ANTIBODY, COMPOSITE, DETECTION DEVICE AND METHOD USING SAME
20200291098 · 2020-09-17
Inventors
Cpc classification
G01N21/75
PHYSICS
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
G01N33/543
PHYSICS
Abstract
The present invention is an antibody including an amino acid sequence, wherein the amino acid sequence includes, in an N- to C-direction, the following structural domains:
N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C
wherein FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 includes an amino acid sequence represented by GFTFSNY (SEQ ID NO: 1): the CDR2 includes an amino acid sequence represented by NSGGTG (SEQ ID NO: 2); and the CDR3 includes an amino acid sequence represented by RVDGRVLSTIVVSYDY (SEQ ID NO: 3). The antibody is capable of binding to an intranuclear protein of an influenza virus.
Claims
1. An antibody including an amino acid sequence, wherein the amino acid sequence includes, in an N- to C-direction, the following structural domains:
N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 includes an amino acid sequence represented by GFTFSNY (SEQ ID NO: 1); the CDR2 includes an amino acid sequence represented by NSGGTG (SEQ ID NO: 2); and the CDR3 includes an amino acid sequence represented by RVDGRVLSTIVVSYDY (SEQ ID NO: 3).
2. The antibody according to claim 1, wherein the antibody is capable of binding to an intranuclear protein of a type-A influenza.
3. The antibody according to claim 1, wherein the antibody is a single-domain antibody.
4. The antibody according to claim 1, wherein the type-A influenza virus is at least one selected from the group consisting of type-A influenza virus subtypes H1N1 (A/Hyogo/YS/20), H1N1 (A/Hokkaido/6-5/2014), H5N1 (A/duck/Hokkaido/Vac-3/2007), H7N7 (A/duck/Hokkaido/Vac-2/2004), H1N1 (A/duck/Tottori/723/1980), H2N3 (A/dk/Hokkaido/17/01), H3N2 (A/duck/Hokkaido/5/77), H3N8 (A/duck/Mongolia/4/03), H4N6 (A/dk/Czech/56), H6N5 (A/shearwater/S. Australia/1/72), H7N2 (A/duck/Hong Kong/301/78), H5N2 (A/duck/Pennsylvania/10218/84), H9N2(A/turkey/Wisconsin/1966), H12N5 (A/duck/Alberta/60/76), and H10N7 (A/chicken/Germany/N/1949).
5. The antibody according to claim 1, wherein the FR1 includes an amino acid sequences represented by EVQLVESGGGLVQPGGSLSLSCAAS (SEQ ID NO: 4); the FR2 includes an amino acid sequences represented by YMGWFRQAPGKERQSLATV (SE Q ID NO: 5); the FR3 includes an amino acid sequences represented by EAYADSIRGRFTISRDNAKNTVTLQMSSLQPEDTAVYYA (SEQ ID NO: 6); and the FR4 includes the amino acid sequences represented by WGQGTQVTVSS (SEQ. ID NO: 7).
6. A composite containing: an antibody according to claim 1, wherein the antibody is bound to at least one selected from the group consisting of a sold phase support, and a labeled substance.
7. The composite according to claim 6, wherein the antibody is bound to the solid phase support; and the solid phase support is selected from the group consisting of a plate, a bead, a disk, a tube, a filter, and a film.
8. The composite according to claim 6, wherein the antibody is bound to the labeled substance; and the labeled substance is selected from the group consisting of a fluorescent substance, a luminescent substance, a dye, an enzyme, and a radioactive substance.
9. A detection device comprising: a composite according to claim 6; and a detector; wherein the detector detects a change in a physical amount based on an antigen-antibody reaction of the composite and an intranuclear protein which is contained in an analyte.
10. A detection method comprising: (a) bringing a composite according to claim 6 into contact with an analyte; and (b) detecting a change of a physical amount based on an antigen-antibody reaction of the composite and an intranuclear protein which is contained in the analyte.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
DETAILED DESCRIPTION OF THE EMBODIMENT
[0037] The antibody according to the present invention is capable of binding to a type-A influenza virus. In particular, the antibody according to the present invention is capable of binding to an intranuclear protein of the type-A influenza virus. As disclosed in Patent Literature 1, an antibody capable of binding to an influenza virus includes a single-domain amino acid sequence including, in an N- to C-direction, the following structural domains.
N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C
[0038] wherein
[0039] FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence.
[0040] In the present invention, the CDR1 includes an amino acid sequence represented by GFTFSNY (SEQ ID NO: 1)
[0041] In the present invention, the CDR2 includes an amino acid sequence represented by NSGGTG (SEQ ID NO: 2).
[0042] In the present invention, the CDR3 includes an amino acid sequence represented by RVDGRVLSTIVVSYDY (SEQ ID NO: 3).
[0043] Desirably, the CDR1, the CDR2, and the CDR3 are represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively. In this case, more desirably, the FR1, the FR2, the FR3, and the FR4 includes amino acid sequences represented by EVQLVESGGGLVQPGGSLSLSCAAS (SEQ ID NO: 4), YMGWFRQAPGKERQSLATV (SEQ ID NO: 5), EAYADSIRGRFTISRDNAKNTVTLQMSSLQPEDTAVYYCA (SEQ ID NO: 6), and WGQGTQVTVSS (SEQ ID NO: 7), respectively.
[0044] In other words, it is desirable that the antibody according to the present invention consists of the amino acid sequence represented by EVQLVESGGGLVQPGGSLSLSCAASGFTFSNYYMGWFRQAPGKERQSLATVNSGGTGEAYADSIRGRFTISRDNAKN TVTLQMSSLQPEDTAVYYCARVDGRVLSTIVVSYDYWGQGTQVTVSS (SEQ ID NO: 8).
[0045] For example, the antibody according to the present invention binds to an intranuclear protein of a type-A influenza virus. In this case, the antibody consisting of the amino acid sequence represented by SEQ ID NO: 8 does not have to have antigen cross reactivity with influenza viruses other than a type-A influenza virus, such as a type-B influenza virus.
[0046] The antibody according to the present invention can be employed, for example, in a detection device or in a detection method for detecting the intranuclear protein of the type-A influenza virus. In this case, the antibody according to the present invention may be used in a state of a composite in which the antibody according to the present invention has been bound to at least one selected from the group consisting of a solid phase support and a labeled substance.
[0047] As long as the solid phase support is a support insoluble in a solvent used for a reaction system of an antigen-antibody reaction, a shape and a material of the solid phase support is not limited. An example of the shape of the solid phase support is a plate, a bead, a disk, a tube, a filter, and a film. An example of a material of the solid phase support is a polymer such as polyethylene terephthalate, cellulose acetate, polycarbonate, polystyrene, or polymethylmethacrylate, a metal such as gold, silver, or aluminum, or glass. A publicly known method such as a physical adsorption method, a covalent binding method, an ion bonding method, or a cross-linking method is employed as a method for binding the antibody to the solid phase support.
[0048] For example, a labeled substance such as a fluorescent substance, a luminescent substance, a dye, an enzyme, or a radioactive substance is used. A publicly known method such as a physical adsorption method, a covalent binding method, an ion bonding method, or a cross-linking method is employed as a method for binding the antibody to the labeled substance.
[0049] In the detection method in which the antibody according to the present invention is used, the composite including the antibody is brought into contact with an analyte. Then, detected is a change in a physical amount based on an antigen-antibody reaction of the intranuclear protein of the type-A influenza virus contained in the analyte and the antibody included in the composite. An example of the physical amount is luminescence intensity, chromaticity, light transmission, turbidness, absorbance, or radiation dose. A publicly known method such as an enzyme immunoassay method, an immunochromatography method, a latex agglutination method, a radioimmunoassay method, a fluorescence immunoassay method, or a surface plasmon resonance spectroscopy method is employed as a specific example of the detection method.
[0050] The detection device in which the antibody according to the present invention is employed includes a detector for detecting any one of the physical amount which is changed on the basis of the antigen-antibody reaction. The detector is composed a publicly known device such as a photometer, a spectroscope, or a dosimeter.
EXAMPLES
[0051] Hereinafter, the present invention will be described in more detail with reference to the following examples. However, the following examples do not limit the present invention in any way.
Inventive Example 1
[0052] A VHH antibody a variable domain of a heavy chain of a heavy chain antibody) was prepared in accordance with the following procedures as a peptide capable of binding to an intranuclear protein included in a type-A influenza virus H1N1. Hereinafter, the intranuclear protein is referred to as NP.
[0053] (Immunization of Alpaca and Acquirement of Mononuclear Cells)
[0054] In order to form a VHH antibody gene library, an alpaca was immunized using a recombinant intranuclear protein (SEQ ID NO: 24) derived from a type-A influenza virus H1N1 (A/Puerto Rico/8/34/Mount Sinai) as an antigen. The recombinant intranuclear protein was prepared using a Brevibacillus expression system by Higeta Shoyu Co., Ltd. The recombinant intranuclear protein was prepared with an adjuvant before administrated to an alpaca.
[0055] The recombinant intranuclear protein (SEQ ID NO: 24) used in the inventive example 1 is shown below.
TABLE-US-00001 (SEQIDNO:24) MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLS DYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRV NGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQR TRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRG INDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGN AEFEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVG IDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGT KVLPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQR ASAGQISIQPTFSVQRNLPFDRTTIMAAFNGNTEGRTSDMRTEIIRMMES ARPEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGSYFFGDNAEEYDN
[0056] Specifically, the recombinant intranuclear protein having concentration of 1 micrograms/milliliter was administered to the alpaca. After one week, the recombinant intranuclear protein having the same concentration was administered to the alpaca, again. In this way, the alpaca was immunized with the recombinant intranuclear protein five times for five weeks. After another week, blood of the alpaca was extracted. Then, mononuclear cells were acquired from the blood as below.
[0057] A blood cell separation solution available from COSMO BIO Co., Ltd., trade name: Lymphoprep) was added to a lymphocyte separation tube (available from Greiner Bio-One Co., Ltd., trade name: Leucosep). Then, the solution was subjected to centrifugation at a temperature of 20 degrees Celsius at 1,000g for one minute.
[0058] The blood extracted from the alpaca was treated with heparin. Then, an equivalent amount of phosphate buffered saline (hereinafter, referred to as PBS) was added to the thus-treated blood to obtain a sample solution. Then, the sample solution was added to the lymphocyte separation tube containing the blood cell separation solution.
[0059] The lymphocyte separation tube was subjected to centrifugation at a temperature of 20 degrees Celsius at 800g for thirty minutes.
[0060] A fraction containing the mononuclear cells was collected. PBS three times volume was added. The fraction was subjected to centrifugation at a temperature of 20 degrees Celsius at 300g for five minutes. The precipitate was suspended with PBS gently. After the suspending, 10 microliters of the suspension was separated in order for the count of the number of cells. The remaining suspension was subjected to centrifugation at a temperature of 20 degrees Celsius at 300g for five minutes.
[0061] An RNA storage solution (trade name: RNAlater) having a volume of 2 milliliters was added to the precipitate. Then, the solution was suspended gently. The suspension was injected into two tubes each having a volume of 1.5 milliliters. Each tube included 1 milliliter of the suspension. The tube was stored at a temperature of 20 degrees Celsius. The suspension (5 microliters) separated for the count of the number of cells was mixed with a Turk's solution (15 microliters), and the number of the mononuclear cells was counted with a counting chamber.
[0062] (Formation of cDNA Gene Library of VHH Antibody)
[0063] Then, a total RNA was extracted from the mononuclear cells, and a cDNA gene library of the VHH antibody was formed in accordance with the following procedure. In the following procedure, RNase-free-grade reagents and instruments were used.
[0064] A total RNA isolation reagent (trade name: TRIzol Reagent, 1 milliliter) was added to the mononuclear cell fraction. The reagent was mixed gently and left at room temperature for five minutes. Chloroform (200 microliters) was added to the reagent, and the reagent was shaken strongly for fifteen seconds. The reagent was left at rest at room temperature for two-three minutes. The reagent was subjected to centrifugation at 12,000g or less at a temperature of 4 degrees Celsius for 15 minutes.
[0065] The supernatant was moved to a new tube. RNase-free water and chloroform (200 microliters, each) were added to the tube. In addition, 500 milliliters of isopropanol was added to the tube. The liquid contained in the tube was stirred with a vortex mixer. The liquid was left at rest at room temperature for ten minutes. Then, the liquid was subjected to centrifugation at 12,000g or less at a temperature of 4 degrees Celsius for fifteen minutes. The supernatant was removed, and the precipitate was rinsed with one milliliter of 75% ethanol. This solution was subjected to centrifugation at 7,500g or less at a temperature of four degrees Celsius for five minutes. The solution was dried to obtain total RNA. The obtained total RNA was dissolved in RNase-free water.
[0066] In order to obtain cDNA from the total RNA, a kit including a reverse transcriptase was employed. The kit was available from Takara Bio Inc., as a trade name of PrimeScript II 1.sup.st strand cDNA Synthesis Kit. The Random 6 mer and Oligo dT primer included in the kit were used as primers. The cDNA was obtained in accordance with the standard protocol attached to the kit.
[0067] The gene of the VHH antibody included in the alpaca was obtained from the cDNA by a PCR method. An enzyme for PCR was available from Takara Bio Inc., as a trade name of Ex-taq.
[0068] The following reagents were mixed to obtain a mixture solution.
TABLE-US-00002 10x buffer 5 microliters dNTPs 4 microliters Primer F 2 microliters Primer R 2 microliters cDNA template 1 microliter Ex-taq 0.25 microliters
[0069] The mixture solution was subjected to the following PCR method.
[0070] First, the mixture solution was heated at a temperature of 95 degrees Celsius for two minutes.
[0071] Then, the temperature of the mixture solution was varied in accordance with the following cycle: [0072] Ninety six degrees Celsius for thirty seconds, [0073] Fifty two degrees Celsius for thirty seconds, and [0074] Sixty eight degrees Celsius for forty seconds.
[0075] This cycle was repeated thirty times.
[0076] Finally, the mixture solution was heated at a temperature of sixty eight degrees Celsius for four minutes and stored at a temperature of four degrees Celsius.
[0077] The following primers were used in the present PCR method.
TABLE-US-00003 Primer1: (SEQIDNO:9) 5-GGTGGTCCTGGCTGC-3 Primer2: (SEQIDNO:10) 5-ctgctcctcgcGGCCCAGCCGGCCatggcTSAGKTGCAGCTCGTGGA GTC-3 Primer3: (SEQIDNO:11) 5-TGGGGTCTTCGCTGTGGTGCG-3 Primer4: (SEQIDNO:12) 5-TTGTGGTTTTGGTGTCTTGGG-3 Primer5: (SEQIDNO:13) 5-tttgCtctGCGGCCGCagaGGCCgTGGGGTCTTCGCTGTGGTGCG- 3 Primer6: (SEQIDNO:14) 5-tttgCtctGCGGCCGCagaGGCCgaTTGTGGTTTTGGTGTCTTGGG- 3
[0078] (Reference literature: Biomed Environ Sci., 2014; (2): 118-121)
[0079] Three PCR assays were conducted.
[0080] In the first PCR assay, a primer set A consisting of the cDNA, Primer 1 and Primer 3 and a primer set B consisting of the cDNA, Primer 1 and Primer 4 were used.
[0081] In the second PCR assay, primer set C consisting of the gene amplified with the primer set A, Primer 2, and Primer 3, and a primer set D consisting of the gene amplified with the primer set B, Primer 2, and Primer 4 were used.
[0082] In the third PCR assay, a primer set E consisting of the gene amplified with the primer set C, Primer 2, and Primer 5, and a primer set F consisting of the gene amplified with the primer set D, Primer 2, and Primer 6 were used. In this way, the gene library of the VHH antibody was formed. In other words, the gene library of the VHH antibody included the genes amplified with the primer sets E and F.
[0083] (Formation of Phage Library)
[0084] Next, a phage library was formed from the gene library of the VHH antibody in accordance with the following procedures.
[0085] A plasmid Vector 1 (4057 bp, see
[0086] The plasmid Vector 1 consists of the following gene sequence.
TABLE-US-00004 (SEQIDNO:17) gacgaaagggcctcgtgatacgcctatttttataggtta atgtcatgataataatggtttcttagacgtcaggtggc acttttcggggaaatgtgcgcggaacccctatttgttta tttttctaaatacattcaaatatgtatccgctcatgag acaataaccctgataaatgcttcaataatattgaaaaag gaagagtatgagtattcaacatttccgtgtcgccctta ttcccttttttgcggcattttgccttcctgtttttgctc acccagaaacgctggtgaaagtaaaagatgctgaagat cagttgggtgcacgagtgggttacatcgaactggatctc aacagcggtaagatccttgagagttttcgccccgaaga acgttttccaatgatgagcacttttaaagttctgctatg tggcgcggtattatcccgtattgacgccgggcaagagc aactcggtcgccgcatacactattctcagaatgacttgg ttgagtactcaccagtcacagaaaagcatcttacggat ggcatgacagtaagagaattatgcagtgctgccataacc atgagtgataacactgcggccaacttacttctgacaac gatcggaggaccgaaggagctaaccgcttttttgcacaa catgggggatcatgtaactcgccttgatcgttgggaac cggagctgaatgaagccataccaaacgacgagcgtgaca ccacgatgcctgtagcaatggcaacaacgttgcgcaaa ctattaactggcgaactacttactctagcttcccggcaa caattaatagactggatggaggcggataaagttgcagg accacttctgcgctcggcccttccggctggctggtttat tgctgataaatctggagccggtgagcgtgggtctcgcg gtatcattgcagcactggggccagatggtaagccctccc gtatcgtagttatctacacgacggggagtcaggcaact atggatgaacgaaatagacagatcgctgagataggtgcc tcactgattaagcattggtaactgtcagaccaagttta ctcatatatactttagattgatttaaaacttcattttta atttaaaaggatctaggtgaagatcctttttgataatc tcatgaccaaaatcccttaacgtgagttttcgttccact gagcgtcagaccccgtagaaaagatcaaaggatcttct tgagatcctttttttctgcgcgtaatctgctgcttgcaa acaaaaaaaccaccgctaccagcggtggtttgtttgcc ggatcaagagctaccaactctttttccgaaggtaactgg cttcagcagagcgcagataccaaatactgtccttctag tgtagccgtagttaggccaccacttcaagaactctgtag caccgcctacatacctcgctctgctaatcctgttacca gtggctgctgccagtggcgataagtcgtgtcttaccggg ttggactcaagacgatagttaccggataaggcgcagcg gtcgggctgaacggggggttcgtgcacacagcccagctt ggagcgaacgacctacaccgaactgagatacctacagc gtgagctatgagaaagcgccacgcttcccgaagggagaa aggcggacaggtatccggtaagcggcagggtcggaaca ggagagcgcacgagggagcttccagggggaaacgcctgg tatctttatagtcctgtcgggtttcgccacctctgact tgagcgtcgatttttgtgatgctcgtcaggggggcggag cctatggaaaaacgccagcaacgcggcctttttacggt tcctggccttttgctggccttttgctcacatgttctttc ctgcgttatcccctgattctgtggataaccgtattacc gcctttgagtgagctgataccgctcgccgcagccgaacg accgagcgcagcgagtcagtgagcgaggaagcggaaga gcgcccaatacgcaaaccgcctctccccgcgcgttggcc gattcattaatgcagctggcacgacaggtttcccgact ggaaagcgggcagtgagcgcaacgcaattaatgtgagtt agctcactcattaggcaccccaggctttacactttatg cttccggctcgtatgttgtgtggaattgtgagcggataa caatttcacacaggaaacagctatgaccatgattacgc cAAGCTTCGAAGGAGACAGTCATAatgaaatacctgctg ccgaccgctgctgctggtctgctgctcctcgcGGCCCA GCCGGCCatggagcTCAAGATGACACAGACTACATCCTC CCTGTCAGCCTCTCTGGGAGACAGAGTCACCATCAGTT GCAGGGCAAGTCAGGACATTAGCGATTATTTAAACTGGT ATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATC TATTACACATCAAGTTTACACTCAGGAGTCCCATCAAGG TTCAGTGGCGGTGGGTCTGGAAGAGATTATTCTCTCAC CATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTT TTGCCAACAGGGTAATACGCTTCCGTGGACGTTTGGTG GAGGCACCAAGCTGGAAATCAAACGGGCTGATGCTGCAC CAACTgtaGGCCtctGCGGCCGCagaGcaaaaactcat ctcagaagaggatctgaatggggccgcaTAGggttccgg tgattttgattatgaaaagatggcaaacgctaataagg gggctatgaccgaaaatgccgatgaaaacgcgctacagt ctgacgctaaaggcaaacttgattctgtcgctactgat tacggtgctgctatcgatggtttcattggtgacgtttcc ggccttgctaatggtaatggtgctactggtgattttgc tggctctaattcccaaatggctcaagtcggtgacggtga taattcacctttaatgaataatttccgtcaatatttac cttccctccctcaatcggttgaatgtcgcccttttgtct ttagcgctggtaaaccatatgaattttctattgattgt gacaaaataaacttattccgtggtgtctttgcgtttctt ttatatgttgccacctttatgtatgtattttctacgtt tgctaacatactgcgtaataaggagtctTAATAAgaatt cactggccgtcgttttacaacgtcgtgactgggaaaac cctggcgttacccaacttaatcgccttgcagcacatccc cctttcgccagctggcgtaatagcgaagaggcccgcac cgatcgcccttcccaacagttgcgcagcctgaatggcga atggcgcctgatgcggtattttctccttacgcatctgt gcggtatttcacaccgCATATGaAAATTGTAAgcgttaa tattttgttaaaattcgcgttaaatttttgttaaatca gctcattttttaaccaataggccgaaatcggcaaaatcc cttataaatcaaaagaatagaccgagatagggttgagt gttgttccagtttggaacaagagtccactattaaagaac gtggactccaacgtcaaagggcgaaaaaccgtctatca gggcgatggcccactacgtgaaccatcaccctaatcaag ttttttggggtcgaggtgccgtaaagcactaaatcgga accctaaagggagcccccgatttagagcttgacggggaa agccggcgaacgtggcgagaaaggaagggaagaaagcg aaaggagcgggcgctagggcgctggcaagtgtagcggtc acgctgcgcgtaaccaccacacccgccgcgcttaatgc gccgctacaGGGCGCGTcccatATGgtgcactctcagta caatctgctctgatgccgcatagttaagccagccccga cacccgccaacacccgctgacgcgccctgacgggcttgt ctgctcccggcatccgcttacagacaagctgtgaccgt ctccgggagctgcatgtgtcagaggttttcaccgtcatc accgaaacgcgcga
[0087] Similarly, the gene library of the VHH antibody was treated with the restriction enzyme SfiI. In this way, VHH antibody gene fragments were obtained.
[0088] The thus treated plasmid Vector 1 was mixed with the VHH antibody gene fragments at a ratio of 1:2. An enzyme (available from Toyobo Co. Ltd., trade name: Ligation High ver. 2) was injected into the mixture solution. The mixture solution was left at rest at a temperature of 16 degrees Celsius for two hours. In this way, each of the VHH antibody gene fragments was ligated into the plasmid Vector 1.
[0089] Coli bacteria (available from Takara Bio Inc., trade name: HST02) were transfected with the thus-ligated Vector 1.
[0090] Then, the coli bacteria were incubated for fifteen hours on a 2YT plate culture medium containing ampicillin at a concentration of 100 micrograms/milliliter. In this way, obtained was a library of phages each of which displays a protein obtained from the gene fragment included in the gene library of the VHH antibody.
[0091] After the incubation, a concentration of the library was calculated by counting the number of single colonies formed on the 2YT plate culture medium. As a result, the library of the phages had a concentration of 510.sup.7/milliliter.
[0092] (Biopanning)
[0093] VHH antibodies capable of specifically binding to the intranuclear protein were obtained from the phage library in accordance with the following procedures.
[0094] In order to extract the clones each capable of binding to the antigen from among the phages which expressed the VHH antibody, biopanning was conducted twice.
[0095] Coli bacteria (HST02) into which the VHH antibody gene fragment included in the gene library of the VHH antibody was introduced were incubated at a temperature of 30 degrees Celsius in the 2YT AG culture medium containing 100 micrograms/milliliter of ampicillin and 1% glucose until a value OD.sub.600 indicating absorbance reached 1.0. The 2YT AG culture medium has a volume of 100 milliliters. In this way, the coli bacteria were proliferated.
[0096] Helper phages (available from invitrogen company, trade name: M13KO7) were added to the coli bacteria containing culture medium in such a manner that the multiplicity of infection (MOI) was approximately 20.
[0097] Then, the culture medium was warmed at a temperature of 37 degrees Celsius for about thirty minutes. Then, the culture medium was subjected to centrifugation at a rotation speed of 4,000 rpm for ten minutes to collect the coli bacteria. The coli bacteria were incubated overnight at a temperature of 30 degrees Celsius in a 2YTAK culture medium (i.e., a 2YT culture medium containing 100 micrograms/milliliter of ampicillin and 50 micrograms/milliliter of kanamycin), while subjected to centrifugation at 213 rpm. The 2YTAK culture medium has a volume of 100 milliliters.
[0098] The incubation liquid (100 milliliters) containing the thus-incubated coli bacteria was injected into two centrifugation tubes (volume: 50 milliliters, each). The two centrifugation liquids were subjected to centrifugation at a rotation speed of 4,000 rpm for ten minutes. Then, the supernatants (20 milliliters, each) were collected.
[0099] The supernatants (40 milliliters) were added to a 20% polyethylene glycol solution (10 milliliters) containing NaCl (2.5 M). Then, the mixture solution was mixed upside down. Subsequently, the mixture solution was cooled on ice for approximately one hour. The mixture solution was subjected to centrifugation at a rotation speed of 4,000 rpm for ten minutes. Then, the supernatant was removed. PBS containing 10% glycerol was injected toward the precipitate. Finally, the precipitate was loosened and dissolved. In this way, a library of phages each of which displays the VHH antibody was obtained.
[0100] (Screening of VHH Antibody Capable of Specifically Binding to NP)
[0101] (A) Immobilization of NP Antigen
[0102] NP was mixed with PBS to prepare an NP solution. The concentration of NP was 2 micrograms/milliliter. The NP solution (2 milliliters) was injected into an immunotube (available from NUNC Co., Ltd.). The NP solution was left at rest in the immunotube overnight. In this way, NP was immobilized in the immunotube.
[0103] Then, the inside of the immunotube was washed three times with PBS.
[0104] The inside of the immunotube was filled with PBS which contained 3% skim milk (available from FUJIFILM Wako Pure Chemical Corporation). In this way, NP was blocked as an antigen in the immunotube.
[0105] The immunotube was left at rest at room temperature for one hour. Subsequently, the inside of the immunotube was washed three times with PBS.
[0106] (B) Panning
[0107] The library of the phages each of which displays the VHH antibody (concentration: approximately 5E+11/milliliter) was mixed with 3 milliliters of PBS containing 3% skim milk to prepare a mixture solution. The mixture solution was injected into the immunotube in which the NP antigen was immobilized.
[0108] A lid formed of a parafilm was attached to the immunotube. Then, the immunotube was rotated upside down in a rotator for ten minutes.
[0109] The immunotube was left at rest at room temperature for one hour.
[0110] The inside of the immunotube was washed ten times with PBS containing 0.05% Tween 20. Hereinafter, such PBS is referred to as PBST.
[0111] The inside of the immunotube was filled with PBST. Subsequently, the immunotube was left at rest for ten minutes. Then, the inside of the immunotube was washed ten times with PBST.
[0112] In order to extract phages each of which displays the VHH antibody bound to the NP antigen, a 100 mM trimethylamine solution (1 milliliter) was injected into the immunotube.
[0113] A lid formed of a parafilm was attached to the immunotube. Then, the immunotube was rotated upside down in a rotator for ten minutes.
[0114] In order to neutralize the solution, the solution was moved to a tube containing 1 milliliter of 0.5 M Tris/HCl (pH: 6.8). Again, the extraction of the phage was repeated using a 100 mM trimethylamine solution (1 milliliter). In this way, 3 milliliters of an extraction liquid was obtained.
[0115] The extraction liquid (1 milliliter) was mixed with 9 milliliters of coli bacteria HST02. The mixture solution was left at rest for one hour at a temperature of 30 degrees Celsius.
[0116] In order to count the number of colonies, 10 microliters of the mixture solution containing the coli bacteria HST02 was distributed onto a small plate including a 2TYA culture medium (10 milliliters/plate).
[0117] The rest of the mixture solution was subjected to centrifugation. The supernatant was removed, and the precipitate was distributed onto a large plate eluding a 2TYA culture medium (40 milliliters/plate). These two plates were left at rest overnight at a temperature of 30 degrees Celsius. In this way, first panning was conducted.
[0118] Second panning was conducted identically to the procedure of the first panning. In other words, the panning was repeated. In this way, the monoclonal phages on which the VHH antibody was displayed were purified.
[0119] After the second panning, a colony of the coli bacteria was picked up with a toothpick. The picked-up colony was put on one well of 96-flat-bottom plate. This was repeated. One well contained 200 microliters of a 2YTAG culture medium.
[0120] The solutions included in the wells were stirred at a rotation speed of 213 rpm at a temperature of 30 degrees Celsius.
[0121] The solution (50 microliters) containing grown coli bacteria was collected. The collected solution was mixed with 50 microliters of a 2YTA culture medium included in a plate. The 2YTA culture medium contained helper phages such that the multiplicity of infection was set to be 20. The solution was left at rest at a temperature of 37 degrees Celsius for forty minutes.
[0122] The plate including the 2YTA culture medium was subjected to centrifugation at 1,800 rpm for twenty minutes. The supernatant was removed. The precipitate contained the coli bacteria. The precipitate was mixed with 200 microliters of a 2YTAK culture medium The mixture solution was left at rest overnight at a temperature of 30 degrees Celsius.
[0123] The mixture solution was subjected to centrifugation at 1,800 rpm for twenty minutes. The supernatant containing the coli bacteria was collected.
[0124] (C) Qualitative Evaluation of Phage-Displayed VHH Antibody and Antigen by ELISA
[0125] An intranuclear protein solution having a concentration of 2 micrograms/milliliter was injected as an antigen into each of the wells of a 96-well plate (available from Thermo scientific, trade name: maxisorp). The volume of the intranuclear protein solution in each well was 50 microliters. The 96-well plate was left overnight at a temperature of 4 degrees Celsius. In this way, the NP antigen was immobilized in each well.
[0126] Each of the wells was washed three times with PBS. Then, PBS containing 3% skim milk (available from FUJIFILM Wako Pure Chemical Corporation) was injected into each well (200 microliters/well). The 96-well plate was left at room temperature for one hour. In this way, the intranuclear protein was blocked in each well. Subsequently, each well was washed three times with PBS.
[0127] The monoclonal phages each of which displays the VHH antibody were injected into each well (50 microliters/well). Then, the 96-well plate was left at rest for one hour. In this way, the phages reacted with the NP antigen.
[0128] Each well was washed three times with PBST. Then, an anti-M13 antibody (available from ABCAM company, trade name: ab50370, 10,000-fold dilution) was injected into each well (50 microliters/well). Then, each well was washed three times with PBST.
[0129] A color producing agent (available from Thermo Scientific, trade name: 1-STFP ULTRA TMB-ELISA) was injected into each well (50 microliters/well). The 96-well plate was left at rest for two minutes to cause the color-producing agent to react with the antibody.
[0130] A sulfuric acid aqueous solution (normal, i.e., 1 N) was injected each well at a concentration of 50 microliters/well to cease the reaction.
[0131] The absorbance of the solution at a wavelength of 450 nanometers was measured.
[0132] Fourteen wells each having good absorbance measurement result were selected. The DNA sequences included in the phages contained in the selected fourteen wells were analyzed by Greiner Company. The analysis results of the DNA sequences will be described below. The following one DNA sequence was found.
TABLE-US-00005 (SEQIDNO:18) GAGGTGCAGCTCGTGGAGTCTGGGGGAGGCTTGGTGCAGCCTGGGGGGTC TCTGAGCCTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAATTATTACA TGGGCTGGTTCCGCCAGGCACCAGGGAAGGAACGACAGTCTCTAGCGACA GTTAACTCAGGTGGTACTGGGGAGGCCTATGCAGACTCCATACGGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAACACGGTGACGCTACAAATGA GCAGCCTGCAACCTGAGGACACGGCCGTTTATTACTGTGCACGAGTCGAC GGGCGTGTCCTGAGTACAATAGTAGTTTCTTACGACTACTGGGGCCAGGG GACCCAGGTCACCGTCTCCTCA
[0133] The protein synthesized from the DNA sequence represented by SEQ ID NO: 18 consists of the following amino acid sequence.
TABLE-US-00006 (SEQIDNO:8) EVQLVESGGGLVQPGGSLSLSCAASGFTFSNYYMGWFRQAPGKERQSLAT VNSGGTGEAYADSIRGRFTISRDNAKNTVTLQMSSLQPEDTAVYYCARVD GRVLSTIVVSYDYWGQGTQVTVSS
[0134] (Expression of Anti NP VHH Antibody)
[0135] A vector pRA2(+) was used as an expression vector (see
[0136] First, a VHH antibody gene fragment was amplified by the PCR method using the following two primers (SEQ ID NO: 19 and SEQ ID NO: 20) from the plasmid Vector 1 in which the VHH antibody gene fragment included in the gene library of the VHH antibody was ligated. In this way, the following one DNA (SEQ ID NO: 21) including a gene sequence coding for the amino acid sequence represented by the SEQ ID NO: 8 was obtained.
TABLE-US-00007 Primer1: (SEQIDNO:19) 5-CAGCCGGCCATGGCTGAGGTGCAGCTCGTGGAGTCTGG-3 Primer2: (SEQIDNO:20) ATGGTGTGCGGCCGCTGAGGAGACGGTGACCTGGGTCC-3 (SEQIDNO:21) 5- CAGCCGGCCATGGCTGAGGTGCAGCTCGTGGAGTCTGGGAGGTGCAGCT CGTGGAGTCTGGGGGAGGCTTGGTGCAGCCTGGGGGGTCTCTGAGCCTC TCCTGTGCAGCCTCTGGATTCACCTTCAGTAATTATTAGATGGGCTGGT TCCGCCAGGCACCAGGGAAGGAACGACAGTCTCTAGCGACAGTTAACTC AGGTGGTACTGGGGAGGCCTATGCAGACTCCATACGGGGCCGATTCACC ATCTCCAGAGACAACGCCAAGAACACGGTGACGCTACAAATGAGCAGCC TGGAACCTGAGGACACGGCCGTTTATTACTGTGCACGAGTCGACGGGCG TGTCCTGAGTACAATAGTAGTTTCTTACGACTACTGGGGCCAGGGGACC CAGGTCACCGTCTCCTCAGGACCCAGGTCACCGTCTCCTCAGCGGCCGC ACACCAT-3
[0137] On the other hand, a part of the base sequence included in the vector pRA2 was amplified by a PCR method using the following two primers (SEQ ID NO: 22 and SEQ ID NO: 23). In this way, a DNA (SEQ ID NO: 25) was obtained.
TABLE-US-00008 Primer1: (SEQIDNO:22) 5-GCGGCCGCACACCATCATCACCACCATTAATAG-3 Primer2: (SEQIDNO:23) 5-AGCCATGGCCGGCTGGGCCGCGAGTAATAAC-3 (SEQIDNO:25) GCGGCCGCACACCATCATCACCACCATTAATAGcactagtcaagaggat ccggctgctaacaaagcccgaaaggaagctgagttggctgctgccaccg ctgagcaataactagcataaccccttggggcctctaaacgggtcttgag gggttttttgctgaaaggaggaactatatccggatgaattccgtgtatt ctatagtgtcacctaaatcgtatgtgtatgatacataaggttatgtatt aattgtagccgcgttctaacgacaatatgtacaagcctaattgtgtagc atctggcttactgaagcagaccctatcatctctctcgtaaactgccgtc agagtcggtttggttggacgaaccttctgagtttctggtaacgccgtcc cgcacccggaaatggtcagcgaaccaatcagcagggtcatcgctagcca gatcctctacgccggacgcatcgtggccggcatcaccggcgccacaggt gcggttgctggcgcctatatcgccgacatcaccgatggggaagatcggg ctcgccacttcgggctcatgagcgcttgtttcggcgtgggtatggtggc aggccccgtggccgggggactgttgggcgccatctccttgcatgcacca ttccttgcggcggcggtgctcaacggcctcaacctactactgggctgct tcctaatgcaggagtcgcataagggagagcgtcgaatggtgcactctca gtacaatctgctctgatgccgcatagttaagccagccccgacacccgcc aacacccgctgacgcgccctgacgggcttgtctgctcccggcatccgct tacagacaagctgtgaccgtctccgggagctgcatgtgtcagaggtttt caccgtcatcaccgaaacgcgcgagacgaaagggcctcgtgatacgcct atttttataggttaatgtcatgataataatggtttcttagacgtcaggt ggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttct aaatacattcaaatatgtatccgctcatgagacaataaccctgataaat gcttcaataatattgaaaaaggaagagtatgagtattcaacatttccgt gtcgcccttattcccttttttgcggcattttgccttcctgtttttgctc acccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgc acgagtgggttacatcgaactggatctcaacagcggtaagatccttgag agttttcgccccgaagaacgttttccaatgatgagcacttttaaagttc tgctatgtggcgcggtattatcccgtattgacgccgggcaagagcaact cggtcgccgcatacactattctcagaatgacttggttgagtactcacca gtcacagaaaagcatcttacggatggcatgacagtaagagaattatgca gtgctgccataaccatgagtgataacactgcggccaacttacttctgac aacgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggg gatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagcca taccaaacgacgagcgtgacaccacgatgcctgtagcaatggcaacaac gttgcgcaaactattaactggcgaactacttactctagcttcccggcaa caattaatagactggatggaggcggataaagttgcaggaccacttctgc gctcggcccttccggctggctggtttattgctgataaatctggagccgg tgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaag ccctcccgtatcgtagttatctacacgacggggagtcaggcaactatgg atgaacgaaatagacagatcgctgagataggtgcctcactgattaagca ttggtaactgtcagaccaagtttactcatatatactttagattgattta aaacttcatttttaatttaaaaggatctaggtgaagatcctttttgata atctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtc agaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctg cgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtgg tttgtttgccggatcaagagctaccaactctttttccgaaggtaactgg cttcagcagagcgcagataccaaatactgttcttctagtgtagccgtag ttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctc tgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtct taccgggttggactcaagacgatagttaccggataaggcgcagcggtcg ggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacct acaccgaactgagatacctacagcgtgagctatgagaaagcgccacgct tcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcgga acaggagagcgcacgagggagcttccagggggaaacgcctggtatcttt atagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtg atgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcc tttttacggttcctggccttttgctggccttttgctcacatgttctttc ctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtg agctgataccgctcgccgcagccgaacgaccgagcgcagcgagtcagtg agcgaggaagcggaagagcgcccaatacgcaaaccgcctctccccgcgc gttggccgattcattaatgcagctggcttatcgaaattaatacgactca ctatagggagacccaagctttatttcaaggagacagtcataATGaaata cctattgcctacggcagccgctggattgttattactcgcggcccagccg gccatggct
[0138] DNAs other than the following two DNAs (I) and (II) were fragmented with a restriction enzyme DpnI (available from TOYOBO). In other words, the following two DNAs (I) and (II) remained unchanged; however, the rest of the DNAs were fragmented.
[0139] (I) the DNA represented by SEQ ID NO: 21, and
[0140] (II) the DNA represented by SEQ ID NO: 25.
[0141] The DNA represented. by SEQ ID NO: 21 was fused with the DNA represented by the SEQ ID NO: 25 using In-Fusion HD Cloning Kit (available from Takara Bio Inc.). In this way, the VHH antibody gene fragment was ligated into the vector pRA2(+).
[0142] The ligation solution (10 microliters) and coli bacteria JM109 (available from Takara Bio, 100 microliters) were mixed on ice. The mixture solution was left at rest on the ice for thirty minutes. Then, the mixture solution was heated at a temperature of 42 degrees Celsius for forty five seconds. Finally, the mixture solution was left at rest on the ice for three minutes. This procedure is known as a general heat shock method.
[0143] After the incubation at a temperature of 37 degrees Celsius for one hour with shaking, the total amount of the mixture solution was distributed onto an LBA culture medium containing ampicillin at a concentration of 100 micrograms/milliliter. The LBA culture medium was left at rest overnight at a temperature of 37 degrees Celsius.
[0144] Three colonies were selected from among the colonies formed on the LBA culture medium. The selected three colonies were incubated overnight in the LBA culture medium (3 milliliters).
[0145] The plasmids contained in the incubated coli bacteria were extracted from the LBA culture medium using a plasmid extraction kit (available from Sigma, trade name: Gene Elute Plasmid Mini Kit). In order to confirm that the gene of the targeted VHH antibody was inserted in the plasmid, the sequence of the plasmid was analyzed by Greiner Company. For the analysis of the sequence, a general T7 promotor primer set was used.
[0146] Selected were plasmids which were confirmed through the analysis of the sequence to have been formed as planned.
[0147] Coli bacteria (Competent Cell BL21 (DE3) pLysS, available from Life Technologies Company) were transfected with the selected plasmids by a heat shock method.
[0148] An LBA culture medium (1 milliliter) was injected into the solution containing the transfected coli bacteria. Then, the coli bacteria were recovered at a temperature of 37 degrees Celsius for one hour, while shaken at 213 rpm.
[0149] Then, the coli bacteria solution was collected. The collected coli bacteria solution (1 milliliter) was distributed onto an LBA culture medium. The LBA culture medium was left at rest overnight at a temperature of 37 degrees Celsius.
[0150] One colony was selected from among the colonies formed in the LBA culture medium. The selected colony was picked up with a toothpick. The picked-up colony was incubated in an LBA culture medium (3 milliliters) at a temperature of 37 degrees Celsius, while shaken at 213 rpm. In this way, a culture liquid was obtained.
[0151] In addition, the incubation liquid (3 milliliters) was mixed with an LBA culture medium (1,000 milliliters). Until the absorbance of the mixture solution at a wavelength of 600 nanometers reached 0.6, the mixture solution was shaken at 120 rpm at a temperature of 28 degrees Celsius.
[0152] After the absorbance reached 0.6, an isopropylthiogalactoside solution (hereinafter, referred to as IPTG solution) was added to the mixture solution. The final concentration of the IPTG solution was 0.5 mM. The coli bacteria contained in the mixture solution were incubated at a temperature of 20 degrees Celsius overnight. In order to collect the thus-incubated coli bacteria, the mixture solution was subjected to centrifugation at 6,000 rpm at a temperature of 4 degrees Celsius for ten minutes.
[0153] The collected coli bacteria were mixed with a mixture solvent containing 50 mM Tris-HCl, 500 mM NaCl, and 5 mM imidazole. The mixture solvent had a volume of 50 milliliters. The coli bacteria contained in the mixture solution were disintegrated with an ultrasonic wave.
[0154] The disintegration liquid containing the coli bacteria, was subjected to centrifugation at 40,000g at a temperature of 4 degrees Celsius for thirty minutes to obtain an eluate. The supernatant was collected. The collected supernatant was filtered through a 0.45-micrometer filter.
[0155] The filtrate was purified with Ni-NTA-Agarose (available from QIAGEN) in accordance with recommended protocol. For the purification, an elution buffer having an amount of 3 milliliters was used for 1 milliliter of Ni-NTA-Agarose.
[0156] Furthermore, the eluate containing the anti-NP antibody was purified with a column chromatograph (available from General Electric Company, trade name: Akta purifier). In this way, a solution containing the anti-NP antibody was obtained.
[0157] The anti-NP antibody contained in the thus-obtained solution was quantified with an absorption spectrometer (available from Scrum Inc., trade name: nanodrop) on the basis of the absorption measurement value at a wavelength of 280 nanometers. As a result, the concentration of anti-NP antibody was 1.30 milligrams/milliliter.
[0158] (D-1) Surface Plasmon Resonance Evaluation of Anti-NP Antibody Using Recombinant NP
[0159] The anti-NP antibody was evaluated as below with a recombinant NP and a surface plasmon resonance evaluation device. The details of the surface plasmon resonance (hereinafter, referred to as SPR) will be described below.
[0160] SPR evaluation device: T200 (available from GE healthcare)
[0161] Immobilization buffer: PBS containing 0.05% Tween 20
[0162] Running buffer: PBS containing 0.05% Tween 20
[0163] Sensor chip: CM5 (available from GE Healthcare)
[0164] Immobilization reagents: N-hydroxysuccinimido (NHS) and ethyldimethylaminopropyl carbodiimide (EDC)
[0165] Anti-Flag antibody: Monoclonal ANTI-FLAG antibody (available from SIGMA)
[0166] NP: recombinant nucleoprotein (NP) protein derived from influenza virus H1N1 to which a Flag tag was fused and which was prepared using baculovirus.
[0167] The anti-Flag antibody was immobilized in accordance with the wizard included in the control software of the SPR evaluation device T200. For the immobilization of the anti-Flag antibody, an acetic acid solution having a pH of 5.0 was used.
[0168] The anti-NP antibody consisting of the amino acid sequence represented by SEQ ID NO: 8 was used as an analyte. In the first to sixth analyses, the concentrations of the anti-NP antibody contained in the running buffer were adjusted to 0.63 nM, 1.9 nM, 5.6 nM, 16.7 nM, and 50 nM, respectively. First, the recombinant intranuclear proteins were captured with the anti-Flag antibodies. Then, the anti NP antibodies were supplied. In this way, the anti-NP antibodies were evaluated.
[0169] (D-2) Evaluation of Cross Reactivity to Other Influenza Virus Subtypes
[0170] Next, in order to evaluate binding ability of the VHH antibody consisting of the amino acid sequence represented by SEQ ID NO: 8 with nucleoproteins (namely, NPs) derived from the following twenty-one kinds of type-A influenza virus subtypes, the binding ability to a virus solution containing the intranuclear proteins was evaluated by an ELISA measurement method.
[0171] (i) H1N1(A/Hyogo/YS/2011 pdm),
[0172] (ii) H1N1(A/Hokkaido/6-5/2014 pdm),
[0173] (iii) H5N1(A/duck/Hokkaido/Vac-3/2007),
[0174] (iv) H7N7(A/duck/Hokkaido/Vac-2/2004),
[0175] (v) H1N1(A/Puerto Rico/8/34/Mount Sinai),
[0176] (vi) H1N1(A/duck/Tottori/723/1980),
[0177] (vii) H1N1 (A/swine/Hokkaido/2/81),
[0178] (viii) H2N3(A/dk/Hokkaido/17/01),
[0179] (ix) H2N9(A/duck/Hong Kong/278/78),
[0180] (x) H3N2(A/duck/Hokkaido/5/77),
[0181] (xi) H3N8(A/duck/Mongolia/4/03),
[0182] (xii) H4N6 (A/dk/Czech/56),
[0183] (xiii) H5N2(A/duck/Pennsylvania/10218/84),
[0184] (xiv) H5N3(A/duck/Hong Kong/820/80),
[0185] (xv) H6N5(A/shearwater/S. Australia/1/72),
[0186] (xvi) H7N2(A/duck/Hong Kong/301/78),
[0187] (xvii) H7N7(A/seal/Massachusetts/1/1980),
[0188] (xviii) H9N2(A/duck/Hong Kong/448/78),
[0189] (xix) H9N2(A/turkey/Wisconsin/1966),
[0190] (xx) H11N6(A/duck/England/1/1956), and
[0191] (xxi) H12N5 (A/duck/Alberta/60/76).
[0192] The virus solution containing the intranuclear protein derived from the type-A influenza virus subtype H1N1 (A/Hyogo/YS/2011 pdm) was prepared. The virus solution was obtained from School/Faculty of Veterinary Medicine, Hokkaido University.
[0193] Similarly, fourteen kinds of virus solutions containing the intranuclear proteins derived from the following (i)-(xiv) type-A influenza virus subtypes were prepared. The fourteen kinds of virus solutions were obtained from School/Faculty of Veterinary Medicine, Hokkaido University.
[0194] (i) H1N1(A/Hokkaido/6-5/2014),
[0195] (ii) H5N1(A/duck/Hokkaido/Vac-3/2007),
[0196] (iii) H7N7(A/duck/Hokkaido/Vac-2/2004),
[0197] (iv) H1N1(A/duck/Tottori/723/1980),
[0198] (v) H2N3(A/dk/Hokkaido/17/01),
[0199] (vi) H3N2(A/duck/Hokkaido/5/77),
[0200] (vii) H3N8(A/duck/Mongolia/4/03),
[0201] (viii) H4N6(A/dk/Czech/56),
[0202] (ix) H6N5 (A/shearwater/S. Australia/1/72),
[0203] (x) H7N2(A/duck/Hong Kong/301/78),
[0204] (xi) H5N2(A/duck/Pennsylvania/10218/84),
[0205] (xii) H9N2(A/turkey/Wisconsin/1966),
[0206] (xiii) H12N5(A/duck/Alberta/60/76), and
[0207] (xiv) H10N7(A/chicken/Germany/N/1949).
[0208] Furthermore, a virus solution containing the intranuclear protein derived from the type-B influenza virus (B/Hokkaido/M2/2014) was prepared. The virus solution was obtained from School/Faculty of Veterinary Medicine, Hokkaido University.
[0209] A part of a solution A (concentration 10 micrograms/milliliter) containing the VHH antibody consisting of the amino acid sequence represented by SEQ ID NO: 8 was diluted 4-fold with a PBS containing both 3% skim milk (available from FUJIFILM Wako Pure Chemical Corporation) and 0.05% Tween 20. Hereinafter, the PBS containing both 3% skim milk and 0.05% Tween 20 is referred to as skim-milk-containing PBST. In this way, a diluted solution B (concentration: 2.5 micrograms/milliliter) of the solution containing the VHH antibody consisting of the amino acid sequence represented by SEQ ID NO: 8 was provided. This was repeated to provide a diluted solution C (concentration: 0.625 micrograms/milliliter), a diluted solution D (concentration: 0.15625 micrograms/milliliter), a diluted solution E (concentration: 0.0390625 micrograms/milliliter), a diluted solution F (concentration: 9.7656210.sup.4 micrograms/milliliter), and a diluted solution G (concentration: 2.4414110.sup.4 micrograms/milliliter).
[0210] The virus solutions containing the intranuclear proteins derived from the following type-A influenza virus subtypes and from the type-B influenza virus were injected into the wells of 96 well plate (Maxisorp, Nunc).
[0211] (i) H1N1(A/Hyogo/YS/20),
[0212] (ii) H1N1 (A/Hokkaido/6-5/2014),
[0213] (iii) H5N1(A/duck/Hokkaido/Vac-3/2007),
[0214] (iv) H7N7(A/duck/Hokkaido/Vac-2/2004),
[0215] (v) H1N1(A/duck/Tottori/723/1980),
[0216] (vi) H2N3 (A/dk/Hokkaido/17/01),
[0217] (vii) H3N2(A/duck/Hokkaido/5/77),
[0218] (viii) H3N8(A/duck/Mongolia/4/03),
[0219] (ix) H4N6(A/dk/Czech/56),
[0220] (x) H6N5(A/shearwater/S. Australia/1/72),
[0221] (xi) H7N2(A/duck/Hong Kong/301/78),
[0222] (xii) H5N2(A/duck/Pennsylvania/10218/84),
[0223] (xiii) H9N2(A/turkey/Wisconsin/1966),
[0224] (xiv) H12N5(A/duck/Alberta/60/76),
[0225] (x) H10N7(A/chicken/Germany/N/1949), and
[0226] (xvi) B/Hokkaido/M2/2014.
[0227] Each of the wells contained 50 microliters of the solution. The 96-well plate was left at rest at room temperature for two hours to immobilize the virus in the wells.
[0228] The skim-milk-containing PBST was injected into each well to block the virus. The volume of the PBST injected into each well was 200 microliters. The 96-well plate was left at rest at room temperature for three hours.
[0229] PBST containing 0.05% Tween 20 was injected into each well to wash the wells. The PBST had a pH of 7.4. The volume of the PBST injected into each well was 200 microliters. This was repeated three times.
[0230] Each of the diluted solutions of the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 included in the diluted solutions A-G was injected into each well. As a reference, the skim-milk-containing PBST was injected into another well. This well including the skim-milk-containing PBST only was used as a reference to remove a background in measurement. The volume of the solutions injected into each well was 50 microliters. The 96-well plate was left at rest at room temperature. In this way, the VHH antibodies included in the diluted solutions A-G were bound to the intranuclear protein contained in the wells. The 96-well plate was left at rest at room temperature for one hour.
[0231] PBST containing 0.05% Tween 20 was injected into each well to wash the wells. The PBST had a pH of 7.4. The volume of the PBST injected into each well was 200 microliters. This was repeated five times.
[0232] Labeled antibodies (available from Medical and Biological laboratories Co., Ltd, trade name: Anti-His-tag mAb-HRP-DirecT) were diluted 10,000-fold with PBST containing 0.05% Tween 20. The thus-diluted labeled antibodies were injected into each well (50 microliters well). Then, the 96-well plate was left at rest for one hour.
[0233] PBST containing 0.05% Tween 20 was injected into each well to wash the wens. The PBST had a pH of 7.4. The volume of the PBST injected into each well was 200 microliters. This was repeated five times.
[0234] The color-producing agent (available from Thermo Scientific, trade name: 1-STEP ULTRA TMB-ELISA) was injected into each well (50 microliters/well). The 96-well plate was left at rest for thirty minutes to cause the color-producing agent to react with the antibody.
[0235] A color-stopping agent (available from ScyTek laboratories, trade name: TMB Stop Buffer) containing sulfuric acid and hydrochloric acid at a low concentration was injected into each well at a concentration of 50 microliters/well to cease the reaction.
[0236] The absorbance of the solution at a wavelength of 450 nanometers was measured.
[0237] (i) H1N1(A/Hyogo/YS/20),
[0238] (ii) H1N1(A/Hokkaido/6-5/2014),
[0239] (iii) H5N1(A/duck/Hokkaido/Vac-3/2007),
[0240] (iv) H7N7(A/duck/Hokkaido/Vac-2/2004),
[0241] (v) H1N1(A/duck/Tottori/723/1980),
[0242] (vi) H2N3(A/dk/Hokkaido/17/01),
[0243] (vii) H3N2(A/duck/Hokkaido/5/77),
[0244] (viii) H3N8 (A/duck/Mongolia/4/03),
[0245] (ix) H4N6 (A/dk/Czech/56),
[0246] (x) H6N5(A/shearwater/S. Australia/1/72),
[0247] (xi) H7N2(A/duck/Hong Kong/301/78),
[0248] (xii) H5N2(A/duck/Pennsylvania/10218/84),
[0249] (xiii) H9N2(A/turkey/Wisconsin/1966),
[0250] (xiv) H12N5 (A/duck/Alberta/60/76),
[0251] (xv) H10N7(A/chicken/Germany/N/1949), and
[0252] (xvi) B/Hokkaido/M2/2014.
[0253] As understood from
[0254] (i) H1N1(A/Hyogo/YS/20),
[0255] (ii) H1N1(A/Hokkaido/6-5/2014),
[0256] (iii) H5N1(A/duck/Hokkaido/Vac-3/2007),
[0257] (iv) H7N7(A/duck/Hokkaido/Vac-2/2004),
[0258] (v) H1N1 (A/duck/Tottori/723/1980),
[0259] (vi) H2N3(A/dk/Hokkaido/17/01),
[0260] (vii) H3N2 (A/duck/Hokkaido/5/77),
[0261] (viii) H3N8(A/duck/Mongolia/4/03),
[0262] (ix) H4N6(A/dk/Czech/56),
[0263] (x) H6N5(A/shearwater/S. Australia/1/72),
[0264] (xi) H7N2(A/duck/Hong Kong/301/78),
[0265] (xii) H5N2(A/duck/Pennsylvania/10218/84),
[0266] (xiii) H9N2(A/turkey/Wisconsin/1966),
[0267] (xiv) H12N5(A/duck/Alberta/60/76), and
[0268] (xv) H10N7(A/chicken/Germany/N/1949),
[0269] On the other hand, the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 has low cross reactivity with the type-B influenza virus.
INDUSTRIAL APPLICABILITY
[0270] The present invention provides a novel antibody capable of binding to an intranuclear protein of an influenza virus, a composite, a detection device and method using the same.