCTTCTCAGATGT FcRH5 GCTCCTTGGAGCTGGTGTGCA GenBank GTGTCCTGACTGTAAGATCAAGTCCAAACCTGTTTTGGAATTGAGGAAA NM_0031281.2 CTTCTCTTTTGATCTCAGCCC TTGGTGGTCCAGGTCTTCATGCTGCTGTGGGTGATATTACTGGTCCTGG CTCCTGTCAGTGGACAGTTTG CAAGGACACCCAGGCCCATTATTTTCCTCCAGCCTCCATGGACCACAGT CTTCCAAGGAGAGAGAGTGAC CCTCACTTGCAAGGGATTTCGCTTCTACTCACCACAGAAAACAAAATGG TACCATCGGTACCTTGGGAAA GAAATACTAAGAGAAACCCCAGACAATATCCTTGAGGTTCAGGAATCTG GAGAGTACAGATGCCAGGCCC AGGGCTCCCCTCTCAGTAGCCCTGTGCACTTGGATTTTTCTTCAGCTTC GCTGATCCTGCAAGCTCCACT TTCTGTGTTTGAAGGAGACTCTGTGGTTCTGAGGTGCCGGGCAAAGGCG GAAGTAACACTGAATAATACT ATTTACAAGAATGATAATGTCCTGGCATTCCTTAATAAAAGAACTGACT TCCATATTCCTCATGCATGTC TCAAGGACAATGGTGCATATCGCTGTACTGGATATAAGGAAAGTTGTTG CCCTGTTTCTTCCAATACAGT CAAAATCCAAGTCCAAGAGCCATTTACACGTCCAGTGCTGAGAGCCAGC TCCTTCCAGCCCATCAGCGGG AACCCAGTGACCCTGACCTGTGAGACCCAGCTCTCTCTAGAGAGGTCAG ATGTCCCGCTCCGGTTCCGCT TCTTCAGAGATGACCAGACCCTGGGATTAGGCTGGAGTCTCTCCCCGAA TTTCCAGATTACTGCCATGTG GAGTAAAGATTCAGGGTTCTACTGGTGTAAGGCAGCAACAATGCCTTAC AGCGTCATATCTGACAGCCCG AGATCCTGGATACAGGTGCAGATCCCTGCATCTCATCCTGTCCTCACTC TCAGCCCTGAAAAGGCTCTGA ATTTTGAGGGAACCAAGGTGACACTTCACTGTGAAACCCAGGAAGATTC TCTGCGCACTTTGTACAGGTT TTATCATGAGGGTGTCCCCCTGAGGCACAAGTCAGTCCGCTGTGAAAGG GGAGCATCCATCAGCTTCTCA CTGACTACAGAGAATTCAGGGAACTACTACTGCACAGCTGACAATGGCC TTGGCGCCAAGCCCAGTAAGG CTGTGAGCCTCTCAGTCACTGTTCCCGTGTCTCATCCTGTCCTCAACCT CAGCTCTCCTGAGGACCTGAT TTTTGAGGGAGCCAAGGTGACACTTCACTGTGAAGCCCAGAGAGGTTCA CTCCCCATCCTGTACCAGTTT CATCATGAGGGTGCTGCCCTGGAGCGTAGGTCGGCCAACTCTGCAGGAG GAGTGGCCATCAGCTTCTCTC TGACTGCAGAGCATTCAGGGAACTACTACTGCACAGCTGACAATGGCTT TGGCCCCCAGCGCAGTAAGGC GGTGAGCCTCTCCGTCACTGTCCCTGTGTCTCATCCTGTCCTCACCCTC AGCTCTGCTGAGGCCCTGACT TTTGAAGGAGCCACTGTGACACTTCACTGTGAAGTCCAGAGAGGTTCCC CACAAATCCTATACCAGTTTT ATCATGAGGACATGCCCCTGTGGAGCAGCTCAACACCCTCTGTGGGAAG AGTGTCCTTCAGCTTCTCTCT GACTGAAGGACATTCAGGGAATTACTACTGCACAGCTGACAATGGCTTT GGTCCCCAGCGCAGTGAAGTG GTGAGCCTTTTTGTCACTGTTCCAGTGTCTCGCCCCATCCTCACCCTCA GGGTTCCCAGGGCCCAGGCTG TGGTGGGGGACCTGCTGGAGCTTCACTGTGAGGCCCCGAGAGGCTCTCC CCCAATCCTGTACTGGTTTTA TCATGAGGATGTCACCCTGGGGAGCAGCTCAGCCCCCTCTGGAGGAGAA GCTTCTTTCAACCTCTCTCTG ACTGCAGAACATTCTGGAAACTACTCATGTGAGGCCAACAATGGCCTAG TGGCCCAGCACAGTGACACAA TATCACTCAGTGTTATAGTTCCAGTATCTCGTCCCATCCTCACCTTCAG GGCTCCCAGGGCCCAGGCTGT GGTGGGGGACCTGCTGGAGCTTCACTGTGAGGCCCTGAGAGGCTCCTCC CCAATCCTGTACTGGTTTTAT CATGAAGATGTCACCCTGGGTAAGATCTCAGCCCCCTCTGGAGGAGGGG CCTCCTTCAACCTCTCTCTGA CTACAGAACATTCTGGAATCTACTCCTGTGAGGCAGACAATGGTCTGGA GGCCCAGCGCAGTGAGATGGT GACACTGAAAGTTGCAGTTCCGGTGTCTCGCCCGGTCCTCACCCTCAGG GCTCCCGGGACCCATGCTGCG GTGGGGGACCTGCTGGAGCTTCACTGTGAGGCCCTGAGAGGCTCTCCCC TGATCCTGTACCGGTTTTTTC ATGAGGATGTCACCCTAGGAAATAGGTCGTCCCCCTCTGGAGGAGCGTC CTTAAACCTCTCTCTGACTGC AGAGCACTCTGGAAACTACTCCTGTGAGGCCGACAATGGCCTCGGGGCC CAGCGCAGTGAGACAGTGACA CTTTATATCACAGGGCTGACCGCGAACAGAAGTGGCCCTTTTGCCACAG GAGTCGCCGGGGGCCTGCTCA GCATAGCAGGCCTTGCTGCGGGGGCACTGCTGCTCTACTGCTGGCTCTC GAGAAAAGCAGGGAGAAAGCC TGCCTCTGACCCCGCCAGGAGCCCTTCAGACTCGGACTCCCAAGAGCCC ACCTATCACAATGTACCAGCC TGGGAAGAGCTGCAACCAGTGTACACTAATGCAAATCCTAGAGGAGAAA ATGTGGTTTACTCAGAAGTAC GGATCATCCAAGAGAAAAAGAAACATGCAGTGGCCTCTGACCCCAGGCA TCTCAGGAACAAGGGTTCCCC TATCATCTACTCTGAAGTTAAGGTGGCGTCAACCCCGGTTTCCGGATCC CTGTTCTTGGCTTCCTCAGCT CCTCACAGATGAGTCCACACGTCTCTCCAACTGCTGTTTCAGCCTCTGC ACCCCAAAGTTCCCCTTGGGG GAGAAGCAGCATTGAAGTGGGAAGATTTAGGCTGCCCCAGACCATATCT ACTGGCCTTTGTTTCACATGT CCTCATTCTCAGTCTGACCAGAATGCAGGGCCCTGCTGGACTGTCACCT GTTTCCCAGTTAAAGCCCTGA CTGGCAGGTTTTTTAATCCAGTGGCAAGGTGCTCCCACTCCAGGGCCCA GCACATCTCCTGGATTCCTTA GTGGGCTTCAGCTGTGGTTGCTGTTCTGAGTACTGCTCTCATCACACCC CCACAGAGGGGGTCTTACCAC ACAAAGGGAGAGTGGGCCTTCAGGAGATGCCGGGCTGGCCTAACAGCTC AGGTGCTCCTAAACTCCGACA CAGAGTTCCTGCTTTGGGTGGATGCATTTCTCAATTGTCATCAGCCTGG TGGGGCTACTGCAGTGTGCTG CCAAATGGGACAGCACACAGCCTGTGCACATGGGACATGTGATGGGTCT CCCCACGGGGGCTGCATTTCA CACTCCTCCACCTGTCTCAAACTCTAAGGTCGGCACTTGACACCAAGGT AACTTCTCTCCTGCTCATGTG TCAGTGTCTACCTGCCCAAGTAAGTGGCTTTCATACACCAAGTCCCAAG TTCTTCCCATCCTAACAGAAG TAACCCAGCAAGTCAAGGCCAGGAGGACCAGGGGTGCAGACAGAACACA TACTGGAACACAGGAGGTGCT CAATTACTATTTGACTGACTGACTGAATGAATGAATGAATGAGGAAGAA AACTGTGGGTAATCAAACTGG CATAAAATCCAGTGCACTCCCTAGGAAATCCGGGAGGTATTCTGGCTTC CCTAAGAAACAATGGAAGAGA AGGAGCTTGGATGAGGAAACTGTTCAGCAAGAGGAAGGGCTTCTCACAC TTTCATGTGCTTGTGGATCAC CTGAGGATCCTGTGAAAATACAGATACTGATTCAGTGGGTCTGCGTAGA GCCTGAGACTGCCATTCTAAC ATGTTCCCAGGGGATGCTGATGCTGCTGGCCCTGGGACTGCACTGCATG CATGTGAAGCCCTATAGGTCT CAGCAGAGGCCCATGGAGAGGGAATGTGTGGCTCTGGCTGCCCAGGGCC CAACTCGGTTCACACGGATCG TGCTGCTCCCTGGCCAGCCTTTGGCCACAGCACCACCAGCTGCTGTTGC TGAGAGAGCTTCTTCTCTGTG ACATGTTGGCTTTCATCAGCCACCCTGGGAAGCGGAAAGTAGCTGCCAC TATCTTTGTTTCCCCACCTCA GGCCTCACACTTTCCCATGAAAAGGGTGAATGTATATAACCTGAGCCCT CTCCATTCAGAGTTGTTCTCC CATCTCTGAGCAATGGGATGTTCTGTTCCGCTTTTATGATATCCATCAC ATCTTATCTTGATCTTTGCTC CCAGTGGATTGTACAGTGATGACTTTTAAGCCCCACGGCCCTGAAATAA AATCCTTCCAAGGGCATTGGA AGCTCACTCCACCTGAACCATGGCTTTTCATGCTTCCAAGTGTCAGGGC CTTGCCCAGATAGACAGGGCT GGCTCTGCTGCCCCAACCTTTCAAGGAGGAAACCAGACACCTGAGACAG GAGCCTGTATGCAGCCCAGTG CAGCCTTGCAGAGGACAAGGCTGGAGGCATTTGTCATCACTACAGATAT GCAACTAAAATAGACGTGGAG CAAGAGAAATGCATTCCCACCGAGGCCGCTTTTTTAGGCCTAGTTGAAA GTCAAGAAGGACAGCAGCAAG CATAGGCTCAGGATTAAAGAAAAAAATCTGCTCACAGTCTGTTCTGGAG GTCACATCACCAACAAAGCTC ACGCCCTATGCAGTTCTGAGAAGGTGGAGGCACCAGGCTCAAAAGAGGA AATTTAGAATTTCTCATTGGG AGAGTAAGGTACCCCCATCCCAGAATGATAACTGCACAGTGGCAGAACA AACTCCACCCTAATGTGGGTG GACCCCGTCCAGTCTGTTGAAGGCCTGAATGTAACAAAAGGGCTTATTC TTCCTCAAGTAAGGGGGAACT CCTGCTTTGGGCTGGGACATAAGTTTTTCTGCTTTCAGACGCAAACTGA AAAATGGCTCTTCTTGGGTCT TGAGCTTGCTGGCATATGGACTGAAAGAAACTATGCTATTGGATCTCCT GGATCTCCAGCTTGCTGACTG CAGATCTTGAGATATGTCAGCCTCTACAGTCACAAGAGCTAATTCATTC TAATAAACCAATCTTTCTGTA AAAAA 57 GGAAATAGGTCGTCCCCCTC FcRH5 CRISPR guideRNA 58 AGTTGGCCGACCTACGCTCC FcRH5 CRISPR guideRNA 59 AGCGGACTGACTTGTGCCTC FcRH5 CRISPR guideRNA 60 ACAAGTCAGTCCGCTGTGAA FcRH5 CRISPR guideRNA 61 CTCACCGCCTTACTGCGCTG FcRH5 CRISPR guideRNA 62 TTCAGTTCCGGTGTCTCGCC FcRH5 CRISPR guideRNA