Construction and Application of Engineering Bacteria Capable of Secreting and Expressing Diacetylchitobiose Deacetylase
20200291410 ยท 2020-09-17
Inventors
- Long Liu (Wuxi, CN)
- Jian Chen (Wuxi, CN)
- Guocheng Du (Wuxi, CN)
- Xueqin Lv (Wuxi, CN)
- Jianghua Li (Wuxi, CN)
- Zhu Jiang (Wuxi, CN)
- Wei LU (Xintai City, CN)
- Hongzhi ZHANG (Xintai City, CN)
- Jianxing LU (Xintai City, CN)
- Changfeng LIU (Xintai City, CN)
Cpc classification
A23L33/125
HUMAN NECESSITIES
C12N2500/12
CHEMISTRY; METALLURGY
C12N9/80
CHEMISTRY; METALLURGY
C12P19/26
CHEMISTRY; METALLURGY
A23L29/30
HUMAN NECESSITIES
A61K31/7008
HUMAN NECESSITIES
International classification
A61K31/7008
HUMAN NECESSITIES
C12N9/80
CHEMISTRY; METALLURGY
Abstract
The disclosure herein relates to construction and application of engineering bacteria capable of secreting and expressing diacetylchitobiose deacetylase, and belongs to the technical field of fermentation engineering. Firstly, recombinant B. subtilis capable of heterologously secreting and expressing a diacetylchitobiose deacetylase gene is constructed, and a signal peptide fragment yncM is added into the recombinant vector for the first time. The signal peptide can secrete the target protein diacetylchitobiose deacetylase outside the cells of the recombinant B. subtilis, and a mutant of the 5-end untranslated region is acquired, thereby significantly increasing the expression level of the target protein, and greatly simplifying the subsequent enzyme separation and purification steps. When the acquired diacetylchitobiose deacetylase is fermented and cultured in a fermentation medium for 50-60 h, the enzyme activity reaches a maximum of 1,548.7 U/mL, and the maximum yield of the diacetylchitobiose deacetylase is about 620 mg/L. Simultaneously, the method has the advantages of low production cost, mild production conditions, simple purification process steps, safe production operation and the like.
Claims
1. Genetic engineering bacteria, wherein the genetic engineering bacteria fuse and express diacetylchitobiose deacetylase and a yncM signal peptide, and harbor a DNA fragment comprising SEQ ID NO. 3 in a 5-untranslated region of a diacetylchitobiose deacetylase gene.
2. The genetic engineering bacteria according to claim 1, wherein the Genbank accession number of the diacetylchitobiose deacetylase is PH0499.
3. The genetic engineering bacteria according to claim 1, wherein an amino acid sequence of the yncM signal peptide is set forth in SEQ ID NO. 5.
4. The genetic engineering bacteria according to claim 3, wherein a nucleotide sequence that encodes the yncM signal peptide is set forth in SEQ ID NO. 1.
5. The genetic engineering bacteria according to claim 1, wherein a p43NMK used an expression vector.
6. The genetic engineering bacteria according to claim 1, wherein B. subtilis is used as a host.
7. The genetic engineering bacteria according to claim 6, wherein B. subtilis WB600 is used as a host.
8. A method for using the genetic engineering bacteria according to claim 1, comprising preparing a fermentation culture of the genetic engineering bacteria, and obtaining diacetylchitobiose deacetylase from the fermentation culture.
9. The method according to claim 8, wherein a seed solution of the genetic engineering bacterial is inoculated into a TB fermentation medium according to an inoculum concentration of 2-5%, and culture conditions are 35-37 C., 200-220 rpm, and 14 h-96 h.
10. The method according to claim 8, wherein a seed solution of the genetic engineering bacterial is prepared by culturing the genetic engineering bacteria in an LB medium, and the culture conditions are 35-37 C., 200-220 rpm, and 10-15 h.
11. The method according to claim 9, wherein the composition of the TB medium per liter comprises: peptone 12 g, yeast powder 24 g, NaCl 10 g, glycerol 4 mL, KH.sub.2PO.sub.4 2.31 g and K.sub.2HPO.sub.4 12.54 g.
12. The method according to claim 10, wherein the composition of the LB medium per liter comprises: peptone 10 g, yeast powder 5 g, and NaCl 10 g.
13. A method for using the genetic engineering bacteria according to claim 1, comprising preparing a fermentation culture of the genetic engineering bacteria, and obtaining a preparation of glucosamine or products containing glucosamine from the fermentation culture.
14. The method according to claim 13, wherein the products containing the glucosamine comprise drugs.
15. The method according to claim 13, wherein the products containing the glucosamine comprise dietary supplements.
Description
BRIEF DESCRIPTION OF FIGURES
[0019]
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION
[0024] (1) Bacterial Strains and Vectors
[0025] The plasmid is replicated by using Escherichia coli JM109 as a host strain, and the expression of deacetylase and fermentation of the strain are carried out by B. subtilis WB600. The plasmid pP43NMK is a commercial plasmid.
[0026] (2) Reagents, Enzymes and Related Kits
[0027] Antibiotics (kanamycin sulfate and ampicillin) are purchased from Sangon Biotech (Shanghai) Co., Ltd.
[0028] All kinds of chemical reagents are of analytical grade and are purchased from Shanghai Sinopharm Group.
[0029] All kinds of restrictive enzymes and DNA ligases are purchased from Takara.
[0030] 1 kb DNA Ladder and a plasmid miniprep kit are purchased from Sangon Biotech (Shanghai) Co., Ltd. A gel recovery kit is purchased from Fermentas.
[0031] (3) Media
[0032] The composition of a seed medium per 100 mL comprises: peptone 1 g, yeast powder 0.5 g, and NaCl 1 g.
[0033] The composition of a fermentation medium per 100 mL comprises: peptone 1.2 g, yeast powder 2.4 g, glycerol 0.4 mL, KH.sub.2PO.sub.4 0.23 g, and K.sub.2HPO.sub.4 1.25 g.
[0034] (4) HPLC Determination Method
[0035] Preparation of an HPCL sample to be tested: 1 mL of reaction solution is taken, precipitate in the reaction is removed by centrifugation, and an appropriate amount of the supernatant is taken, diluted properly with deionized water, and filtered through a membrane with a pore size of 0.22 m. The filtrate is subjected to analysis by high performance liquid chromatography.
[0036] Determination of acetylglucosamine content: an Agilent 1260 high performance liquid chromatograph (with a differential detector) and an HPX-87H column (Bio-Rad, Hercules, Calif.) are used; 0.5 mM dilute sulfuric acid is used as a mobile phase; the flow rate is 0.6 mL/min; the sample size is 10 L; the column temperature is 40 C.; isocratic elution is carried out. Detection is carried out by the differential detector.
[0037] Determination of glucosamine content: an Agilent 1260 high performance liquid chromatograph (with a UV-visible detector) and an Agilent ODS (250 mm4.6 mm, 5 m) chromatographic column are used; a derivatization reagent is OPA (o-phthaldialdehyde); a mobile phase A is prepared by weighing 3.02 g of anhydrous sodium acetate in a beaker, adding deionized water to dissolve the anhydrous sodium acetate and dilute to 1 L, then adding 200 L of triethylamine, adjusting the PH to 7.200.05 with 5% acetic acid, and after suction filtration, adding 5 ml of tetrahydrofuran and carrying out mixing for later use; a mobile phase B is prepared by weighing 3.02 g of anhydrous sodium acetate in a beaker, adding deionized water to dissolve the anhydrous sodium acetate and enabling the constant volume to be 200 mL, adjusting the pH to 7.200.05 with 5% acetic acid, and after suction filtration, adding 400 mL of acetonitrile and 400 mL of methanol to the solution and carrying out mixing for later use; the flow rate is 1.0 mL/min; the sample size is 20 L; the column temperature is 40 C.; gradient elution is carried out. Detection is carried out by the UV detector at a detection wavelength of 330 nm.
[0038] (5) Definition and Determination Method of Enzyme Activity Unit
[0039] At 40 C., with 50 mM pH 8.0 PB as a buffer, the enzyme amount, which can convert 1 mol of substrate acetylglucosamine to 1 mol of product glucosamine in 1 h, is called an enzyme activity unit, i.e., 1 U=1 mol/h.
[0040] Determination method of enzyme activity of diacetylchitobiose deacetylase:
[0041] 5 mL of acetylglucosamine solution is accurately sucked and added into clean test tubes 1# and 2# with stoppers respectively, and preheated for 5 minutes in a 40 C. water bath kettle; 5 mL of crude enzyme solution is added to the test tube 2# (the enzyme solution is appropriately diluted with a pH 8.0 PB buffer, and the dilution factor is N), and 5 mL of PB solution is added to the test tube 1#; the mixed solutions are shaken intermittently for 2 min in a 40 C. constant temperature water bath; after taking out, 1 mL of 1 M dilute hydrochloric acid solution is immediately added to each of the test tubes 1# and 2# to terminate the reaction. The mixed solutions are subjected to external standard detection analysis by liquid chromatography.
[0042] Drawing of a standard curve: an acetylglucosamine standard (with accuracy of 0.0001 g) is accurately weighed to prepare 1 g/L, 2 g/L, 3 g/L, 4 g/L and 5 g/L acetylglucosamine solutions, liquid phase detection is carried out and a standard curve is drawn.
[0043] Calculation of enzyme activity:
[0044] where XEnzyme activity, U/mL;
[0045] 5Volume of an enzyme solution, mL;
[0046] 5Volumic number of a substrate solution (100 g/L acetylglucosamine solution), mL;
[0047] AGlucosamine content of reaction liquid, g/L;
[0048] BGlucosamine content of blank liquid, g/L;
[0049] NDilution rate of the enzyme solution;
[0050] 1.1Dilution rate of a sample after a terminator is added;
[0051] 215.6Molar mass of standard sample glucosamine hydrochloride, g/mol;
[0052] 5Volumic number of a substrate solution (100 g/L acetylglucosamine solution), mL;
[0053] 2Reaction time, min;
[0054] 601 h is 60 min.
[0055] Biochemical techniques used in the disclosure are all conventional techniques in the art.
Example 1 Construction of Recombinant Plasmids which Secrete and Express Diacetylchitobiose Deacetylase
[0056] A gene encoding a signal peptide yncM (with the nucleotide sequence as shown in SEQ ID NO. 1) and a gene encoding diacetylchitobiose deacetylase Dac (with the nucleotide sequence as shown in SEQ ID NO. 2), namely two target genes are inserted into an expression vector pP43NMK by seamless cloning (the insertion sites are KpnI and PstI), and a recombinant plasmid pP43NMK-yncM-Dac is constructed (as shown in
Example 2 Acquisition of 5-Untranslated Region Mutants
[0057] In the process of constructing the recombinant plasmid pP43NMK-yncM-Dac in Example 1, a 5-untranslated region mutant is acquired and found to have a 73 bp base insertion at the 5-end by sequencing and analyzing (as shown in
Example 3 Construction of Recombinant B. subtilis
[0058] The recombinant plasmid pP43mut-yncM-Dac acquired in Example 2 is transformed into a cloning host E. coli JM109, and single colonies growing on an LB kanamycin resistant plate are picked for colony PCR identification; positive clones are cultured for extracting plasmids and the plasmids are subjected to double enzyme digestion identification, correct digestion bands are selected for sequencing, and the recombinant plasmid with a correct sequencing result is transformed into an expression host B. subtilis WB600.
Example 4 Secretion and Expression of Diacetylchitobiose Deacetylase Encoding Gene in B. subtilis WB600
[0059] The recombinant B. subtilis bacterial strain acquired in Example 3 is inoculated into a seed medium containing kanamycin antibiotics (10 mg/L) at 37 C., and cultured overnight at 220 rpm with shaking. Transferring is carried out to a fresh fermentation medium containing kanamycin antibiotics (10 mg/L) according to an inoculum concentration (v/v) of 4%, and cultured for 14-80 h at 37 C. at 220 rpm with shaking. The enzyme activity reaches a maximum of 1,548.7 U/mL during fermentation, and the yield of diacetylchitobiose deacetylase reaches a maximum of 620 mg/L.
Example 5 Growth of Recombinant B. subtilis
[0060] The recombinant B. subtilis bacterial strain acquired in Example 3 is inoculated into a seed medium containing kanamycin antibiotics (10 mg/L) at 37 C., and cultured overnight at 220 rpm with shaking. Transferring is carried out to a fresh fermentation medium containing kanamycin antibiotics (10 mg/L) according to an inoculum concentration (v/v) of 4%, and cultured at 37 C. at 220 rpm with shaking. Samples are taken every 2-8 h and diluted appropriately with deionized water, and OD.sub.600 is measured with an ultraviolet spectrophotometer to plot the growth curve of the thallus. As shown in
Example 6 Detection of Enzyme Activity of Diacetylchitobiose Deacetylase in B. subtilis WB600 at Different Stages
[0061] Samples are taken from different fermentation stages and centrifuged at 8,000g, the thallus is discarded, and the supernatant is obtained, which is the crude enzyme solution. The enzyme activity is determined according to the above enzyme activity detection method. The degradation rate of acetylglucosamine is controlled at 10% or below in the detection process. Otherwise, the enzyme solution needs to be appropriately diluted with a pH 8.0 PB buffer with a concentration of 50 mM, and then the enzyme activity is determined as described above. A curve of enzyme activity over time is plotted based on the determination results. As shown in
[0062] Control 1
[0063] Plasmids fused with different signal peptides (yncM, bpr, ywbN, ansZ, yvgO, amyE, oppA, vpr, lipA, wapA, Epr and yclQ, with amino acid sequences shown in Table 1) are used as controls, and other conditions are the same as those in Examples 1-6. In the fermentation process, the plasmids fused with different signal peptides have enzyme activity ranging from 0 U/mL to 18.6 U/mL, and extracellular enzyme activity is as high as 18.6 U/mL, as shown in
TABLE-US-00001 TABLE1 Sequencesofsignalpeptides Name Aminoacidsequencesofsignalpeptides yncM MAKPLSKGGILVKKVLIAGAVGTAVLFGTLSSGIPGLPAADAQ VAKA bpr MRKKTKNRLISSVLSTVVISSLLFPGAAGA ywbN MSDEQKKPEQIHRRDILKWGAMAGAAVA ansZ MKKQRMLVLFTALLFVFTGCSHS yvgO MKRIRIPMTLALGAALTIAPLSFASA amyE MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASA oppA MKKRWSIVTLMLIFTLVLSA vpr MKKGIIRFLLVSFVLFFALSTGITGVQA lipA MKFVKRRIIALVTILMLSVTSLFALQPSAKA wapA MKKRKRRNFKRFIAAFLVLALMISLVPADVLA Epr MKNMSCKLVVSVTLFFSFLTIGPLAHA yclQ MKKFALLFIALVTAVVISACGNQSTSSKG
[0064] Control 2
[0065] The recombinant plasmid pP43NMK-yncM-Dac which is not mutated in the 5-untranslated region is used as a control, and other conditions are the same as those in Examples 1-6. The enzyme activity reaches a maximum of 18.6 U/mL during fermentation, and the yield of diacetylchitobiose deacetylase reaches a maximum of 12 mg/L, as shown in