METHOD OF GENERATING VACCINES
20240009287 ยท 2024-01-11
Assignee
Inventors
Cpc classification
A61K2039/52
HUMAN NECESSITIES
International classification
Abstract
A vaccine comprising a pharmaceutically acceptable carrier and bacteria which presents at least one cancer-associated antigen is disclosed. The bacteria are not genetically modified to express the at least one cancer-associated antigen. Uses thereof are also disclosed.
Claims
1. A vaccine comprising a pharmaceutically acceptable carrier and bacteria which presents at least one cancer-associated antigen, wherein said bacteria are not genetically modified to express said at least one cancer-associated antigen.
2. The vaccine of claim 1, wherein said at least one cancer-associated antigen is integrated into the cell wall of the bacteria via a modified amino acid which is comprised in said bacteria.
3. The vaccine of claim 2, wherein said modified amino acid comprises D-alanine.
4. The vaccine of claim 1, wherein said at least one cancer-associated antigen comprises at least one reactive group selected from the group consisting of an alkene group, an alkyne group, an azide group, a cyclopropenyl group, a tetrazine group, a dibenzocyclooctyl (DBCO) group, a dibenzocyclooctine (DIBO) group, a bicyclononine (BCN) group, a Trans-Cyclooctene (TCO) group and a strained Trans-Cyclooctene (sTCO) group.
5. The vaccine of claim 1, wherein said bacteria is a gram negative bacteria.
6. The vaccine of claim 1, wherein said at least one cancer-associated antigen binds to said modified amino acid via a Click chemistry reaction.
7. The vaccine of claim 1, wherein the bacteria is of a family, order, genus or species set forth in any of Tables 1-3 and/or wherein a genome of the bacteria comprises a 16S rRNA sequence as set forth in any one of SEQ ID NOs: 24-310.
8. The vaccine of claim 1, wherein said bacteria comprise Salmonella Typhimurium, Pseudomonas aeruginosa and/or Bacillus subtillis.
9. The vaccine of claim 1, wherein said cancer-associated antigen is a neoantigen.
10. A method of generating an antigenic composition comprising: (a) incubating bacteria in a culture medium comprising a modified amino acid which is metabolized by the bacteria under conditions that allow the bacteria to be integrated into the cell wall of the bacteria; and (b) contacting the bacteria with at least one cancer-associated antigen under conditions that allow said cancer associated antigen to bind to said modified amino acid, thereby generating the antigenic composition.
11. The method of claim 10, wherein said modified amino acid comprises D-alanine.
12. The method of claim 10, wherein said steps (a) and (b) are performed simultaneously.
13. The method of claim 10, wherein said bacteria are gram negative bacteria.
14. The method of claim 10, wherein said bacteria comprise Salmonella typhimurium, Pseudomonas aeruginosa and/or Bacillus subtillis.
15. The method of claim 10, wherein said cancer-associated antigen binds to said modified amino acid via a Click chemistry reaction.
16. The method of claim 10, wherein said cancer-associated antigen is a neoantigen.
17. The method of claim 10, wherein the bacteria is of a family, order, genus or species set forth in any one of Tables 1-3, and/or wherein a genome of the bacteria comprises a 16S rRNA sequence as set forth in any one of SEQ ID NOs: 24-310.
18. The vaccine of claim 1, generated by: (a) incubating bacteria in a culture medium comprising a modified amino acid which is metabolized by the bacteria under conditions that allow the bacteria to be integrated into the cell wall of the bacteria; and (b) contacting the bacteria with at least one cancer-associated antigen under conditions that allow said cancer associated antigen to bind to said modified amino acid, thereby generating the antigenic composition.
19. A method of treating or preventing cancer of a subject in need thereof the method comprising administering to the subject a therapeutically effective amount of the vaccine of claim 1, thereby treating the cancer.
20. The method of claim 19, wherein the cancer is selected from the group consisting of breast cancer, lung cancer, gastric cancer, colorectal cancer, melanoma, pancreatic cancer, ovarian cancer, bone cancer and brain cancer.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0049] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawings will be provided by the Office upon request and payment of the necessary fee.
[0050] Some embodiments of the invention are herein described, by way of example only, with reference to the accompanying drawings. With specific reference now to the drawings in detail, it is stressed that the particulars shown are by way of example and for purposes of illustrative discussion of embodiments of the invention. In this regard, the description taken with the drawings makes apparent to those skilled in the art how embodiments of the invention may be practiced.
[0051] In the drawings:
[0052]
[0053]
[0054]
[0055]
[0056]
DESCRIPTION OF SPECIFIC EMBODIMENTS OF THE INVENTION
[0057] The present invention, in some embodiments thereof, relates to bacterial vaccines which may be manipulated to contain disease-associated antigens on their outer surface.
[0058] Before explaining at least one embodiment of the invention in detail, it is to be understood that the invention is not necessarily limited in its application to the details set forth in the following description or exemplified by the Examples. The invention is capable of other embodiments or of being practiced or carried out in various ways.
[0059] In vivo therapeutic cancer vaccine strategies based on bacterial vectors that directly deliver antigens or nucleic acids encoding antigens to the cytosol of APCs, have been developed in academic laboratories and pharmaceutical industry due to their ease of use. Typically, the bacteria is genetically modified to express (and even secrete) the disease antigen. Alternatively, the bacteria may be used to deliver plasmid cDNA which encode the disease antigen to the immune system.
[0060] The present inventors have now conceived of a novel vaccine in which bacteria are manipulated to present disease associated antigens on their outer surface without genetic modification.
[0061] As is illustrated hereinunder and in the examples section which follows, the present inventors show that it is possible to label bacteria with neonatigen without genetic modification thereof. Firstly, bacteria were incubated with a modified amino acid (alkyne-D-Alanine-D-alanine (D-Ala) allowing their incorporation into the peptidoglycan bacterial cell wall. Next, the OVA neoantigen containing an azido residue in its N-terminus was clicked to the bacteria, as illustrated in
[0062] Whilst further reducing the present invention to practice, the present inventors demonstrated that the clicked bacteria were capable of reaching the tumor site following i.v. injection (
[0063] Consequently, the present teachings suggest that other modified cell wall components can be taken up by bacteria from the culture medium and incorporated into their cell wall (e.g. MurNAc, teichoic acid and lipopolysaccharides), paving the way for an easy and cost-effective method for the generation of vaccines for the treatment of cancer. Moreover, non-genetic manipulation of bacteria for the presentation of the neoantigens of choice resolves major bottle necks of biosafety and regulation constraints related to genetically engineered bacteria. While every genetic manipulation of a bacteria will require lengthy and costly approval process, the presently disclosed strategy allows for a quick and non-expensive strategy. Moreover, the presently disclosed method enables the use of bacteria which are difficult to genetically modify as conduits for neoantigen presentation.
[0064] Consequently, non-genetically modified bacteria which present tumor neoantigens has the potential to become the tiebreaker in the field of personalized anti-cancer vaccines.
[0065] Thus, according to an aspect of the present invention there is provided a vaccine comprising a pharmaceutically acceptable carrier and bacteria which presents at least one cancer-associated antigen, wherein the bacteria are not genetically modified to express the at least one cancer-associated antigen.
[0066] As used herein, the term vaccine refers to a pharmaceutical preparation (pharmaceutical composition) that upon administration induces an immune response, in particular a cellular immune response, which recognizes and attacks a cancer cell. Preferably, the vaccine results in the formation of long-term immune memory towards the targeted antigen. The vaccine of the present invention preferably also includes a pharmaceutically acceptable carrier (i.e. a liquid which holds the bacteria). The carrier may be one that does not affect the viability of the bacteria.
[0067] The isolated bacteria of this aspect of the present invention may be gram positive or gram negative bacteria or may be a combination of both.
[0068] The isolated bacteria may be aerobic or non-aerobic.
[0069] In one embodiment, the bacteria are capable of homing to a tumor site.
[0070] In another embodiment, the bacteria are present in a tumor microbiome.
[0071] According to a particular embodiment, the bacteria is Salmonella Typhimuriume.g. the Salmonella Typhimurium attenuated strain VNP20009, Salmonella Typhimurium 14028 strain STM3120, Salmonella Typhimurium 14028 strain STM1414, Pseudomonas aeruginosa (strain CHA-OST) and/or Bacillus Subtillis (strain PY79). Examples of bacteria known to be present in a breast tumor microbiome are set forth in
[0072] Table 1, herein below. Such bacteria may be particular relevant for use in vaccines for treating breast cancer.
TABLE-US-00001 TABLE 1 kingdom phylum class order family genus species SEQ ID Bacteria Actinobacteria Actinobacteria Actinomycetales Actinomycetaceae Trueperella 24 Bacteria Actinobacteria Actinobacteria Actinomycetales Bogoriellaceae Georgenia 25 Bacteria Actinobacteria Actinobacteria Actinomycetales Cellulomonadaceae Cellulomonas 26 Bacteria Actinobacteria Actinobacteria Actinomycetales Cellulomonadaceae Oerskovia 27 Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Corynebacterium 29 tuberculostearicum Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Corynebacterium 31 tuberculostearicum Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Corynebacterium 32 variabile Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium 33 Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium 35 Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium 36 Bacteria Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium 37 Bacteria Actinobacteria Actinobacteria Actinomycetales Dermabacteraceae Dermabacter 38 Bacteria Actinobacteria Actinobacteria Actinomycetales Dermacoccaceae Dermacoccus 39 Bacteria Actinobacteria Actinobacteria Actinomycetales Dermacoccaceae Dermacoccus 40 Bacteria Actinobacteria Actinobacteria Actinomycetales Dietziaceae Dietzia 41 Bacteria Actinobacteria Actinobacteria Actinomycetales Geodermatophilaceae Blastococcus 42 Bacteria Actinobacteria Actinobacteria Actinomycetales Intrasporangiaceae Janibacter 43 Bacteria Actinobacteria Actinobacteria Actinomycetales Intrasporangiaceae Ornithinimicrobium 44 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Agrococcus 45 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Agrococcus 46 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Microbacterium 47 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Microbacterium 48 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Microbacterium 49 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Microbacterium 50 Bacteria Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Microbacterium 51 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Arthrobacter Arthrobacter 52 aurescens Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 53 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 54 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 55 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 56 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 57 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 58 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 59 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 60 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 61 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 62 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 63 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 64 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 65 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 66 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 67 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 68 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 69 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 70 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus Micrococcus 71 luteus Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Arthrobacter 72 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Kocuria 73 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Microbispora 74 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Microbispora 75 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus 76 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus 77 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus 78 Bacteria Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Micrococcus 79 Bacteria Actinobacteria Actinobacteria Actinomycetales Mycobacteriaceae Mycobacterium 80 Bacteria Actinobacteria Actinobacteria Actinomycetales Nocardiaceae Rhodococcus Rhodococcus 81 erythropolis Bacteria Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 82 acnes Bacteria Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 83 acnes Bacteria Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 84 acnes Bacteria Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 85 avidum Bacteria Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 86 avidum Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus 87 flexus Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus 88 flexus Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus 89 muralis Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus 90 Bacteria Firmicutes Bacilli Bacillales Bacillaceae 1 Bacillus Bacillus 91 subtilis Bacteria Firmicutes Bacilli Bacillales Bacillaceae 1 Bacillus Bacillus 92 subtilis Bacteria Firmicutes Bacilli Bacillales Bacillaceae 1 Bacillus Bacillus 93 subtilis Bacteria Firmicutes Bacilli Bacillales Bacillaceae 1 Bacillus Bacillus 94 foraminis Bacteria Firmicutes Bacilli Bacillales Bacillaceae 1 Bacillus Bacillus 95 nealsonii Bacteria Firmicutes Bacilli Bacillales Bacillaceae 2 Terribacillus 96 Bacteria Firmicutes Bacilli Bacillales Planococcaceae Chryseomicrobium Chryseomicrobium 97 imtechense Bacteria Firmicutes Bacilli Bacillales Planococcaceae Chryseomicrobium 98 Bacteria Firmicutes Bacilli Bacillales Planococcaceae Sporosarcina 99 Bacteria Firmicutes Bacilli Bacillales Planococcaceae Sporosarcina 100 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 101 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 102 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 103 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 104 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 105 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 106 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 107 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 108 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 109 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 110 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 111 epidermidis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 112 haemolyticus Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 113 hominis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 114 hominis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 115 hominis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 116 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 117 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 118 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 119 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 120 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 121 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 122 lugdunensis Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 123 succinus Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 124 succinus Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 125 succinus Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus 126 Bacteria Firmicutes Bacilli Bacillales Unknown Exiguobacterium Exiguobacterium 127 species mexicanum Bacteria Firmicutes Bacilli Bacillales Unknown Exiguobacterium Exiguobacterium 128 species profundum Bacteria Firmicutes Bacilli Bacillales Unknown Exiguobacterium 129 species Bacteria Firmicutes Bacilli Lactobacillales Aerococcaceae Aerococcus Aerococcus 130 viridans Bacteria Firmicutes Bacilli Lactobacillales Enterococcaceae Enterococcus Enterococcus 131 faecalis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 132 infantis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 133 infantis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 134 infantis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 135 infantis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 136 oralis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 137 pneumoniae Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 138 pneumoniae Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 139 sanguinis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 140 vestibularis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 141 vestibularis Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Assigned 142 species1791 Bacteria Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae Paracoccus Paracoccus 143 aminovorans Bacteria Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae Paracoccus 144 Bacteria Proteobacteria Alphaproteobacteria Rhodospirillales Acetobacteraceae Roseomonas Roseomonas 145 mucosa Bacteria Proteobacteria Alphaproteobacteria Rhodospirillales Acetobacteraceae Roseomonas 146 Bacteria Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Sphingomonas Sphingomonas 147 desiccabilis Bacteria Proteobacteria Betaproteobacteria Burkholderiales Oxalobacteraceae Massilia 148 Bacteria Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria 149 macacae Bacteria Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria 150 subflava Bacteria Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria 151 subflava Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Enterobacter 152 cloacae Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Proteus Proteus 153 mirabilis Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Proteus Proteus 154 mirabilis Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Proteus Proteus 155 mirabilis Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Erwinia 156 Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Erwinia 157 Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Erwinia 158 Bacteria Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Erwinia 159 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Acinetobacter Acinetobacter 160 radioresistens Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Enhydrobacter Enhydrobacter 161 aerosaccus Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Enhydrobacter Enhydrobacter 162 aerosaccus Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Enhydrobacter Enhydrobacter 163 aerosaccus Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Enhydrobacter 164 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas 165 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas 166 Fungi Ascomycota Eurotiomycetes Eurotiales Trichocomaceae Aspergillus Aspergillus 167 kawachii Fungi Ascomycota Eurotiomycetes Eurotiales Trichocomaceae Aspergillus Aspergillus 168 niger Fungi Ascomycota Eurotiomycetes Eurotiales Trichocomaceae Aspergillus Aspergillus 169 pseudoglaucus Fungi Ascomycota Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces 170 cerevisiae
[0073] Table 2 includes bacterial taxa that may be particular relevant for use in a vaccine for treating breast, lung or ovarian cancers. Bacteria are sorted according to their p-values (lowest to highest) for enrichment per tumor type.
TABLE-US-00002 TABLE 2 Tumor SEQ ID bact_ID phylum class order family genus species type NO: 12873 Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Sphingomonas Unknown Breast 171 species602 13620 Proteobacteria Betaproteobacteria Burkholderiales Comamonadaceae Tepidimonas Unknown Breast 172 species11 32080 Proteobacteria Betaproteobacteria Burkholderiales Comamonadaceae Tepidimonas Breast 11657 Proteobacteria Alphaproteobacteria Rhizobiales Methylobacteriaceae Methylobacterium Methylobacterium Breast 173 organophilum 11656 Proteobacteria Alphaproteobacteria Rhizobiales Methylobacteriaceae Methylobacterium Methylobacterium Breast 174 mesophilicum 30362 Bacteroidetes Bacteroidia Bacteroidales Prevotellaceae Prevotella Breast 50030 Bacteroidetes Bacteroidia Bacteroidales Breast 30867 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Breast 50075 Firmicutes Bacilli Bacillales Breast 50148 Proteobacteria Gammaproteobacteria Pseudomonadales Breast 31477 Firmicutes Clostridia Clostridiales Tissierellaceae Finegoldia Breast 40195 Firmicutes Clostridia Clostridiales Tissierellaceae Breast 70016 Firmicutes Breast 30663 Cyanobacteria Chloroplast Streptophyta Unknown Unknown Breast family genus116 4523 Cyanobacteria Chloroplast Streptophyta Unknown Unknown Unknown Breast 175 family genus116 species19 40168 Firmicutes Bacilli Bacillales Staphylococcaceae Breast 9900 Firmicutes Clostridia Clostridiales Tissierellaceae Finegoldia Unknown Breast 176 species11 5302 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Unknown Breast 178 species8 5324 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus Breast 179 haemolyticus 15324 Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Acinetobacter Acinetobacter Breast 180 ursingii 30817 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Breast 30858 Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Breast 31799 Proteobacteria Alphaproteobacteria Rhizobiales Methylobacteriaceae Methylobacterium Breast 40245 Proteobacteria Alphaproteobacteria Rhizobiales Methylobacteriaceae Breast 60052 Firmicutes Bacilli Breast 60078 Proteobacteria Betaproteobacteria Breast 13182 Proteobacteria Betaproteobacteria Burkholderiales Burkholderiaceae Ralstonia Ralstonia Breast 181 mannitolilytica 31786 Proteobacteria Alphaproteobacteria Rhizobiales Hyphomicrobiaceae Devosia Breast 40181 Firmicutes Bacilli Lactobacillales Streptococcaceae Breast 40330 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Breast 969 Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Corynebacterium Breast 182 stationis 32410 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Breast 230 Actinobacteria Actinobacteria Actinomycetales Actinomycetaceae Actinomyces Actinomycesoris Breast 183 5687 Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Lactobacillus Breast 184 iners 40176 Firmicutes Bacilli Lactobacillales Aerococcaceae Breast 50079 Firmicutes Clostridia Clostridiales Breast 40179 Firmicutes Bacilli Lactobacillales Lactobacillaceae Breast 3941 Bacteroidetes Flavobacteriia Flavobacteriales Weeksellaceae Wautersiella Unknown Breast 187 species18 30113 Actinobacteria Actinobacteria Actinomycetales Cellulomonadaceae Cellulomonas Breast 6166 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus Breast 188 cristatus 15055 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Klebsiella Klebsiella Breast 189 pneumoniae 30866 Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Breast 40144 Cyanobacteria Chloroplast Streptophyta Unknown Breast family 40276 Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Breast 50085 Fusobacteria Fusobacteriia Fusobacteriales Breast 40046 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Breast 50077 Firmicutes Bacilli Lactobacillales Breast 60081 Proteobacteria Gammaproteobacteria Breast 1021 Actinobacteria Actinobacteria Actinomycetales Geodermatophilaceae Blastococcus Unknown Breast 190 species13 4719 Firmicutes Bacilli Bacillales Bacillaceae Anoxybacillus Anoxybacillus Breast 191 kestanbolensis 40042 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae Breast 2556 Bacteroidetes Bacteroidia Bacteroidales Paraprevotellaceae Prevotella Prevotella Breast 192 tannerae 30099 Actinobacteria Actinobacteria Actinomycetales Actinomycetaceae Actinomyces Breast 9261 Firmicutes Clostridia Clostridiales Ruminococcaceae Faecalibacterium Faecalibacterium Breast 195 prausnitzii 4521 Cyanobacteria Chloroplast Streptophyta Unknown Unknown Unknown Breast 197 family genus116 species17 30190 Actinobacteria Actinobacteria Actinomycetales Mycobacteriaceae Mycobacterium Breast 30225 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Breast 32336 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Breast 40021 Actinobacteria Actinobacteria Actinomycetales Actinomycetaceae Breast 40038 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Breast 40193 Firmicutes Clostridia Clostridiales Ruminococcaceae Breast 40198 Firmicutes Clostridia Clostridiales Veillonellaceae Breast 40278 Proteobacteria Betaproteobacteria Rhodocyclales Rhodocyclaceae Breast 30845 Firmicutes Bacilli Lactobacillales Aerococcaceae Alloiococcus Breast 9771 Firmicutes Clostridia Clostridiales Tissierellaceae 1-68 1-68 Unknown Breast 198 5687 Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Lactobacillus Lung 199 iners 40260 Proteobacteria Alphaproteobacteria Sphingomonadales Erythrobacteraceae Lung
[0074] Table 3 summarizes the different bacterial species that are prevalent in specific tumor types.
TABLE-US-00003 TABLE 3 Prevalence Tumor in specific SEQ type bact_ID phylum class order family genus species tumor type ID NO: Breast 1824 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 38% 201 granulosum Breast 1346 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Rothia Rothia 37% 202 mucilaginosa Breast 5687 Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Lactobacillus 37% 203 iners Breast 6175 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 36% 204 infantis Breast 10545 Firmicutes Clostridia Clostridiales Veillonellaceae Veillonella Veillonella 36% 205 dispar Breast 1344 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Rothia Rothia 32% 206 dentocariosa Breast 587 Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Unknown 28% 207 species1715 Breast 5330 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 28% 208 pasteuri Breast 3046 Bacteroidetes Bacteroidia Bacteroidales Prevotellaceae Prevotella Prevotella 27% 209 melaninogenica Breast 10726 Fusobacteria Fusobacteriia Fusobacteriales Fusobacteriaceae Fusobacterium Fusobacterium 24% 210 nucleatum Breast 4523 Cyanobacteria Chloroplast Streptophyta Unknown Unknown Unknown 23% 211 family genus116 species 19 Breast 9900 Firmicutes Clostridia Clostridiales Tissierellaceae Finegoldia Unknown 23% 212 species 11 Breast 15324 Proteobacteria Gamma Pseudomonadales Moraxellaceae Acinetobacter Acinetobacter 23% 213 proteobacteria ursingii Breast 6184 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 22% 214 pneumoniae Breast 2555 Bacteroidetes Bacteroidia Bacteroidales Paraprevotellaceae Prevotella Prevotella 22% 215 Unknown Breast 5286 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Unknown 22% 216 species691 Breast 10546 Firmicutes Clostridia Clostridiales Veillonellaceae Veillonella Veillonella 22% 217 parvula Breast 12106 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae Paracoccus Paracoccus 21% 218 chinensis Breast 13904 Proteobacteria Betaproteobacteria Burkholderiales Oxalobacteraceae Massilia Massilia 21% 219 timonae Breast 12109 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae Paracoccus Paracoccus 20% 220 marcusii Lung 1824 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 19% 221 granulosum Lung 12551 Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Kaistobacter Kaistobacter 16% 222 Unknown Lung 10545 Firmicutes Clostridia Clostridiales Veillonellaceae Veillonella Veillonelladispar 16% 223 Lung 587 Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Unknown 16% 224 species1715 Lung 1346 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Rothia Rothia 16% 225 mucilaginosa Lung 2555 Bacteroidetes Bacteroidia Bacteroidales Paraprevotellaceae Prevotella Prevotella 14% 226 Unknown Lung 5687 Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Lactobacillus 14% 227 iners Lung 12937 Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Sphingomonas Sphingomonas 13% 228 yunnanensis Lung 1766 Actin Actinobacteria Actinomycetales Propionibacteriaceae Unknown Unknown 12% 229 Proteobacteria genus24 species 1 Lung 12109 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae Paracoccus Paracoccus 11% 230 marcusii Lung 12289 Proteobacteria Alphaproteobacteria Rhodospirillales Acetobacteraceae Roseomonas Roseomonas 10% 231 mucosa Lung 15666 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas 9% 232 baetica Lung 1815 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Unknown 8% 233 species 18 Lung 12808 Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Sphingomonas Unknown 8% 234 species 45 Lung 5338 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 7% 235 warneri Lung 13018 Proteobacteria Betaproteobacteria Burkholderiales Alcaligenaceae Alcaligenes Alcaligenes 7% 236 faecalis Lung 13194 Proteobacteria Betaproteobacteria Burkholderiales Comamonadaceae Acidovorax Acidovorax 7% 237 temperans Lung 545 Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Unknown 7% 238 species1626 Lung 6066 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Unknown 7% 239 species346 Lung 9900 Firmicutes Clostridia Clostridiales Tissierellaceae Finegoldia Unknown 7% 240 species 11 Melanoma 12109 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae Paracoccus Paracoccus 20% 241 marcusii Melanoma 5315 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 14% 242 aureus Melanoma 2495 Bacteroidetes Bacteroidia Bacteroidales Bacteroidaceae Bacteroides Bacteroides 10% 243 dorei Melanoma 15607 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Unknown 5% 244 species632 Melanoma 10444 Firmicutes Clostridia Clostridiales Veillonellaceae Selenomonas Unknown 5% 245 species 18 Melanoma 15733 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas 4% 246 viridiflava Melanoma 4886 Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Unknown 4% 247 species208 Melanoma 15043 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Klebsiella Unknown 4% 248 species 25 Melanoma 15608 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Unknown 4% 249 species643 Melanoma 4619 Cyanobacteria Chloroplast Streptophyta Unknown Unknown Unknown 3% 250 family genus39 species 8 Melanoma 15956 Proteobacteria Gammaproteobacteria Xanthomonadales Xanthomonadaceae Xanthomonas Xanthomonas 3% 251 arboricola Melanoma 436 Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Unknown 2% 252 species1061 Melanoma 6291 Firmicutes Clostridia Clostridiales Clostridiaceae Clostridium Unknown 2% 253 species 19 Melanoma 15368 Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Acinetobacter Unknown 2% 254 species 31 Melanoma 13810 Proteobacteria Betaproteobacteria Burkholderiales Oxalobacteraceae Massilia Unknown 2% 255 species177 Melanoma 67031 Firmicutes Clostridia Clostridiales Lachnospiraceae Unknown Unknown 2% 256 genus3008 species 1 Melanoma 4087 Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Eikenella Eikenella 2% 257 corrodens Melanoma 2437 Bacteroidetes Bacteroidia Bacteroidales Bacteroidaceae Bacteroides Unknown 2% 258 species388 Melanoma 10458 Firmicutes Clostridia Clostridiales Veillonellaceae Selenomonas Unknown 2% 259 species208 Melanoma 8343 Firmicutes Clostridia Clostridiales Lachnospiraceae Lachnoanaerobaculum Eubacterium 1% 260 saburreum Melanoma 10504 Firmicutes Clostridia Clostridiales Veillonellaceae Selenomonas Unknown 1% 261 species 59 Pancreas 14775 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Citrobacter Citrobacter 45% 262 freundii Pancreas 15055 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Klebsiella Klebsiella 42% 263 pneumoniae Pancreas 14847 Proteobacteri Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Enterobacter 33% 264 asburiae Pancreas 10545 Firmicutes Clostridia Clostridiales Veillonellaceae Veillonella Veillonella 19% 265 dispar Pancreas 10726 Fusobacteria Fusobacteriia Fusobacteriales Fusobacteriaceae Fusobacterium Fusobacterium 18% 266 nucleatum Pancreas 14849 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Enterobacter 18% 267 cloacae Pancreas 15054 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Klebsiella Klebsiella 15% 268 oxytoca Pancreas 14846 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Enterobacter 13% 269 aerogenes Pancreas 6161 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus 13% 270 anginosus Pancreas 15695 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas 12% 271 mendocina Pancreas 1346 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Rothia Rothia 10% 272 mucilaginosa Pancreas 14680 Proteobacteria Gammaproteobacteria Alteromonadales Shewanellaceae Shewanella Shewanella 10% 273 decolorationis Pancreas 5583 Firmicutes Bacilli Lactobacillales Enterococcaceae Enterococcus Enterococcus 10% 274 gallinarum Pancreas 5552 Firmicutes Bacilli Lactobacillales Carnobacteriaceae Granulicatella Granulicatella 9% 275 adiacens Pancreas 986 Actinobacteria Actinobacteria Actinomycetales Dermabacteraceae Brachybacterium Brachybacterium 7% 276 conglomeratum Pancreas 14174 Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria 7% 277 subflava Pancreas 2555 Bacteroidetes Bacteroidia Bacteroidales Paraprevotellaceae Prevotella Prevotella 6% 278 Unknown Pancreas 5582 Firmicutes Bacilli Lactobacillales Enterococcaceae Enterococcus Enterococcus 6% 279 faecium Pancreas 1344 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Rothia Rothia 4% 280 dentocariosa Pancreas 10757 Fusobacteria Fusobacteriia Fusobacteriales Leptotrichiaceae Leptotrichia Unknown 4% 281 species235 Ovary 12289 Proteobacteria Alphaproteobacteria Rhodospirillales Acetobacteraceae Roseomonas Roseomonas 20% 282 mucosa Ovary 12873 Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Sphingomonas Unknown 20% 283 species602 Ovary 5319 Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus 9% 284 cohnii Ovary 16227 Thermi Deinococci Deinococcales Deinococcaceae Deinococcus Unknown 7% 285 species124 Ovary 5627 Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Unknown 5% 286 species479 Bone 12674 Proteobacteria Alphaproteobacteria Sphingomonadales Sphingomonadaceae Sphingobium Sphingomonas 36% 287 yanoikuyae Bone 1824 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae Propionibacterium Propionibacterium 28% 288 granulosum Bone 225 Actinobacteria Actinobacteria Actinomycetales Actinomycetaceae Actinomyces Actinomyces 18% 289 massiliensis Bone 15662 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas 13% 290 argentinensis Bone 14847 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Enterobacter 10% 291 asburiae Bone 15568 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Unknown 10% 292 species 39 Bone 5968 Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Unknown 8% 293 species2029 Bone 16119 TM7 TM7-3 CW040 Unknown Unknown Unknown 5% 294 family genus3 species 7 Bone 16025 Spirochaetes Spirochaetes Spirochaetales Spirochaetaceae Treponema Treponema 5% 295 socranskii Bone 4868 Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus 5% 296 clausii Bone 527 Actinobacteria Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium Unknown 5% 297 species1534 GBM 14849 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Enterobacter 10% 298 cloacae GBM 14169 Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria 8% 299 macacae GBM 1311 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae Kocuria Kocuria 8% 300 atrinae GBM 15409 Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Acinetobacter Unknown 8% 301 species424 GBM 14934 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Escherichia/ Unknown 8% 302 Shigella species231 GBM 14795 Proteobacteria Gammaproteobacteria Enterobacteriales Enterobacteriaceae Enterobacter Unknown 8% 303 species196 GBM 1129 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae Agromyces Agromyces 5% 304 mediolanus GBM 11842 Proteobacteria Alphaproteobacteria Rhizobiales Rhizobiaceae Agrobacterium Unknown 5% 305 species298 GBM 15853 Proteobacteria Gammaproteobacteria Xanthomonadales Xanthomonadaceae Luteimonas Unknown 5% 306 species 76 GBM 5106 Firmicutes Bacilli Bacillales Planococcaceae Lysinibacillus Lysinibacillus 5% 307 boronitolerans GBM 5009 Firmicutes Bacilli Bacillales Exiguobacteraceae Exiguobacterium Unknown 5% 308 species 29 GBM 15333 Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Acinetobacter Unknown 5% 309 species127 GBM 15494 Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Psychrobacter Unknown 5% 310 species 28
[0075] The term isolated or enriched encompasses bacteria that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting), and/or (2) produced, prepared, purified, and/or manufactured by the hand of man. Isolated microbes may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated microbes are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is pure if it is substantially free of other components. The terms purify, purifying and purified refer to a microbe or other material that has been separated from at least some of the components with which it was associated either when initially produced or generated (e.g., whether in nature or in an experimental setting), or during any time after its initial production. A microbe or a microbial population may be considered purified if it is isolated at or after production, such as from a material or environment containing the microbe or microbial population, and a purified microbe or microbial population may contain other materials up to about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or above about 90% and still be considered isolated. In some embodiments, purified microbes or microbial population are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. In the instance of microbial compositions provided herein, the one or more microbial types present in the composition can be independently purified from one or more other microbes produced and/or present in the material or environment containing the microbial type. Microbial compositions and the microbial components thereof are generally purified from residual habitat products.
[0076] In certain embodiments, at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% of the bacteria in the vaccine are of a genus, species or strain listed in Tables 1-3, herein above.
[0077] According to a specific embodiment, the genome of the bacteria comprises a 16S rRNA sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.95% identical to any one of the sequences as set forth in SEQ ID NO: 24-310.
[0078] As used herein, percent homology, percent identity, sequence identity or identity or grammatical equivalents as used herein in the context of two nucleic acid or polypeptide sequences includes reference to the residues in the two sequences which are the same when aligned. When percentage of sequence identity is used in reference to proteins it is recognized that residue positions which are not identical often differ by conservative amino acid substitutions, where amino acid residues are substituted for other amino acid residues with similar chemical properties (e.g. charge or hydrophobicity) and therefore do not change the functional properties of the molecule. Where sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Sequences which differ by such conservative substitutions are considered to have sequence similarity or similarity. Means for making this adjustment are well-known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated, e.g., according to the algorithm of Henikoff S and Henikoff JG. [Amino acid substitution matrices from protein blocks. Proc. Natl. Acad. Sci. U.S.A. 1992, 89(22): 10915-9].
[0079] Percent identity can be determined using any homology comparison software, including for example, the BlastN software of the National Center of Biotechnology Information (NCBI) such as by using default parameters.
[0080] Other exemplary sequence alignment programs that may be used to determine % homology or identity between two sequences include, but are not limited to, the FASTA package (including rigorous (SSEARCH, LALIGN, GGSEARCH and GLSEARCH) and heuristic (FASTA, FASTX/Y, TFASTX/Y and FASTS/M/F) algorithms, the EMBOSS package (Needle, stretcher, water and matcher), the BLAST programs (including, but not limited to BLASTN, BLASTX, TBLASTX, BLASTP, TBLASTN), megablast and BLAT. In some embodiments, the sequence alignment program is BLASTN. For example, 95% homology refers to 95% sequence identity determined by BLASTN, by combining all non-overlapping alignment segments (BLAST HSPs), summing their numbers of identical matches and dividing this sum with the length of the shorter sequence.
[0081] In some embodiments, the sequence alignment program is a basic local alignment program, e.g., BLAST. In some embodiments, the sequence alignment program is a pairwise global alignment program. In some embodiments, the pairwise global alignment program is used for protein-protein alignments. In some embodiments, the pairwise global alignment program is Needle. In some embodiments, the sequence alignment program is a multiple alignment program. In some embodiments, the multiple alignment program is MAFFT. In some embodiments, the sequence alignment program is a whole genome alignment program. In some embodiments, the whole genome alignment is performed using BLASTN. In some embodiments, BLASTN is utilized without any changes to the default parameters.
[0082] According to some embodiments of the invention, the identity is a global identity, i.e., an identity over the entire nucleic acid sequences of the invention and not over portions thereof.
[0083] In certain embodiments, the vaccine comprises at least 110.sup.3 colony forming units (CFUs), 110.sup.4 colony forming units (CFUs), 110.sup.5 colony forming units (CFUs), 110.sup.6 colony forming units (CFUs), 110.sup.7 colony forming units (CFUs), 110.sup.8 colony forming units (CFUs), 1109 colony forming units (CFUs), 110.sup.10 colony forming units (CFUs) of bacteria of a family/genus/species/strain listed in Tables 1-3, herein above.
[0084] Methods for producing bacteria may include three main processing steps. The steps are: organism banking, organism production, and preservation.
[0085] For banking, the strains included in the bacteria may be (1) isolated directly from a specimen or taken from a banked stock, (2) optionally cultured on a nutrient agar or broth that supports growth to generate viable biomass, and (3) the biomass optionally preserved in multiple aliquots in long-term storage.
[0086] In embodiments using a culturing step, the agar or broth may contain nutrients that provide essential elements and specific factors that enable growth. An example would be a medium composed of 20 g/L glucose, 10 g/L yeast extract, 10 g/L soy peptone, 2 g/L citric acid, 1.5 g/L sodium phosphate monobasic, 100 mg/L ferric ammonium citrate, 80 mg/L magnesium sulfate, 10 mg/L hemin chloride, 2 mg/L calcium chloride, 1 mg/L menadione. Another examples would be a medium composed of 10 g/L beef extract, 10 g/L peptone, 5 g/L sodium chloride, 5 g/L dextrose, 3 g/L yeast extract, 3 g/L sodium acetate, 1 g/L soluble starch, and 0.5 g/L L-cysteine HCl, at pH 6.8. A variety of microbiological media and variations are well known in the art (e.g., R. M. Atlas, Handbook of Microbiological Media (2010) CRC Press). Culture media can be added to the culture at the start, may be added during the culture, or may be intermittently/continuously flowed through the culture. The strains in the vaccine may be cultivated alone, as a subset of the microbial composition, or as an entire collection comprising the microbial composition. As an example, a first strain may be cultivated together with a second strain in a mixed continuous culture, at a dilution rate lower than the maximum growth rate of either cell to prevent the culture from washing out of the cultivation.
[0087] The inoculated culture is incubated under favorable conditions for a time sufficient to build biomass. For microbial compositions for human use this is often at 37 C. temperature, pH, and other parameter with values similar to the normal human niche. The environment may be actively controlled, passively controlled (e.g., via buffers), or allowed to drift. For example, for anaerobic bacterial compositions, an anoxic/reducing environment may be employed. This can be accomplished by addition of reducing agents such as cysteine to the broth, and/or stripping it of oxygen. As an example, a culture of a bacterial composition may be grown at 37 C., pH 7, in the medium above, pre-reduced with 1 g/L cysteine-HCl.
[0088] When the culture has generated sufficient biomass, it may be preserved for banking. The organisms may be placed into a chemical milieu that protects from freezing (adding cryoprotectants), drying (lyoprotectants), and/or osmotic shock (osmoprotectants), dispensing into multiple (optionally identical) containers to create a uniform bank, and then treating the culture for preservation. Containers are generally impermeable and have closures that assure isolation from the environment. Cryopreservation treatment is accomplished by freezing a liquid at ultra-low temperatures (e.g., at or below 80 C.). Dried preservation removes water from the culture by evaporation (in the case of spray drying or cool drying) or by sublimation (e.g., for freeze drying, spray freeze drying). Removal of water improves long-term microbial composition storage stability at temperatures elevated above cryogenic. If the microbial composition comprises, for example, spore forming species and results in the production of spores, the final composition may be purified by additional means such as density gradient centrifugation preserved using the techniques described above. Microbial composition banking may be done by culturing and preserving the strains individually, or by mixing the strains together to create a combined bank. As an example of cryopreservation, a microbial composition culture may be harvested by centrifugation to pellet the cells from the culture medium, the supernatant decanted and replaced with fresh culture broth containing 15% glycerol. The culture can then be aliquoted into 1 mL cryotubes, sealed, and placed at 80 C. for long-term viability retention. This procedure achieves acceptable viability upon recovery from frozen storage.
[0089] Microbial production may be conducted using similar culture steps to banking, including medium composition and culture conditions. It may be conducted at larger scales of operation, especially for clinical development or commercial production. At larger scales, there may be several subcultivations of the microbial composition prior to the final cultivation. At the end of cultivation, the culture is harvested to enable further formulation into a dosage form for administration. This can involve concentration, removal of undesirable medium components, and/or introduction into a chemical milieu that preserves the microbial composition and renders it acceptable for administration via the chosen route. After drying, the powder may be blended to an appropriate potency, and mixed with other cultures and/or a filler such as microcrystalline cellulose for consistency and ease of handling, and the bacteria of the vaccine formulated as provided herein.
[0090] In certain aspects, provided are vaccines (i.e. bacterial compositions) for administration to subjects. In some embodiments, the bacteria of the vaccines are combined with additional active and/or inactive materials in order to produce a final product, which may be in single dosage unit or in a multi-dose format.
[0091] The bacteria present in the vaccine may be viable (e.g. capable of propagating when cultured in the appropriate medium, or inside the body, following administration).
[0092] In another embodiment, the bacteria present in the vaccine are non-viable.
[0093] In still another embodiment, the bacteria are attenuated such that they are not capable of causing disease.
[0094] As mentioned, the bacteria of the vaccine disclosed herein present at least one cancer associated antigen.
[0095] Cancer-associated antigens are typically short peptides corresponding to one or more antigenic determinants of a protein. The cancer-associated antigen typically binds to a class I or II MHC receptor thus forming a ternary complex that can be recognized by a T-cell bearing a matching T-cell receptor binding to the MHC/peptide complex with appropriate affinity. Peptides binding to MHC class I molecules are typically about 8-14 amino acids in length. T-cell epitopes that bind to MHC class II molecules are typically about 12-30 amino acids in length. In the case of peptides that bind to MHC class II molecules, the same peptide and corresponding T cell epitope may share a common core segment, but differ in the overall length due to flanking sequences of differing lengths upstream of the amino-terminus of the core sequence and downstream of its carboxy terminus, respectively. A T-cell epitope may be classified as an antigen if it elicits an immune response.
[0096] A peptide sequence may be synthesized by methods known to those of ordinary skill in the art, such as, for example, peptide synthesis using automated peptide synthesis machines, such as those available from Applied Biosystems, Inc. (Foster City, Calif.). Longer peptides or polypeptides also may be prepared, e.g., by recombinant means.
[0097] The antigens for cancers can be antigens from testicular cancer, ovarian cancer, brain cancer such as glioblastoma, pancreatic cancer, melanoma, lung cancer, prostate cancer, hepatic cancer, breast cancer, rectal cancer, colon cancer, esophageal cancer, gastric cancer, renal cancer, sarcoma, neuroblastoma, Hodgkins and non-Hodgkins lymphoma and leukemia.
[0098] In one embodiment, the cancer-associated antigen is a cancer testis antigen (e.g. a member of the melanoma antigen protein (MAGE) family, Squamous Cell Carcinoma-1 (NY-ESO-1), BAGE (B melanoma antigen), LAGE-1 antigen, Brother of the Regulator of Imprinted Sites (BORIS) and members of the GAGE family).
[0099] In another embodiment, the cancer-associated antigen is derived from MART-1/Melan-A protein e.g. (MARTI MHC class I peptides (Melan-A:26-35(L27), ELAGIGILTV; SEQ ID NO: 1) and MHC class II peptides (Melan-A:51-73(RR-23) RNGYRALMDKSLHVGTQCALTRR; SEQ ID NO: 2).
[0100] In another embodiment, the cancer-associated antigen is derived from glycoprotein 70, glycoprotein 100 (gp100:25-33 (MHC class I (EGSRNQDWLSEQ ID NO: 7)) or gp100:44-59 MHC class II (WNRQLYPEWTEAQRLDSEQ ID NO: 8) peptides).
[0101] In still another embodiment, the cancer-associated antigen is derived from tyrosinase, tyrosinase-related protein 1 (TRP1), tyrosinase-related protein 2 (TRP-2) or TRP-2/INT2 (TRP-2/intron2).
[0102] In still another embodiment, the cancer-associated antigen comprises MUT30 (mutation in Kinesin family member 18B, Kif18bPSKPSFQEFVDWENVSPELNSTDQPFLSEQ ID NO: 9) or MUT44 (cleavage and polyadenylation specific factor 3-like, Cpsf31EFKHIKAFDRTFANNPGPMVVFATPGMSEQ ID NO: 10).
[0103] In still another embodiment, the cancer-associated antigen is derived from stimulator of prostatic adenocarcinoma-specific T cells-SPAS-1.
[0104] In still another embodiment, the cancer-associated antigen is derived from human telomerase reverse transcriptase (hTERT) or hTRT (human telomerase reverse transcriptase).
[0105] In still another embodiment, the cancer-associated antigen is derived from ovalbumin (OVA) for example OVA.sub.257-264 MHCI H-2Kb (SIINFEKLSEQ ID NO: 11) and OVA.sub.323-339 MHCII I-A(d) (ISQAVHAAHAEINEAGR SEQ ID NO: 12), a RAS mutation, mutant oncogenic forms of p53 (TP53) (p53mut (peptide antigen of mouse mutated p53.sub.R172H sequence VVRHCPHHERSEQ ID NO: 4 (human mutated p53.sub.R175H sequence EVVRHCPHHESEQ ID NO: 5)), or from BRAF-V600E peptide (GDFGLATEKSRWSGSSEQ ID NO: 13).
[0106] According to a particular embodiment, the cancer associated antigen is set forth in SEQ ID NO: 11.
[0107] In still another embodiment, the cancer-associated antigen is a breast cancer associated disease antigen including but not limited to -Lactalbumin (-Lac), Her2/neu, BRCA-2 or BRCA-1 (RNF53), KNG1K438-R457 (kininogen-1 peptide) and C3fS1304-R1320 (peptides that distinguish BRCA1 mutated from other BC and non-cancer mutated BRCA1).
[0108] In still another embodiment, the cancer-associated antigen is a colorectal cancer associated disease antigen including but not limited to MUC1, KRAS, CEA (CAP-1-6-D [Asp6]; YLSGADLNLSEQ ID NO: 14) and Adpgk.sub.R304M MC38 (MHCI-Adpgk: ASMTNMELM SEQ ID NO: 15; MHCII-Adpgk: GIPVHLELASMTNMELMSSIVHQQVFPT SEQ ID NO: 16).
[0109] In still another embodiment, the cancer-associated antigen is a pancreatic cancer associated disease antigen including but not limited to CEA, CA 19-9, MUC1, KRAS, p53mut (peptide antigen of mouse mutated p53.sub.R172H sequence VVRHCPHHERSEQ ID NO: 4 (human mutated p53.sub.R175H sequence EVVRHCPHHESEQ ID NO: 5)) and MUC4 or MUC13, MUC3A or CEACAM5, KRAS peptides (e.g. KRAS-G12R, KRAS-G13D, p 5-21 sequence KLVVVGAGGVGKSALTI (SEQ ID NO: 17), p 5-21 G12D sequence KLVVVGADGVGKSALTI (SEQ ID NO: 18), p 17-31 sequence SALTIQLIQNHFVDE (SEQ ID NO: 19), p 78-92 sequence FLCVFAINNTKSFED (SEQ ID NO: 20), p 156-170 sequence FYTLVREIRKHKEKM (SEQ ID NO: 21), NRAS (e.g. NRAS-Q61R), PI3K (e.g. PIK3CA-H1047R), C-Kit-D816V, and BRCA mutated epitopes YIHTHTFYV (SEQ ID NO: 22) and SQIWNLNPV (SEQ ID NO: 23) HLA-A*02:01 restricted neoepitopes.
[0110] In still another embodiment, the cancer-associated antigen is a lung cancer associated disease antigen including but not limited to Sperm Protein 17 (SP17), A-kinase anchor protein 4 (AKAP4) and Pituitary Tumor Transforming Gene 1 (PTTG1), Aurora kinase A, HER2/neu, and p53mut.
[0111] In still another embodiment, the cancer-associated antigen is a prostate cancer associated disease antigen such as prostate cancer antigen (PCA), prostate-specific antigen (PSA) or prostate-specific membrane antigen (PSMA).
[0112] In still another embodiment, the cancer-associated antigen is a brain cancer, specifically glioblastoma cancer associated disease antigen such as GL261 neoantigen (mImp3 D81N AALLNKLYASEQ ID NO: 6).
[0113] In another embodiment, the cancer-associated antigen is a tumor neoantigen.
[0114] As used herein the term neoantigen is an epitope that has at least one alteration that makes it distinct from the corresponding wild-type, parental antigen, e.g., via mutation in a tumor cell or post-translational modification specific to a tumor cell. A neoantigen can include a polypeptide sequence or a nucleotide sequence. A mutation can include a frameshift or nonframeshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF. A mutation can also include a splice variant. Post-translational modifications specific to a tumor cell can include aberrant phosphorylation. Post-translational modifications specific to a tumor cell can also include a proteasome-generated spliced antigen.
[0115] An example of a mutant APC antigen is QATEAERSF (SEQ ID NO: 3).
[0116] Examples of BRCA mutated epitopes are YIHTHTFYV (SEQ ID NO: 22) and SQIWNLNPV (SEQ ID NO: 23) HLA-A*02:01 restricted neoepitopes.
[0117] An examples of a universal HLA-DR-binding T helper synthetic epitope (AKFVAAWTLKAAA, SEQ ID NO: 311) is the pan DR-biding epitope (PADRE), which is a 13 amino acid peptide that activates CD4+ T cells.
[0118] Another contemplated cancer-associated neoantigen is the GL261 neoantigen (mImp3 D81N, sequence AALLNKLYASEQ ID NO: 6).
[0119] As mentioned, the cancer antigens are presented on the outer surface of the bacteria.
[0120] In some embodiments, the bacteria comprised in the vaccine are bound to a cancer associated antigen by a cross-linker. As used herein, the term cross-linker broadly refers to compositions that can be used to join various molecules, including proteins, together. Examples of cross-linkers include, but are not limited to, 1,5-difluoro-2,4-dinitrobenzene, 3,3-dithiobis(succinimidyl propionate), bis(2-succinimidooxycarbonyloxy)ethyl)sulfone, bis(sulfosuccinimidyl)suberate, dimethyl 3,3-dithiobispropionimidate, dimethyl adipimidate, dimethyl pimelimidate, dimethyl suberimidate, disuccinimidyl glutarate, disuccinimidyl suberate, disuccinimidyl tartrate, dithiobis(succinimidyl propionate), ethylene glycosl bis(succinimidyl succinate), ethylene glycosl bis(sulfosuccinimidyl succinate), PEGylated bis(sulfosuccinimidyl)suberate (with PEGS), PEGylated bis(sulfosuccinimidyl)suberate (with PEGS) and tris-(succinimidyl)aminotriacetate.
[0121] In some embodiments, the bacteria comprised in the vaccine are linked to a cancer associated antigen through a nucleic acid linker. For example, in some embodiments, the bacteria described herein display a first single-stranded nucleic acid oligonucleotide (e.g., an oligonucleotide of at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides in length and/or no more than 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 95 or 100 nucleotides in length) on their surface that can serve binding site for an agent that comprises and/or is linked to second nucleic acid oligonucleotide (e.g., an oligonucleotide of at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides in length and/or no more than 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nucleotides in length) that specifically hybridizes to the first nucleic acid oligonucleotide. Methods for attaching oligonucleotides to the surface of bacterial cells are known in the art and described in, for example, Twite A. A., et al., Adv. Mater., 2012, 24(18):2380-5, which is hereby incorporated by reference. In some embodiments, the first oligonucleotide has a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to a sequence of the second oligonucleotide. Exemplary methods for linking agents to oligonucleotides are provided, for example, in David A. Rusling & Keith R. Fox, Small Molecule-Oligonucleotide Conjugates, DNA Conjugates and Sensors, 2012, Ch3, 75-102, which is hereby incorporated by reference. In some embodiments, a cancer therapeutic is covalently linked to a single-stranded nucleic acid oligonucleotide that specifically hybridizes to a single-stranded nucleic acid oligonucleotide displayed on the cell surface of a bacteria described herein. The hybridized oligonucleotides hybridize and the resulting double-stranded nucleic acid duplex is stable for days. In some embodiments, the stability of the duplex is improved by incorporating phosphorothioate bonds (e.g., 1, 2, 3, 4, 5, 6, 7 or more phosphorothioate bonds) on the 5 and/or 3 ends of one or both oligonucleotides.
[0122] In some embodiments, the bacteria of the vaccine described herein are linked to a cancer associated antigen through a biotin/streptavidin interaction.
[0123] In some embodiments, the bacteria described herein are linked to biotin or to a cancer associated antigen using amine-reactive N-hydroxysuccinimide (NHS) esters or N-hydroxysulfosuccinimide (Sulfo-NHS) esters (adding PEG to NEH-esters may serve to keep the antigen extracellular). NHS esters or Sulfo-NHS esters (Life Technologies) can be made of virtually any carboxyl-containing molecule of interest by mixing the NHS or Sulfo-NHS with the carboxyl-containing molecule of interest and a dehydrating agent such as the carbodimide EDC using methods available in the art. Exemplary methods of labeling bacteria using NHS esters are provided in Bradburne J. A., et al., Appl. Environ. Microbiol, 1993, 59(3):663-8, which is hereby incorporated by reference.
[0124] The NHS ester binds directly to the cell wall. NHS esters, when conjugated to an alkyue group, can attach to any peptide with an azide residue by standard click chemistry.
[0125] Exemplary crosslinker reactive groups for protein conjugation are summarized in Table 4 herein below.
TABLE-US-00004 TABLE 4 Target functional Reactive chemical Reactivity Class group group Amine-reactive NH.sub.2 NHS ester Imidoester Pentafluorophenyl ester Hydroxymethyl phosphine Carboxyl to amine COOH Carbodiimide (e.g., EDC reactive Sulfhydryl-reactive SH Maleimide Haloacetyl (Bromo- or Iodo-) Pyridyldisulfide Thiosulfonate Vinylsulfone Aldehyde-reactive i.e. CHO Hydrazine oxidized sugars Alkoxyamine (carbonyls) Photo-reactive i.e. random Diazirine nonselective, random Aryl azide insertion Hydroxyl (nonaqueous)- OH Isocyanate reactive Azide-reactive N.sub.3 Phosphine
[0126] According to a particular embodiment, the cancer associated antigen peptide is generated such that it has NHS-ester at the C-terminal end. The NHS-ester is capable of binding to free amines present at the N-terminal of every protein or on lysines. In order to prevent the NHS-azide of one peptide from binding to free amines on another peptide, the N-terminal of the peptides may be modified (e.g. by acetylation) so that they no longer comprise a free amine. Alternatively, the lysines in the peptides may be protected so that their free amines are no longer exposed and reactive. Once the peptides are attached to the bacteria, this protection may be removed.
[0127] According to another embodiment, a hydrazine group may be attached to the cancer associated antigen peptide. This group is capable of binding to aldehyde containing moleculessuch as to a C-terminal of a protein as well as to the side chain of the amino acids aspartic and glutamic acid. The C-terminal of the cancer associated antigen peptide is typically protected. This method is preferred for peptides that do not have glutamic or aspartic acids in them.
[0128] In some embodiments, the bacteria of the vaccine described herein are linked to a cancer cancer associated antigen through a sequence-specific DNA hybridization interaction. For example, a molecule of interest is covalently linked to a single-stranded DNA oligonucleotide and then attached to a bacterial cell that displays the complementary single-stranded DNA oligonucleotide on its cell surface. The two complementary oligonucleotides hybridize and the resulting double-stranded DNA duplex is stable for days. The stability of the DNA duplex and resistance to nucleases is further improved by incorporating 4 phosphorothioate bonds on the 5 and 3 ends of both oligonucleotides.
[0129] In some embodiments, unnatural amino acids containing ketones, azides, alkynes or other functional groups that are incorporated into surface-expressed proteins of the bacteria described herein are used to link the bacteria to the cancer associated antigen. Unnatural amino acids containing ketones, azides, alkynes or other functional groups known to one skilled in the art can be incorporated into target proteins in a residue-specific manner using, for example, an auxotrophic bacterial strain as described in Marquis H., et aL, Infect. Immun., 1993, 61(9):3756-60, which is hereby incorporated by reference. For example, labeling of the bacterial cell surface can be accomplished by growing a methionine auxotrophic bacterial strain in the presence of the unnatural amino acid azidohomoalanine, which acts as a methionine surrogate and is incorporated during protein biosynthesis in place of methionine. Wild-type proteins on the bacterial surface that normally contain a surface-exposed methionine are now functionalized with a surface-exposed azide group, which can then modified with a molecule of interest that contains an alkyne group (e.g., an alkyne-derivatized small-molecule drug or an alkyne-derivatized protein) using Click Chemistry as described in Link A. J. & Tirrell D. A., Cell surface labeling of Escherichia coli via copper(I)-catalyzed [3+2] cycloaddition, J. Am. Chem. Soc., 2003, 125(37):11164-5, which is hereby incorporated by reference. After incorporation into the surface-expressed protein, these functional groups can serve as attachment points for a small-molecule of interest using, for example, the methods described in Prescher J. A. & Bertozzi C. R., Nat. Chem. Biol, 2005, 1(1):13-21, which is hereby incorporated by reference. In another embodiment, wild-type bacteria are cultured with a modified D-alanine, such as D-alanine azide, D-alanine-D-alanine azide, D-alanine alkyne, D-alanine-D-alanine alkyne and the neoantigens are attached to an azido or alkyne group. In another embodiment, a copper-free CLICK chemistry reaction is carried out to attach the cancer associated antigen to the bacteria) e.g. using DBCO-amine).
[0130] In some embodiments, the bacteria described herein is a gram-negative bacteria and the cancer associated antigen is linked to a surface-associated glycan. Linking a cancer associated antigen to a surface-associated glycan can be accomplished, for example, using a two-step metabolic/chemical labeling protocol. First, the surface-associated polymeric sugar is modified by metabolic labeling of the gram-negative bacterium with a chemically modified monosaccharide, which contains an azide functional group that is incorporated into the polymeric structure on the bacterial surface. Second, the cancer associated antigen is selectively ligated to the modified polymer on the bacterial cell surface using Click chemistry, for example, as described in Dumont A., et al., Angew. Chem. Int. Ed. Engl., 2012, 51(13):3143-6), which is hereby incorporated by reference.
[0131] In some embodiments, the cancer associated antigen is linked to the peptidoglycans (PG) of the bacterial cell wall. This may be relevant for gram positive or negative bacteria. However, the cell wall of gram-positive bacteria comprises many interconnected layers of peptidoglycan (PG), whereas the cell wall of gram-negative bacteria comprises only one or two layers of peptidoglycan. Accordingly, linking to PGs of bacteria may be more relevant for gram positive bacteria.
[0132] A two-step metabolic/chemical labeling approach can be used for attaching an exogenously added molecule of interest to the PG. The gram-positive bacterial cells are first metabolically labeled by growing the cells in the presence of an alkyne-functionalized D alanine analog, which is incorporated into nascent PG layers during cell wall biosynthesis. Incorporation of the alkyne group then allows labeling of the PG with an azide-functionalized molecule of interest using the copper-catalyzed Click reaction as described in, for example, Siegrist M. S., et al., ACS Chem. Biol., 2013, 8(3):500-5, which is hereby incorporated by reference. In some embodiments, the gram-positive bacterial cells are grown in medium that contains a cyclooctyne-functionalized D alanine analog (e.g., exobenDala or endobenDala), which is then incorporated into the PG of the growing cells. The cells are washed with fresh medium and incubated with a cancer associated antigen that is derivatized with an azido-PEG3 group to attach the molecule of interest to the PG in a copper-free reaction as described in, for example, Shieh P., et al., Proc. Natl. Acad. Sci. USA, 2014, 111(15):5456-61, which is hereby incorporated by reference. In some embodiments, the gram-positive bacterial cells are grown in medium that contains an unnatural D-amino acid with a norbornene (NB) group (e.g., D-Lys-NB-OH, D-Dap-NB-OH, D-Dap-NB-NH.sub.2). The unnatural amino acid is metabolically incorporated into the PG of the growing bacterial cells and equips the bacterial cell surface with alkene functional groups with increased reactivity because of the strained alkene within the ring of the norbornene. The cells are then incubated with a tetrazine derivative of the cancer ther associated antigen apeutic to allow ligation of the cancer associated antigen to the PG, as described in Pidgeon S. E. & Pires M. M., Chem. Commun. (Camb). 2015, 51(51):10330-3, which is hereby incorporated by reference.
[0133] In some embodiments, a cancer associated antigen is incorporated into the PG layer of a gram-negative bacterium described herein. Methods for incorporation molecules into the PG layer of a gram-negative bacterium are provided, for example, in Liechti G. W., et al., Nature, 2014, 506(7489):507-10, which is hereby incorporated by reference. In some embodiments, the gram-negative bacterium is grown in the presence of the D amino acid dipeptide EDA-DA (ethynyl-D alanine-D alanine) or DA-EDA (D alanine-ethynyl-D alanine). The EDA-DA, or DA-EDA, is incorporated into the PG layer of the actively growing bacteria and equips the PG with surface-exposed alkyne groups. Copper-catalyzed Click chemistry is used to attach a cancer associated antigen that contains a terminal azide group to the newly introduced alkyne groups of the PG layer. In some embodiments, a D amino acid derivative of a cancer associated antigen is be incorporated directly into the PG layer of a growing bacterium using, for example, the method described in Kuru E., et al., Nat. Protoc., 2015, 10(1):33-52, which is hereby incorporated by reference.
[0134] In order to carry out click chemistry, the cancer associated antigen may comprise at least one reactive group selected from the group consisting of an alkene group, an alkyne group, an azide group, a cyclopropenyl group, a tetrazine group, a dibenzocyclooctyl (DBCO) group, a dibenzocyclooctine (DIBO) group, a bicyclononine (BCN) group, a Trans-Cyclooctene (TCO) group and a strained Trans-Cyclooctene (sTCO) group.
[0135] Methods of attaching the cancer associated antigen to the reactive groups are known in the art and are described in Johansson and Pedersen, European Journal of Organic Chemistry, Volume 2012, Issue 23, August 2012, pages 4267-4281.
[0136] Once the reactive groups are attached to amino acids, peptides may be synthesized according to techniques that are known to those skilled in the art of peptide synthesis. For solid phase peptide synthesis, a summary of the many techniques may be found in J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, W. H. Freeman Co. (San Francisco), 1963 and J. Meienhofer, Hormonal Proteins and Peptides, vol. 2, p. 46, Academic Press (New York), 1973. For classical solution synthesis see G. Schroder and K. Lupke, The Peptides, vol. 1, Academic Press (New York), 1965.
[0137] In general, these methods comprise the sequential addition of one or more amino acids or suitably protected amino acids to a growing peptide chain. Normally, either the amino or carboxyl group of the first amino acid is protected by a suitable protecting group. The protected or derivatized amino acid can then either be attached to an inert solid support or utilized in solution by adding the next amino acid in the sequence having the complimentary (amino or carboxyl) group suitably protected, under conditions suitable for forming the amide linkage. The protecting group is then removed from this newly added amino acid residue and the next amino acid (suitably protected) is then added, and so forth. After all the desired amino acids have been linked in the proper sequence, any remaining protecting groups (and any solid support) are removed sequentially or concurrently, to afford the final peptide compound. By simple modification of this general procedure, it is possible to add more than one amino acid at a time to a growing chain, for example, by coupling (under conditions which do not racemize chiral centers) a protected tripeptide with a properly protected dipeptide to form, after deprotection, a pentapeptide and so forth. Further description of peptide synthesis is disclosed in U.S. Pat. No. 6,472,505.
[0138] A preferred method of preparing the peptide compounds of some embodiments of the invention involves solid phase peptide synthesis.
[0139] Large scale peptide synthesis is described by Andersson Biopolymers 2000; 55(3):227-50.
[0140] The present inventors further contemplate that the bacteria of the vaccine may comprise therapeutic agents other than the cancer associated antigens described herein above. Such therapeutic agents may be attached to the outside of the bacteria using an attachment method described herein above. Alternatively, the bacteria may be genetically modified to express the therapeutic agent.
[0141] For example, in some embodiments, the bacteria comprises a nucleic acid encoding the therapeutic agent operably linked to transcriptional regulatory elements, such as a bacterial promotor. The transcriptional regulatory element can further comprise a secretion signal. In some embodiments, the therapeutic agent is constitutively expressed by the bacteria. In some embodiments, the therapeutic antigen is inducibly expressed by the bacteria (e.g., it is expressed upon exposure to a sugar or an environmental stimulus like low pH or an anaerobic environment). In some embodiments, the bacteria comprises a plurality of nucleic acid sequences that encode for multiple therapeutic agents that can be expressed by the same bacterial cell.
[0142] Examples of bacterial promoters include but are not limited to STM1787 promoter, pepT promoter, pfIE promoter, ansB promoter, vhb promoter, FF+20* promoter or p(luxI) promoter.
[0143] Examples of therapeutic agents include immune modulatory proteins, such as a cytokine. Examples of immune modulating proteins include, but are not limited to, B lymphocyte chemoattractant (BLC), C-C motif chemokine 11 (Eotaxin-1), Eosinophil chemotactic protein 2 (Eotaxin-2), Granulocyte colony-stimulating factor (G-CSF), Granulocyte macrophage colony-stimulating factor (GM-CSF), 1-309, Intercellular Adhesion Molecule 1 (ICAM-1), Interferon gamma (IFN-gamma), Interlukin-1 alpha (IL-1 alpha), Interlukin-1 beta (IL-1 beta), Interleukin 1 receptor antagonist (IL-1ra), Interleukin-2 (IL-2), Interleukin-4 (IL-4), Interleukin-5 (IL-5), Interleukin-6 (IL-6), Interleukin-6 soluble receptor (IL-6 sR), Interleukin-7 (IL-7), Interleukin-8 (IL-8), Interleukin-10 (IL-10), Interleukin-11 (IL-11), Subunit beta of Interleukin-12 (IL-12 p 40 or IL-12 p 70), Interleukin-13 (IL-13), Interleukin-(IL-15), Interleukin-16 (IL-16), Interleukin-17 (IL-17), Chemokine (C-C motif) Ligand 2 (MCP-1), Macrophage colony-stimulating factor (M-CSF), Monokine induced by gamma interferon (MIG), Chemokine (C-C motif) ligand 2 (MIP-1 alpha), Chemokine (C-C motif) ligand 4 (MIP-1 beta), Macrophage inflammatory protein-1-delta (MIP-1 delta), Platelet-derived growth factor subunit B (PDGF-BB), Chemokine (C-C motif) ligand 5, Regulated on Activation, Normal T cell Expressed and Secreted (RANTES), TIMP metallopeptidase inhibitor 1 (TIMP-1), TIMP metallopeptidase inhibitor 2 (TIMP-2), Tumor necrosis factor, lymphotoxin-alpha (TNF alpha), Tumor necrosis factor, lymphotoxin-beta (TNF beta), Soluble TNF receptor type 1 (sTNFRI), sTNFRIIAR, Brain-derived neurotrophic factor (BDNF), Basic fibroblast growth factor (bFGF), Bone morphogenetic protein 4 (BMP-4), Bone morphogenetic protein 5 (BMP-5), Bone morphogenetic protein 7 (BMP-7), Nerve growth factor (b-NGF), Epidermal growth factor (EGF), Epidermal growth factor receptor (EGFR), Endocrine-gland-derived vascular endothelial growth factor (EG-VEGF), Fibroblast growth factor 4 (FGF-4), Keratinocyte growth factor (FGF-7), Growth differentiation factor 15 (GDF-15), Glial cell-derived neurotrophic factor (GDNF), Growth Hormone, Heparin-binding EGF-like growth factor (HB-EGF), Hepatocyte growth factor (HGF), Insulin-like growth factor binding protein 1 (IGFBP-1), Insulin-like growth factor binding protein 2 (IGFBP-2), Insulin-like growth factor binding protein 3 (IGFBP-3), Insulin-like growth factor binding protein 4 (IGFBP-4), Insulin-like growth factor binding protein 6 (IGFBP-6), Insulin-like growth factor 1 (IGF-1), Insulin, Macrophage colony-stimulating factor (M-CSF R), Nerve growth factor receptor (NGF R), Neurotrophin-3 (NT-3), Neurotrophin-4 (NT-4), Osteoclastogenesis inhibitory factor (Osteoprotegerin), Platelet-derived growth factor receptors (PDGF-AA), Phosphatidylinositol-glycan biosynthesis (PIGF), Skp, Cullin, F-box containing comples (SCF), Stem cell factor receptor (SCF R), Transforming growth factor alpha (TGFalpha), Transforming growth factor beta-1 (TGF beta 1), Transforming growth factor beta-3 (TGF beta 3), Vascular endothelial growth factor (VEGF), Vascular endothelial growth factor receptor 2 (VEGFR2), Vascular endothelial growth factor receptor 3 (VEGFR3), VEGF-D 6Ckine, Tyrosine-protein kinase receptor UFO (Axl), Betacellulin (BTC), Mucosae-associated epithelial chemokine (CCL28), Chemokine (C-C motif) ligand 27 (CTACK), Chemokine (C-X-C motif) ligand 16 (CXCL16), C-X-C motif chemokine 5 (ENA-78), Chemokine (C-C motif) ligand 26 (Eotaxin-3), Granulocyte chemotactic protein 2 (GCP-2), GRO, Chemokine (C-C motif) ligand 14 (HCC-1), Chemokine (C-C motif) ligand 16 (HCC-4), Interleukin-9 (IL-9), Interleukin-17 F (IL-17F), Interleukin-18-binding protein (IL-18 BPa), Interleukin-28 A (IL-28A), Interleukin 29 (IL-29), Interleukin 31 (IL-31), C-X-C motif chemokine 10 (IP-10), Chemokine receptor CXCR3 (I-TAC), Leukemia inhibitory factor (LIF), Light, Chemokine (C motif) ligand (Lymphotactin), Monocyte chemoattractant protein 2 (MCP-2), Monocyte chemoattractant protein 3 (MCP-3), Monocyte chemo attractant protein 4 (MCP-4), Macrophage-derived chemokine (MDC), Macrophage migration inhibitory factor (MIF), Chemokine (C-C motif) ligand 20 (MIP-3 alpha), C-C motif chemokine 19 (MIP-3 beta), Chemokine (C-C motif) ligand 23 (MPIF-1), Macrophage stimulating protein alpha chain (MSPalpha), Nucleosome assembly protein 1-like 4 (NAP-2), Secreted phosphoprotein 1 (Osteopontin), Pulmonary and activation-regulated cytokine (PARC), Platelet factor 4 (PF4), Stroma cell-derived factor-1 alpha (SDF-1 alpha), Chemokine (C-C motif) ligand 17 (TARC), Thymus-expressed chemokine (TECK), Thymic stromal lymphopoietin (TSLP 4-IBB), CD 166 antigen (ALCAM), Cluster of Differentiation 80 (B7-1), Tumor necrosis factor receptor superfamily member 17 (BCMA), Cluster of Differentiation 14 (CD14), Cluster of Differentiation 30 (CD30), Cluster of Differentiation 40 (CD40 Ligand), Carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM-1), Death Receptor 6 (DR6), Deoxythymidine kinase (Dtk), Type 1 membrane glycoprotein (Endoglin), Receptor tyrosine-protein kinase erbB-3 (ErbB3), Endothelial-leukocyte adhesion molecule 1 (E-Selectin), Apoptosis antigen 1 (Fas), Fms-like tyrosine kinase 3 (Flt-3L), Tumor necrosis factor receptor superfamily member 1 (GITR), Tumor necrosis factor receptor superfamily member 14 (HVEM), Intercellular adhesion molecule 3 (ICAM-3), IL-1 R4, IL-1 RI, IL-10 Rbeta, IL-17R, IL-2Rgamma, IL-21R, Lysosome membrane protein 2 (LIMPII), Neutrophil gelatinase-associated lipocalin (Lipocalin-2), CD62L (L-S electin), Lymphatic endothelium (LYVE-1), MEC class I polypeptide-related sequence A (MICA), MEC class I polypeptide-related sequence B (MICB), NRG1-beta1, Beta-type platelet-derived growth factor receptor (PDGF Rbeta), Platelet endothelial cell adhesion molecule (PECAM-1), RAGE, Hepatitis A virus cellular receptor 1 (TIM-1), Tumor necrosis factor receptor superfamily member IOC (TRAIL R3), Trappin protein transglutaminase binding domain (Trappin-2), Urokinase receptor (uPAR), Vascular cell adhesion protein 1 (VCAM-1), XEDARActivin A, Agouti-related protein (AgRP), Ribonuclease 5 (Angiogenin), Angiopoietin 1, Angiostatin, Catheprin S, CD40, Cryptic family protein IB (Cripto-1), DAN, Dickkopf-related protein 1 (DKK-1), E-Cadherin, Epithelial cell adhesion molecule (EpCAM), Fas Ligand (FasL or CD95L), Fcg RIIB/C, FoUistatin, Galectin-7, Intercellular adhesion molecule 2 (ICAM-2), IL-13 R1, IL-13R2, IL-17B, IL-2 Ra, IL-2 Rb, IL-23, LAP, Neuronal cell adhesion molecule (NrCAM), Plasminogen activator inhibitor-1 (PAI-1), Platelet derived growth factor receptors (PDGF-AB), Resistin, stromal cell-derived factor 1 (SDF-1 beta), sgp130, Secreted frizzled-related protein 2 (ShhN), Sialic acid-binding immunoglobulin-type lectins (Siglec-5), ST2, Transforming growth factor-beta 2 (TGF beta 2), Tie-2, Thrombopoietin (TPO), Tumor necrosis factor receptor superfamily member 10D (TRAIL R4), Triggering receptor expressed on myeloid cells 1 (TREM-1), Vascular endothelial growth factor C (VEGF-C), VEGFR1Adiponectin, Adipsin (AND), Alpha-fetoprotein (AFP), Angiopoietin-like 4 (ANGPTL4), Beta-2-microglobulin (B2M), Basal cell adhesion molecule (BCAM), Carbohydrate antigen 125 (CA125), Cancer Antigen 15-3 (CA15-3), Carcinoembryonic antigen (CEA), cAMP receptor protein (CRP), Human Epidermal Growth Factor Receptor 2 (ErbB2), Follistatin, Follicle-stimulating hormone (FSH), Chemokine (C-X-C motif) ligand 1 (GRO alpha), human chorionic gonadotropin (beta HCG), Insulin-like growth factor 1 receptor (IGF-1 sR), IL-1 sRII, IL-3, IL-18 Rb, IL-21, Leptin, Matrix metalloproteinase-1 (MMP-1), Matrix metalloproteinase-2 (MMP-2), Matrix metalloproteinase-3 (MMP-3), Matrix metalloproteinase-8 (MMP-8), Matrix metalloproteinase-9 (MMP-9), Matrix metalloproteinase-10 (MMP-10), Matrix metalloproteinase-13 (MMP-13), Neural Cell Adhesion Molecule (NCAM-1), Entactin (Nidogen-1), Neuron specific enolase (NSE), Oncostatin M (OSM), Procalcitonin, Prolactin, Prostate specific antigen (PSA), Sialic acid-binding Ig-like lectin 9 (Siglec-9), ADAM 17 endopeptidase (TACE), Thyroglobulin, Metalloproteinase inhibitor 4 (TIMP-4), TSH2B4, Disintegrin and metalloproteinase domain-containing protein 9 (ADAM-9), Angiopoietin 2, Tumor necrosis factor ligand superfamily member 13/Acidic leucine-rich nuclear phosphoprotein 32 family member B (APRIL), Bone morphogenetic protein 2 (BMP-2), Bone morphogenetic protein 9 (BMP-9), Complement component 5a (C5a), Cathepsin L, CD200, CD97, Chemerin, Tumor necrosis factor receptor superfamily member 6B (DcR3), Fatty acid-binding protein 2 (FABP2), Fibroblast activation protein, alpha (FAP), Fibroblast growth factor 19 (FGF-19), Galectin-3, Hepatocyte growth factor receptor (HGF R), IFN-gammalpha/beta R2, Insulin-like growth factor 2 (IGF-2), Insulin-like growth factor 2 receptor (IGF-2 R), Interleukin-1 receptor 6 (IL-1R6), Interleukin 24 (IL-24), Interleukin 33 (IL-33, Kallikrein 14, Asparaginyl endopeptidase (Legumain), Oxidized low-density lipoprotein receptor 1 (LOX-1), Mannose-binding lectin (MBL), Neprilysin (NEP), Notch homolog 1, translocation-associated (Drosophila) (Notch-1), Nephroblastoma overexpressed (NOV), Osteoactivin, Programmed cell death protein 1 (PD-1), N-acetylmuramoyl-L-alanine amidase (PGRP-5), Serpin A4, Secreted frizzled related protein 3 (sFRP-3), Thrombomodulin, Tolllike receptor 2 (TLR2), Tumor necrosis factor receptor superfamily member 10A (TRAIL R1), Transferrin (TRF), WIF-1ACE-2, Albumin, AMICA, Angiopoietin 4, B-cell activating factor (BAFF), Carbohydrate antigen 19-9 (CA19-9), CD 163, Clusterin, CRT AM, Chemokine (C-X-C motif) ligand 14 (CXCL14), Cystatin C, Decorin (DCN), Dickkopf-related protein 3 (Dkk-3), Delta-like protein 1 (DLL1), Fetuin A, Heparin-binding growth factor 1 (aFGF), Folate receptor alpha (FOLR1), Furin, GPCR-associated sorting protein 1 (GASP-1), GPCR-as sociated sorting protein 2 (GASP-2), Granulocyte colony-stimulating factor receptor (GCSF R), Serine protease hep sin (HAI-2), Interleukin-17B Receptor (IL-17B R), Interleukin 27 (IL-27), Lymphocyte-activation gene 3 (LAG-3), Apolipoprotein A-V (LDL R), Pepsinogen I, Retinol binding protein 4 (RBP4), SOST, Heparan sulfate proteoglycan (Syndecan-1), Tumor necrosis factor receptor superfamily member 13B (TACI), Tissue factor pathway inhibitor (TFPI), TSP-1, Tumor necrosis factor receptor superfamily, member 10b (TRAIL R2), TRANCE, Troponin I, Urokinase Plasminogen Activator (uPA), Cadherin 5, type 2 or VE-cadherin (vascular endothelial) also known as CD144 (VE-Cadherin), WNT1-inducible-signaling pathway protein 1 (WISP-1), and Receptor Activator of Nuclear Factor.kappa.B (RANK). The immune modulatory protein can be made recombinantly using methods known to one skilled in the art. The immune modulatory protein can be presented on the surface of a bacterium using bacterial surface display, where the bacterium expresses a genetically engineered protein-protein fusion of e.g., a membrane protein and the immune modulatory protein.
[0144] In some embodiments, the bacteria described herein are engineered to express a therapeutic protein (e.g., a protein cancer therapeutic), intracellularly and/or on the bacterial surface (i.e., genetic surface display). For example, in some embodiments, the bacteria comprises a nucleic acid encoding protein cancer therapeutic operably linked to transcriptional regulatory elements, such as a promotor. In some embodiments, the protein is constitutively expressed by the bacteria. In some embodiments, the protein is inducibly expressed by the bacteria (e.g., it is expressed upon exposure to a sugar or an environmental stimulus like low pH or an anaerobic environment). In some embodiments, the bacteria comprises a plurality of nucleic acid sequences that encode for multiple different recombinant proteins that can be expressed by the same bacterial cell.
[0145] In some embodiments, the bacteria displays a recombinantly produced cancer therapeutic on its surface using a bacterial surface display system. Examples of bacterial surface display systems include outer membrane protein systems (e.g., LamB, FhuA, Ompl, OmpA, OmpC, OmpT, eCPX derived from OmpX, OprF, and PgsA), surface appendage systems (e.g., F pillin, FimH, FimA, FliC, and FliD), lipoprotein systems (e.g., INP, Lpp-OmpA, PAL, Tat-dependent, and TraT), and virulence factor-based systems (e.g., AIDA-1, EaeA, EstA, EspP, MSP1 a, and invasin). Exemplary surface display systems are described, for example, in van Bloois, E., et al., Trends in Biotechnology, 2011, 29:79-86, which is hereby incorporated by reference.
[0146] In some embodiments, the bacteria described herein comprise a cancer therapeutic (e.g., the cancer therapeutic is loaded into the bacteria prior to administration to a subject). In some embodiments, the cancer therapeutic is loaded into the bacteria by growing the bacteria in a medium that contains a high concentration (e.g., at least 1 mM) of the cancer therapeutic, which leads to either uptake of the cancer therapeutic during cell growth or binding of the cancer therapeutic to the outside of the bacteria. The cancer therapeutic can be taken up passively (e.g. by diffusion and/or partitioning into the lipophilic cell membrane) or actively through membrane channels or transporters. In some embodiments, drug loading is improved by adding additional substances to the growth medium that either increase uptake of the molecule of interest (e.g., Pluronic F-127) or prevent extrusion of the molecules after uptake by the bacterium (e.g., efflux pump inhibitors like Verapamil, Reserpine, Carsonic acid, or Piperine). In some embodiments, the bacteria is loaded with the cancer therapeutic by mixing the bacteria with the cancer therapeutic and then subjecting the mixture to electroporation, for example, as described in Sustarsic M., et al., Cell Biol., 2014, 142(1):113-24, which is hereby incorporated by reference. In some embodiments, the cells can also be treated with an efflux pump inhibitor (see above) after the electroporation to prevent extrusion of the loaded molecules.
[0147] In some embodiments the bacteria of the vaccine comprise an inhibitory antibody or small molecule directed against the immune checkpoint proteine.g. anti-CTLA4, anti-CD40, anti-41BB, anti-OX40, anti-PD1 and anti-PDLL
[0148] The bacteria of the vaccine of the present invention may serve as an adjuvant, thereby rendering the use of additional adjuvant not relevant.
[0149] In one embodiment, the vaccine is devoid of adjuvant (other than the bacteria itself).
[0150] In another embodiment, the vaccine comprises an adjuvant additional to the bacteria.
[0151] Adjuvants are substance that can be added to an immunogen or to a vaccine formulation to enhance the immune-stimulating properties of the immunogenic moiety. Examples of adjuvants or agents that may add to the effectiveness of proteinaceous immunogens include aluminum hydroxide, aluminum phosphate, aluminum potassium sulfate (alum), beryllium sulfate, silica, kaolin, carbon, water-in-oil emulsions, and oil-in-water emulsions. A particular type of adjuvant is muramyl dipeptide (MDP) and various MDP derivatives and formulations, e.g., N-acetyl-D-glucosaminyl-(.beta.1-4)-N-acetylmuramyl-L-alanyl-D-isoglutamine (GMDP) (Hornung, R L et al. Ther Immunol 1995 2:7-14) or ISAF-1 (5% squalene, 2.5% pluronic L121, 0.2% Tween 80 in phosphate-buffered solution with 0.4 mg of threonyl-muramyl dipeptide; see Kwak, L W et al. (1992) N. Engl. J. Med., 327:1209-1238). Other useful adjuvants are, or are based on, cholera toxin, bacterial endotoxin, lipid X, whole organisms or subcellular fractions of the bacteria Propionobacterium acnes or Bordetella pertussis, polyribonucleotides, sodium alginate, lanolin, lysolecithin, vitamin A, saponin and saponin derivatives such as QS21 (White, A. C. et al. (1991) Adv. Exp. Med. Biol., 303:207-210) which is now in use in the clinic (Helling, F et al. (1995) Cancer Res., 55:2783-2788; Davis, T A et al. (1997) Blood, 90: 509), levamisole, DEAE-dextran, blocked copolymers or other synthetic adjuvants. A number of adjuvants are available commercially from various sources, for example, Merck Adjuvant 65 (Merck and Company, Inc., Rahway, N.J.) or Freund's Incomplete Adjuvant and Complete Adjuvant (Difco Laboratories, Detroit, Mich.), Amphigen (oil-in-water), Alhydrogel (aluminum hydroxide), or a mixture of Amphigen and Alhydrogel. Aluminum is approved for human use.
[0152] As mentioned, the vaccines described herein may be used to treat and/or prevent cancer.
[0153] As used herein, the term treating includes abrogating, substantially inhibiting, slowing or reversing the progression of a condition, substantially ameliorating clinical or aesthetical symptoms of a condition.
[0154] According to a particular embodiment, the term preventing refers to substantially preventing the appearance of clinical or aesthetical symptoms of a condition.
[0155] Particular subjects which are treated are mammalian subjectse.g. humans.
[0156] According to a particular embodiment, the subject has been diagnosed as having cancer.
[0157] Cancer
[0158] The term cancer as used herein refers to an uncontrolled, abnormal growth of a host's own cells which may lead to invasion of surrounding tissue and potentially tissue distal to the initial site of abnormal cell growth in the host. Major classes include carcinomas which are cancers of the epithelial tissue (e.g., skin, squamous cells); sarcomas which are cancers of the connective tissue (e.g., bone, cartilage, fat, muscle, blood vessels, etc.); leukemias which are cancers of blood forming tissue (e.g., bone marrow tissue); lymphomas and myelomas which are cancers of immune cells; and central nervous system cancers which include cancers from brain and spinal tissue. Cancer(s), neoplasm(s), and tumor(s) are used herein interchangeably. As used herein, cancer refers to all types of cancer or neoplasm or malignant tumors including leukemias, carcinomas and sarcomas, whether new or recurring.
[0159] Specific examples of cancers that may be treated using the bacteria described herein include, but are not limited to adrenocortical carcinoma, hereditary; bladder cancer; breast cancer; breast cancer, ductal; breast cancer, invasive intraductal; breast cancer, sporadic; breast cancer, susceptibility to; breast cancer, type 4; breast cancer, type 4; breast cancer-1; breast cancer-3; breast-ovarian cancer; triple negative breast cancer, Burkitt's lymphoma; cervical carcinoma; colorectal adenoma; colorectal cancer; colorectal cancer, hereditary nonpolyposis, type 1; colorectal cancer, hereditary nonpolyposis, type 2; colorectal cancer, hereditary nonpolyposis, type 3; colorectal cancer, hereditary nonpolyposis, type 6; colorectal cancer, hereditary nonpolyposis, type 7; dermatofibrosarcoma protuberans; endometrial carcinoma; esophageal cancer; gastric cancer, fibrosarcoma, glioblastoma multiforme; glomus tumors, multiple; hepatoblastoma; hepatocellular cancer; hepatocellular carcinoma; leukemia, acute lymphoblastic; leukemia, acute myeloid; leukemia, acute myeloid, with eosinophilia; leukemia, acute nonlymphocytic; leukemia, chronic myeloid; Li-Fraumeni syndrome; liposarcoma, lung cancer; lung cancer, small cell; lymphoma, non-Hodgkin's; lynch cancer family syndrome II; male germ cell tumor; mast cell leukemia; medullary thyroid; medulloblastoma; melanoma, malignant melanoma, meningioma; multiple endocrine neoplasia; multiple myeloma, myeloid malignancy, predisposition to; myxosarcoma, neuroblastoma; osteosarcoma; osteocarcinoma, ovarian cancer; ovarian cancer, serous; ovarian carcinoma; ovarian sex cord tumors; pancreatic cancer; pancreatic endocrine tumors; paraganglioma, familial nonchromaffin; pilomatricoma; pituitary tumor, invasive; prostate adenocarcinoma; prostate cancer; renal cell carcinoma, papillary, familial and sporadic; retinoblastoma; rhabdoid predisposition syndrome, familial; rhabdoid tumors; rhabdomyosarcoma; small-cell cancer of lung; soft tissue sarcoma, squamous cell carcinoma, basal cell carcinoma, head and neck; T-cell acute lymphoblastic leukemia; Turcot syndrome with glioblastoma; tylosis with esophageal cancer; uterine cervix carcinoma, Wilms' tumor, type 2; and Wilms' tumor, type 1, and the like.
[0160] According to a particular embodiment, the cancer is cancer is selected from the group consisting of breast, melanoma, pancreatic cancer, ovarian cancer, bone cancer and brain cancer (e.g. glioblastoma).
[0161] According to another embodiment, the cancer is melanoma.
[0162] Malignant melanomas are clinically recognized based on the ABCD(E) system, where A stands for asymmetry, B for border irregularity, C for color variation, D for diameter >5 mm, and E for evolving. Further, an excision biopsy can be performed in order to corroborate a diagnosis using microscopic evaluation. Infiltrative malignant melanoma is traditionally divided into four principal histopathological subgroups: superficial spreading melanoma (SSM), nodular malignant melanoma (NMM), lentigo maligna melanoma (LMM), and acral lentiginous melanoma (ALM). Other rare types also exists, such as desmoplastic malignant melanoma. A substantial subset of malignant melanomas appear to arise from melanocytic nevi and features of dysplastic nevi are often found in the vicinity of infiltrative melanomas. Melanoma is thought to arise through stages of progression from normal melanocytes or nevus cells through a dysplastic nevus stage and further to an in situ stage before becoming invasive. Some of the subtypes evolve through different phases of tumor progression, which are called radial growth phase (RGP) and vertical growth phase (VGP).
[0163] In a particular embodiment, the melanoma resistant to treatment with inhibitors of BRAF and/or MEK.
[0164] The tumor may be a primary tumor or a secondary tumor (i.e. metastasized tumor).
[0165] The compositions may be administered using any route such as for example oral administration, rectal administration, topical administration, inhalation (nasal) or injection. Administration by injection includes intravenous (IV), intramuscular (IM), intratumoral (IT), subtumoral (ST), peritumoral (PT), and subcutaneous (SC) administration. The pharmaceutical compositions described herein can be administered in any form by any effective route, including but not limited to intratumoral, oral, parenteral, enteral, intravenous, intraperitoneal, topical, transdermal (e.g., using any standard patch), intradermal, ophthalmic, (intra)nasally, local, non-oral, such as aerosol, inhalation, subcutaneous, intramuscular, buccal, sublingual, (trans)rectal, vaginal, intra-arterial, and intrathecal, transmucosal (e.g., sublingual, lingual, (trans)buccal, (trans)urethral, vaginal (e.g., trans- and perivaginally), intravesical, intrapulmonary, intraduodenal, intragastrical, and intrabronchial. In preferred embodiments, the pharmaceutical compositions described herein are administered orally, rectally, intratumorally, topically, intravesically, by injection into or adjacent to a draining lymph node, intravenously, by inhalation or aerosol, or subcutaneously.
[0166] The present invention contemplates at least 2 different vaccination cycles for the treatment of cancer, wherein at least one of the vaccination cycles includes one strain of bacteria and at least another of the vaccination cycles includes a second (non-identical strain of bacteria). Additionally, or alternatively, the present inventors contemplate at least one of the vaccination cycles includes viable bacteria and at least another of the vaccination cycles (e.g. a subsequent vaccination) includes attenuated (or dead) bacteria.
[0167] The vaccine of the present invention may be administered with additional anti-cancer agents.
[0168] In some embodiments the additional anti-cancer agent is an inhibitory antibody or small molecule directed against the immune checkpoint proteine.g. anti-CTLA4, anti-CD40, anti-41BB, anti-OX40, anti-PD1 and anti-PDL1.
[0169] Other contemplated anti-cancer agents which may be administered to the subject, in combination with the bacteria described herein include, but are not limited to Acivicin; Aclarubicin; Acodazole Hydrochloride; Acronine; Adriamycin; Adozelesin; Aldesleukin; Altretamine; Ambomycin; Ametantrone Acetate; Aminoglutethimide; Amsacrine; Anastrozole; Anthramycin; Asparaginase; Asperlin; Azacitidine; Azetepa; Azotomycin; Batimastat; Benzodepa; Bicalutamide; Bisantrene Hydrochloride; Bisnafide Dimesylate; Bizelesin; Bleomycin Sulfate; Brequinar Sodium; Bropirimine; Busulfan; Cactinomycin; Calusterone; Caracemide; Carbetimer; Carboplatin; Carmustine; Carubicin Hydrochloride; Carzelesin; Cedefingol; Chlorambucil; Cirolemycin; Cisplatin; Cladribine; Crisnatol Mesylate; Cyclophosphamide; Cytarabine; Dacarbazine; Dactinomycin; Daunorubicin Hydrochloride; Decitabine; Dexormaplatin; Dezaguanine; Dezaguanine Mesylate; Diaziquone; Docetaxel; Doxorubicin; Doxorubicin Hydrochloride; Droloxifene; Droloxifene Citrate; Dromostanolone Propionate; Duazomycin; Edatrexate; Eflornithine Hydrochloride; Elsamitrucin; Enloplatin; Enpromate; Epipropidine; Epirubicin Hydrochloride; Erbulozole; Esorubicin Hydrochloride; Estramustine; Estramustine Phosphate Sodium; Etanidazole; Etoposide; Etoposide Phosphate; Etoprine; Fadrozole Hydrochloride; Fazarabine; Fenretinide; Floxuridine; Fludarabine Phosphate; Fluorouracil; Flurocitabine; Fosquidone; Fostriecin Sodium; Gemcitabine; Gemcitabine Hydrochloride; Hydroxyurea; Idarubicin Hydrochloride; Ifosfamide; Ilmofosine; Interferon Alfa-2a; Interferon Alfa-2b; Interferon Alfa-n1; Interferon Alfa-n3; Interferon Beta-I a; Interferon Gamma-I b; Iproplatin; Irinotecan Hydrochloride; Lanreotide Acetate; Letrozole; Leuprolide Acetate; Liarozole Hydrochloride; Lometrexol Sodium; Lomustine; Losoxantrone Hydrochloride; Masoprocol; Maytansine; Mechlorethamine Hydrochloride; Megestrol Acetate; Melengestrol Acetate; Melphalan; Menogaril; Mercaptopurine; Methotrexate; Methotrexate Sodium; Metoprine; Meturedepa; Mitindomide; Mitocarcin; Mitocromin; Mitogillin; Mitomalcin; Mitomycin; Mitosper; Mitotane; Mitoxantrone Hydrochloride; Mycophenolic Acid; Nocodazole; Nogalamycin; Ormaplatin; Oxisuran; Paclitaxel; Pegaspargase; Peliomycin; Pentamustine; Peplomycin Sulfate; Perfosfamide; Pipobroman; Piposulfan; Piroxantrone Hydrochloride; Plicamycin; Plomestane; Porfimer Sodium; Porfiromycin; Prednimustine; Procarbazine Hydrochloride; Puromycin; Puromycin Hydrochloride; Pyrazofurin; Riboprine; Rogletimide; Safingol; Safingol Hydrochloride; Semustine; Simtrazene; Sparfosate Sodium; Sparsomycin; Spirogermanium Hydrochloride; Spiromustine; Spiroplatin; Streptonigrin; Streptozocin; Sulofenur; Talisomycin; Taxol; Tecogalan Sodium; Tegafur; Teloxantrone Hydrochloride; Temoporfin; Teniposide; Teroxirone; Testolactone; Thiamiprine; Thioguanine; Thiotepa; Tiazofuirin; Tirapazamine; Topotecan Hydrochloride; Toremifene Citrate; Trestolone Acetate; Triciribine Phosphate; Trimetrexate; Trimetrexate Glucuronate; Triptorelin; Tubulozole Hydrochloride; Uracil Mustard; Uredepa; Vapreotide; Verteporfin; Vinblastine Sulfate; Vincristine Sulfate; Vindesine; Vindesine Sulfate; Vinepidine Sulfate; Vinglycinate Sulfate; Vinleuro sine Sulfate; Vinorelbine Tartrate; Vinrosidine Sulfate; Vinzolidine Sulfate; Vorozole; Zeniplatin; Zinostatin; Zorubicin Hydrochloride. Additional antineoplastic agents include those disclosed in Chapter 52, Antineoplastic Agents (Paul Calabresi and Bruce A. Chabner), and the introduction thereto, 1202-1263, of Goodman and Gilman's The Pharmacological Basis of Therapeutics, Eighth Edition, 1990, McGraw-Hill, Inc. (Health Professions Division).
[0170] As used herein the term about refers to 10%.
[0171] The terms comprises, comprising, includes, including, having and their conjugates mean including but not limited to.
[0172] The term consisting of means including and limited to.
[0173] The term consisting essentially of means that the composition, method or structure may include additional ingredients, steps and/or parts, but only if the additional ingredients, steps and/or parts do not materially alter the basic and novel characteristics of the claimed composition, method or structure.
[0174] As used herein, the singular form a, an and the include plural references unless the context clearly dictates otherwise. For example, the term a compound or at least one compound may include a plurality of compounds, including mixtures thereof.
[0175] Throughout this application, various embodiments of this invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0176] Whenever a numerical range is indicated herein, it is meant to include any cited numeral (fractional or integral) within the indicated range. The phrases ranging/ranges between a first indicate number and a second indicate number and ranging/ranges from a first indicate number to a second indicate number are used herein interchangeably and are meant to include the first and second indicated numbers and all the fractional and integral numerals therebetween.
[0177] As used herein the term method refers to manners, means, techniques and procedures for accomplishing a given task including, but not limited to, those manners, means, techniques and procedures either known to, or readily developed from known manners, means, techniques and procedures by practitioners of the chemical, pharmacological, biological, biochemical and medical arts.
[0178] It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable subcombination or as suitable in any other described embodiment of the invention. Certain features described in the context of various embodiments are not to be considered essential features of those embodiments, unless the embodiment is inoperative without those elements.
[0179] Various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below find experimental support in the following examples.
EXAMPLES
[0180] Reference is now made to the following examples, which together with the above descriptions illustrate some embodiments of the invention in a non limiting fashion.
[0181] Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, Molecular Cloning: A laboratory Manual Sambrook et al., (1989); Current Protocols in Molecular Biology Volumes I-III Ausubel, R. M., ed. (1994); Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Maryland (1989); Perbal, A Practical Guide to Molecular Cloning, John Wiley & Sons, New York (1988); Watson et al., Recombinant DNA, Scientific American Books, New York; Birren et al. (eds) Genome Analysis: A Laboratory Manual Series, Vols. 1-4, Cold Spring Harbor Laboratory Press, New York (1998); methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and Cell Biology: A Laboratory Handbook, Volumes I-III Cellis, J. E., ed. (1994); Culture of Animal CellsA Manual of Basic Technique by Freshney, Wiley-Liss, N. Y. (1994), Third Edition; Current Protocols in Immunology Volumes I-III Coligan J. E., ed. (1994); Stites et al. (eds), Basic and Clinical Immunology (8th Edition), Appleton & Lange, Norwalk, C T (1994); Mishell and Shiigi (eds), Selected Methods in Cellular Immunology, W. H. Freeman and Co., New York (1980); available immunoassays are extensively described in the patent and scientific literature, see, for example, U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; 4,098,876; 4,879,219; 5,011,771 and 5,281,521; Oligonucleotide Synthesis Gait, M. J., ed. (1984); Nucleic Acid Hybridization Hames, B. D., and Higgins S. J., eds. (1985); Transcription and Translation Hames, B. D., and Higgins S. J., eds. (1984); Animal Cell Culture Freshney, R. I., ed. (1986); Immobilized Cells and Enzymes IRL Press, (1986); A Practical Guide to Molecular Cloning Perbal, B., (1984) and Methods in Enzymology Vol. 1-317, Academic Press; PCR Protocols: A Guide To Methods And Applications, Academic Press, San Diego, C A (1990); Marshak et al., Strategies for Protein Purification and CharacterizationA Laboratory Course Manual CSHL Press (1996); all of which are incorporated by reference as if fully set forth herein. Other general references are provided throughout this document. The procedures therein are believed to be well known in the art and are provided for the convenience of the reader. All the information contained therein is incorporated herein by reference.
Materials and Methods
[0182] Neoantigens:
[0183] To obtain a neoantigen of B16-OVA tumors, the c-terminal of Ovalbumin (aa 252-386) was amplified from pcDNA-OVA (Addgene 64599). The amplified oligo contains the sequence which corresponds to SIINFEKL (SEQ ID NO: 11), the epitope of Ovalbumin.
[0184] To obtain a neoantigen of MC38 tumors, a section of Adpgk (aa 289-421) was amplified from cDNA of MC38 cells. The amplified oligo contains a sequence which corresponds to a validated neoantigen of MC38, based on Yadav et al. (PMID: 25428506).
[0185] Both neoantigens were inserted to the backbone plasmids by NEBuilder cloning kit
[0186] Bacteria:
[0187] The attenuated Salmonella Typhimurium strains VNP20009 (also named YS1646, ATCC, cat. 202165) and STM3120 (PMID: 20231149) were used. Briefly, bacteria were cultured to OD of 0.6-0.8, washed 3 times with Hepes 1 mM and suspended in 10% glycerol in DDW.
[0188] Bacteria Click:
[0189] To conjugate the OVA neonatigen to the bacterial cell wall by CLICK chemistry, bacteria were incubated overnight with azido-D-alanine (VNP20009) or ethynyl-D-alanine-D-alanine (STM3120) at a concentration of 1.25 mM. Fresh starters were seeded from the overnight culture and were grown with 1.25 mM D-alanine derivative until OD of 0.6-0.8. Following wash with PBS, bacteria were incubated for 1 hour at RT in CLICK solution (Sodium ascorbate 2.5 mM, CuSO.sub.4 50 M, BTTAA 300 M) and 50 M azido-SIINFEKL-Biotin or Alkyne-SIINFEKL-Biotin respectively.
[0190] To validate CLICK reaction by FACS, following incubation with D-alanine derivative, a fraction of the bacteria were washed with FACS labeling buffer (1% FBS in PBS), bacteria that were not incubated with D-alanine served as a negative control. Following CLICK reaction, as detailed above, bacteria were washed in labeling buffer and incubated with 2 ug/ml neutralite avidin-Cy5 (Southern Biotech, 7200-15) for 30 mins at 4 C. Next, bacteria were washed with labeling buffer and resuspended in 2% PFA for 45 mins at RT. Finally, bacteria were resuspended in FACS labeling buffer and analyzed by Flow cytometry.
[0191] To enhance click-mediated binding to the bacteria cell wall, an NHS-alkyne anchor was used. While D-ala-alkyne is incorporated into a newly formed cell wall, the NHS-alkyne anchor binds to all exposed primary amines. In contrast to the D-ala-alkyne anchor, the NHS-anchor does not require pre-incubation as in the D-ala-alkyne. Exponentially growing Staphylococcus pasteuri were incubated with NHS-alkyne. Next, the OVA neoantigen containing azido residue at its N-terminus was clicked to the bacteria. For validation purposes, a biotin residue at the C-terminus of the neoantigen was used so as to allow biotin-avidin reaction with the fluorophore Cy5. The resulting clicked neoantigen was Azido-SIINFEKL-Biotin. Following incubation bacteria were then, fixated and cy5 was used for FACS quantification (See
[0192] Mice Models:
[0193] B16-OVA mouse melanoma cell line (10.sup.6) or MC38 mouse CRC cell line (10.sup.5) were injected s.c. to the right flank of 7 weeks C57BL/6 females. Tumor volume was calculated as width{circumflex over ()}2*length/2
[0194] Immune Profiling of Splenocytes by FACS:
[0195] Freshly resected spleens were mashed on a 70 micron strainer into cold PBS. To lyse red blood cells, the splenocytes were incubated with ACK lysis buffer (Quality Biological, cat. 118-156-101), then washed thoroughly in PBS and suspended in FACS labeling buffer. 100 l of splenocytes were incubated for 1 hour at 4 C. with a mixture containing Fc blocker (BD, cat. 553142, 1:100), SIINFEKL (SEQ ID NO: 11) Tetramer (NIH Tetramer Core Facility, 1:500), anti-CD4 (BioLegend, cat. 100438, 1:800), anti-CD8 (Invitrogen, cat. 2021-05-05, 1:400), anti CD3 (Invitrogen, cat. 2023-07-31, 1:1000) and Brilliant Buffer (BD, cat. 566349, 1:5). Next, cells were washed twice in labeling buffer and fixed with CytoFix/CytoPerm solution (BD, cat. 51-2090KZ) for 20 mins at 4 C. Finally, cells were washed twice in Perm/Wash buffer (BD, cat. 51-2091KZ, diluted in DDW 1:10) suspended in labeling buffer and subjected to FACS.
[0196] IFNg Quantification by ELISA:
[0197] To quantify serum level of IFNg, mice were bled into Eppendorf tube containing 20 l Heparin (10 mg/ml). Following centrifugation for 10 mins, 10,000 g, sera were transferred to new tubes for long term storage at 20 C. ELISA was performed according to manufacturer instructions (R&D, cat. DY485) using sera diluted 1:4.
[0198] Bacteria quantification in liver and tumor:
[0199] Slices of tumors and livers were suspended in sterile tubes containing LB and metal beads. Following vortex for 10 minutes at max speed, 200 l of sup, were seeded on LB plates with the relevant antibiotics and incubated over night at 37 C.
[0200] Results
[0201] To generate a vaccine of bacteria clicked with OVA neonatigen, STM3120 bacteria were incubated O/N with alkyne-D-Alanine-D-alanine (D-ala) to allow its incorporation into the bacterial cell wall. Next, the OVA neoantigen containing azido residue in its N-terminus was clicked to the bacteria, as illustrated in
[0202] A fraction of OVA-clicked bacteria were incubated with Avidin-Cy5 and analyzed by flow cytometry. As negative control bacteria that were not incubated with D-ala were used. Indeed, as illustrated in
[0203] Bacteria clicked with Cy5 were injected i.v (tail vein) to tumor bearing C57BL/6 mice. As expected, bacteria were observed in the tumor tissue 24 and 48 hours post injection by IVIS imaging, as illustrated in
[0204] To demonstrate the efficacy of PACMAN vaccine based on clicked bacteria, the attenuated Salmonella Typhimurium STM3120 was clicked with the OVA neoantigen (PACMAN-CLICK-OVA). C57BL/6 mice were injected with 10.sup.6 B16 OVA expressing cells in the right flank. When tumors reached a volume of 100 mm.sup.3, mice were injected with PACMAN-CLICK-OVA (10.sup.6 CFU, i.v) followed by weekly administration of anti-PD1 (75 g, i.p.) At day 55, spleens were harvested and subjected to immune profiling.
[0205] As illustrated in
[0206] To demonstrate selective homing of Salmonella to MC38 tumors, attenuated Salmonella (STM3120) was injected to the tail vein of mice bearing the MC38 CRC tumors at the indicated numbers. After 9 days, tumors, livers and spleens were resected and vigorously shaken in 1 ml LB and a metal ball. Supernatant was seeded on LB plates and colonies were counted following 24 hrs incubation at 37 C. CFU was normalized to the dilution factor and tissue mass. For 110.sup.6, 110.sup.5 N=4, for 110.sup.4 N=3. As illustrated in
[0207] To compare the maximal tolerable dose of attenuated Salmonella (STM3120) vs parental Salmonella (14028), Salmonella were injected to the tail vein at various concentrations and body weight was monitored. As illustrated in
[0208] Although the invention has been described in conjunction with specific embodiments thereof, it is evident that many alternatives, modifications and variations will be apparent to those skilled in the art. Accordingly, it is intended to embrace all such alternatives, modifications and variations that fall within the spirit and broad scope of the appended claims.
[0209] It is the intent of the applicant(s) that all publications, patents and patent applications referred to in this specification are to be incorporated in their entirety by reference into the specification, as if each individual publication, patent or patent application was specifically and individually noted when referenced that it is to be incorporated herein by reference. In addition, citation or identification of any reference in this application shall not be construed as an admission that such reference is available as prior art to the present invention. To the extent that section headings are used, they should not be construed as necessarily limiting. In addition, any priority document(s) of this application is/are hereby incorporated herein by reference in its/their entirety.