ANTI-CD166 ANTIBODIES, ACTIVATABLE ANTI-CD166 ANTIBODIES, AND METHODS OF USE THEREOF
20200291113 ยท 2020-09-17
Inventors
- James William West (Bend, OR)
- Jason Gary Sagert (San Mateo, CA)
- Jonathan Alexander Terrett (Lexington, MA, US)
- Annie Yang Weaver (San Mateo, CA, US)
- Luc Roland Desnoyers (San Francisco, CA, US)
- Shweta Singh (Fremont, CA)
Cpc classification
C07K2319/55
CHEMISTRY; METALLURGY
A61K47/6891
HUMAN NECESSITIES
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6873
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61K31/537
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K31/537
HUMAN NECESSITIES
Abstract
The invention relates generally to antibodies that bind CD166, activatable antibodies that specifically bind to CD166 and methods of making and using these anti-CD166 antibodies and anti-CD166 activatable antibodies in a variety of therapeutic, diagnostic and prophylactic indications.
Claims
1.-100. (canceled)
101. A method of treating, alleviating a symptom of, or delaying the progression of a disorder or disease in a subject in which diseased cells express CD166 or the disorder or disease is associated with cells expressing CD166, comprising: administering to the subject a therapeutically effective amount of a conjugated activatable antibody that in an activated state binds CD166, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166, wherein the AB comprises the VH CDR1 amino acid sequence GFSLSTYGMGVG (SEQ ID NO: 127); the VH CDR2 amino acid sequence NIWWSEDKH (SEQ ID NO: 128); the VH CDR3 amino acid sequence IDYGNDYAFTY (SEQ ID NO: 129); the VL CDR1 amino acid sequence RSSKSLLHSNGITYLY (SEQ ID NO: 130) or RSSQSLLHSNGITYLY (SEQ ID NO: 131); the VL CDR2 amino acid sequence QMSNLAS (SEQ ID NO: 132) or QMSNRAS (SEQ ID NO: 133); and the VL CDR3 amino acid sequence AQNLELPYT (SEQ ID NO: 134); a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state, wherein the MM comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 135-238; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, the CM comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 18-87 and 318-358.
102. The method of claim 101, wherein the disorder or disease associated with cells expressing CD166 is cancer.
103. The method of claim 102, wherein the cancer is an adenocarcinoma, a bile duct (biliary) cancer, a bladder cancer, a bone cancer, a breast cancer, a Her2-negative breast cancer, a triple-negative breast cancer (TNBC), an endometrial cancer, an estrogen receptor-positive breast cancer, a carcinoid, a cervical cancer, a cholangiocarcinoma, a colorectal cancer, a colon cancer, an endometrial cancer, a glioma, a head and neck cancer, a head and neck squamous cell cancer (HNSCC), a leukemia, a liver cancer, a lung cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a lymphoma, a melanoma, an oropharyngeal cancer, an ovarian cancer, a pancreatic cancer, a prostate cancer, a metastatic castration-resistant prostate carcinoma, a renal cancer, a sarcoma, a skin cancer, a squamous cell cancer, a stomach cancer, a testis cancer, a thyroid cancer, a urogenital cancer, or a urothelial cancer.
104. The method of claim 102, wherein the cancer is a Her2-negative breast cancer.
105. The method of claim 102, wherein the cancer is an estrogen receptor-positive breast cancer.
106. The method of claim 102, wherein the cancer is a triple-negative breast cancer (TNBC).
107. The method of claim 101, wherein the AB comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 121 or SEQ ID NO: 122, and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 123-126.
108. The method of claim 101, wherein the antigen binding fragment thereof is selected from the group consisting of a Fab fragment, a F(ab).sub.2 fragment, a scFv, a scAb, and a dAb.
109. The method of claim 101, wherein the MM is linked to the CM such that the activatable antibody in an uncleaved state comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM.
110. The method of claim 109, wherein the activatable antibody comprises a first linking peptide (LP1) and a second linking peptide (LP2), wherein the activatable antibody in the uncleaved state has the structural arrangement from N-terminus to C-terminus as follows: MM-LP1-CM-LP2-AB or AB-LP2-CM-LP1-MM, and wherein each of LP1 and LP2 is a peptide of about 1 to 20 amino acids in length.
111. The method of claim 110, wherein the two linking peptides are not identical to each other.
112. The method of claim 101, wherein the agent has one or more of the characteristics selected from the group consisting of: (a) the agent is a toxin or a fragment thereof; (b) the agent is a microtubule inhibitor; (c) the agent is a nucleic acid damaging agent; (d) the agent is a dolastatin; (e) the agent is an auristatin; (f) the agent is a maytansinoid; (g) the agent is a duocarmycin; (h) the agent is a calicheamicin; (i) the agent is a pyrrolobenzodiazepine; (j) the agent is auristatin E; (k) the agent is monomethyl auristatin E (MMAE); (l) the agent is monomethyl auristatin D (MMAD); (m) the agent is the maytansinoid DM1; (n) the agent is the maytansinoid DM4; (o) the agent is a detectable moiety; and (p) the agent is a diagnostic agent.
113. The method of claim 101, wherein the agent is conjugated to the AB via a linker.
114. The method of claim 101, wherein the linker with which the agent is conjugated to the AB comprises an SPDB moiety, a vc moiety, or a PEG2-vc moiety.
115. The method of claim 101, wherein the agent is a toxin conjugated to the AB via a linker, and wherein the linker and the toxin conjugated to the AB comprise a moiety selected from the group consisting of: an SPDB-DM4 moiety, a vc-MMAD moiety, a vc-MMAE moiety, a vc-duocarmycin moiety, or a PEG2-vc-MMAD moiety.
116. The method of claim 113, wherein the linker is a cleavable linker.
117. A method of treating, alleviating a symptom of, or delaying the progression of a disorder or disease in a subject in which diseased cells express CD166 or the disorder or disease is associated with cells expressing CD166, comprising: administering to the subject a therapeutically effective amount of a conjugated activatable antibody that in an activated state binds CD166, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166; a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, wherein the activatable antibody comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 121 and 122, and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 123-126, 363-370, 373, 374, 377, 378, 381, 382, 385, 386, 389, 390, 393, 394, 397, 398, 401, 402, 405, 406, 409, 410, 413, 414, 417, 418, 421, 422, 425, 426, 429, 430, 433, 434, 437, 438, 441, 442, 445, 446, 449, 450, 453, 454, 457, 458, 461, 462, 465, 466, 469, 470, 473, and 474.
118. The method of claim 117, wherein the disorder or disease associated with cells expressing CD166 is cancer.
119. The method of claim 118, wherein the cancer is an adenocarcinoma, a bile duct (biliary) cancer, a bladder cancer, a bone cancer, a breast cancer, a Her2-negative breast cancer, a triple-negative breast cancer (TNBC), an endometrial cancer, an estrogen receptor-positive breast cancer, a carcinoid, a cervical cancer, a cholangiocarcinoma, a colorectal cancer, a colon cancer, an endometrial cancer, a glioma, a head and neck cancer, a head and neck squamous cell cancer (HNSCC), a leukemia, a liver cancer, a lung cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a lymphoma, a melanoma, an oropharyngeal cancer, an ovarian cancer, a pancreatic cancer, a prostate cancer, a metastatic castration-resistant prostate carcinoma, a renal cancer, a sarcoma, a skin cancer, a squamous cell cancer, a stomach cancer, a testis cancer, a thyroid cancer, a urogenital cancer, or a urothelial cancer.
120. The method of claim 118, wherein the cancer is a Her2-negative breast cancer.
121. The method of claim 118, wherein the cancer is an estrogen receptor-positive breast cancer.
122. The method of claim 118, wherein the cancer is a triple-negative breast cancer (TNBC).
123. The method of claim 117, wherein the activatable antibody comprises the heavy chain comprising an amino acid sequence of SEQ ID NO: 239 and a light chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 240, 242, 244, 246, 248, 303, 310, 312, 314, 316, 371, 372, 375, 376, 379, 380, 383, 384, 387, 388, 391, 392, 395, 396, 399, 400, 403, 404, 407, 408, 411, 412, 415, 416, 419, 420, 423, 424, 427, 428, 431, 432, 435, 436, 439, 440, 443, 444, 447, 448, 451, 452, 455, 456, 459, 460, 463, 464, 467, 468, 471, and 472.
124. The method of claim 117, wherein the agent has one or more of the characteristics selected from the group consisting of: (a) the agent is a toxin or a fragment thereof; (b) the agent is a microtubule inhibitor; (c) the agent is a nucleic acid damaging agent; (d) the agent is a dolastatin; (e) the agent is an auristatin; (f) the agent is a maytansinoid; (g) the agent is a duocarmycin; (h) the agent is a calicheamicin; (i) the agent is a pyrrolobenzodiazepine; (j) the agent is auristatin E; (k) the agent is monomethyl auristatin E (MMAE); (l) the agent is monomethyl auristatin D (MMAD); (m) the agent is the maytansinoid DM1; (n) the agent is the maytansinoid DM4; (o) the agent is a detectable moiety; and (p) the agent is a diagnostic agent.
125. The method of claim 117, wherein the agent is conjugated to the AB via a linker.
126. The method of claim 117, wherein the linker with which the agent is conjugated to the AB comprises an SPDB moiety, a vc moiety, or a PEG2-vc moiety.
127. The method of claim 117, wherein the agent is a toxin conjugated to the AB via a linker, and wherein the linker and the toxin conjugated to the AB comprise a moiety selected from the group consisting of: an SPDB-DM4 moiety, a vc-MMAD moiety, a vc-MMAE moiety, a vc-duocarmycin moiety, or a PEG2-vc-MMAD moiety.
128. The method of claim 125, wherein the linker is a cleavable linker.
129. A method of treating, alleviating a symptom of, or delaying the progression of a disorder or disease in a subject in which diseased cells express CD166 or the disorder or disease is associated with cells expressing CD166, comprising: administering to the subject a therapeutically effective amount of a conjugated activatable antibody that in an activated state binds CD166, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166; a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, wherein the activatable antibody comprises a combination of amino acid sequences, wherein the combination of amino acid sequences is selected from a single row in Table A, wherein for a given combination, (i) the heavy chain of the AB comprises the amino acid sequences of the VH CDR sequences corresponding to the given combination in the single row listed in Table A, (ii) the light chain of the AB comprises the amino acid sequences of the VL CDR sequences corresponding to the given combination in the single row listed in Table A, (iii) the MM comprises the amino acid sequence of the mask sequence (MM) corresponding to the given combination in the single row listed in Table A, and (iv) the CM comprises the amino acid sequence of the substrate sequence (CM) corresponding to the given combination in the single row listed in Table A.
130. The method of claim 129, wherein the disorder or disease associated with cells expressing CD166 is cancer.
131. The method of claim 130, wherein the cancer is an adenocarcinoma, a bile duct (biliary) cancer, a bladder cancer, a bone cancer, a breast cancer, a Her2-negative breast cancer, a triple-negative breast cancer (TNBC), an endometrial cancer, an estrogen receptor-positive breast cancer, a carcinoid, a cervical cancer, a cholangiocarcinoma, a colorectal cancer, a colon cancer, an endometrial cancer, a glioma, a head and neck cancer, a head and neck squamous cell cancer (HNSCC), a leukemia, a liver cancer, a lung cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a lymphoma, a melanoma, an oropharyngeal cancer, an ovarian cancer, a pancreatic cancer, a prostate cancer, a metastatic castration-resistant prostate carcinoma, a renal cancer, a sarcoma, a skin cancer, a squamous cell cancer, a stomach cancer, a testis cancer, a thyroid cancer, a urogenital cancer, or a urothelial cancer.
132. The method of claim 130, wherein the cancer is a Her2-negative breast cancer.
133. The method of claim 130, wherein the cancer is an estrogen receptor-positive breast cancer.
134. The method of claim 130, wherein the cancer is a triple-negative breast cancer (TNBC).
135. The method of claim 129, wherein the AB comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 122, and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 123.
136. The method of claim 129, wherein the antigen binding fragment thereof is selected from the group consisting of a Fab fragment, a F(ab).sub.2 fragment, a scFv, a scAb, and a dAb.
137. The method of claim 129, wherein the MM is linked to the CM such that the activatable antibody in an uncleaved state comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM.
138. The method of claim 129, wherein the activatable antibody comprises a first linking peptide (LP1) and a second linking peptide (LP2), wherein the activatable antibody in the uncleaved state has the structural arrangement from N-terminus to C-terminus as follows: MM-LP1-CM-LP2-AB or AB-LP2-CM-LP1-MM, and wherein each of LP1 and LP2 is a peptide of about 1 to 20 amino acids in length.
139. The method of claim 130, wherein the two linking peptides are not identical to each other.
140. The method of claim 129, wherein the agent has one or more of the characteristics selected from the group consisting of: (a) the agent is a toxin or a fragment thereof; (b) the agent is a microtubule inhibitor; (c) the agent is a nucleic acid damaging agent; (d) the agent is a dolastatin; (e) the agent is an auristatin; (f) the agent is a maytansinoid; (g) the agent is a duocarmycin; (h) the agent is a calicheamicin; (i) the agent is a pyrrolobenzodiazepine; (j) the agent is auristatin E; (k) the agent is monomethyl auristatin E (MMAE); (l) the agent is monomethyl auristatin D (MMAD); (m) the agent is the maytansinoid DM1; (n) the agent is the maytansinoid DM4; (o) the agent is a detectable moiety; and (p) the agent is a diagnostic agent.
141. The method of claim 129, wherein the agent is conjugated to the AB via a linker.
142. The method of claim 129, wherein the linker with which the agent is conjugated to the AB comprises an SPDB moiety, a vc moiety, or a PEG2-vc moiety.
143. The method of claim 129, wherein the agent is a toxin conjugated to the AB via a linker, and wherein the linker and the toxin conjugated to the AB comprise a moiety selected from the group consisting of: an SPDB-DM4 moiety, a vc-MMAD moiety, a vc-MMAE moiety, a vc-duocarmycin moiety, or a PEG2-vc-MMAD moiety.
144. The method of claim 129, wherein the linker is a cleavable linker.
145. A method of treating, alleviating a symptom of, or delaying the progression of a disorder or disease in a subject in which diseased cells express CD166 or the disorder or disease is associated with cells expressing CD166, comprising: administering to the subject a therapeutically effective amount of a conjugated activatable antibody that in an activated state binds CD166, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166; a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, wherein the activatable antibody comprises a combination of amino acid sequences, wherein for a given combination of amino acid sequences, (i) the heavy chain of the AB comprises the amino acid sequences of the VH sequence or VH CDR sequences selected from the group consisting of: the VH sequence or VH CDR sequences listed in the corresponding column of Table B, (ii) the light chain of the AB comprises the amino acid sequences of the VL sequence or VL CDR sequences selected from the group consisting of: the VL sequence or VL CDR sequences listed in the corresponding column of Table B, (iii) the MM comprises the amino acid sequence of the mask sequence (MM) selected from the group consisting of: the MM sequences listed in the corresponding column of Table B, and (iv) the CM comprises the amino acid sequence of the substrate sequence (CM) selected from the group consisting of: the CM sequences listed in the corresponding column of Table B.
146. The method of claim 145, wherein the disorder or disease associated with cells expressing CD166 is cancer.
147. The method of claim 146, wherein the cancer is an adenocarcinoma, a bile duct (biliary) cancer, a bladder cancer, a bone cancer, a breast cancer, a Her2-negative breast cancer, a triple-negative breast cancer (TNBC), an endometrial cancer, an estrogen receptor-positive breast cancer, a carcinoid, a cervical cancer, a cholangiocarcinoma, a colorectal cancer, a colon cancer, an endometrial cancer, a glioma, a head and neck cancer, a head and neck squamous cell cancer (HNSCC), a leukemia, a liver cancer, a lung cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a lymphoma, a melanoma, an oropharyngeal cancer, an ovarian cancer, a pancreatic cancer, a prostate cancer, a metastatic castration-resistant prostate carcinoma, a renal cancer, a sarcoma, a skin cancer, a squamous cell cancer, a stomach cancer, a testis cancer, a thyroid cancer, a urogenital cancer, or a urothelial cancer.
148. The method of claim 146, wherein the cancer is a Her2-negative breast cancer.
149. The method of claim 146, wherein the cancer is an estrogen receptor-positive breast cancer.
150. The method of claim 146, wherein the cancer is a triple-negative breast cancer (TNBC).
151. The method of claim 145, wherein the AB comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 121 or SEQ ID NO: 122, and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 123-126.
152. The method of claim 145, wherein the antigen binding fragment thereof is selected from the group consisting of a Fab fragment, a F(ab).sub.2 fragment, a scFv, a scAb, and a dAb.
153. The method of claim 145, wherein the MM is linked to the CM such that the activatable antibody in an uncleaved state comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM.
154. The method of claim 145, wherein the activatable antibody comprises a first linking peptide (LP1) and a second linking peptide (LP2), wherein the activatable antibody in the uncleaved state has the structural arrangement from N-terminus to C-terminus as follows: MM-LP1-CM-LP2-AB or AB-LP2-CM-LP1-MM, and wherein each of LP1 and LP2 is a peptide of about 1 to 20 amino acids in length.
155. The method of claim 154, wherein the two linking peptides are not identical to each other.
156. The method of claim 145, wherein the agent has one or more of the characteristics selected from the group consisting of: (a) the agent is a toxin or a fragment thereof; (b) the agent is a microtubule inhibitor; (c) the agent is a nucleic acid damaging agent; (d) the agent is a dolastatin; (e) the agent is an auristatin; (f) the agent is a maytansinoid; (g) the agent is a duocarmycin; (h) the agent is a calicheamicin; (i) the agent is a pyrrolobenzodiazepine; (j) the agent is auristatin E; (k) the agent is monomethyl auristatin E (MMAE); (l) the agent is monomethyl auristatin D (MMAD); (m) the agent is the maytansinoid DM1; (n) the agent is the maytansinoid DM4; (o) the agent is a detectable moiety; and (p) the agent is a diagnostic agent.
157. The method of claim 145, wherein the agent is conjugated to the AB via a linker.
158. The method of claim 145, wherein the linker with which the agent is conjugated to the AB comprises an SPDB moiety, a vc moiety, or a PEG2-vc moiety.
159. The method of claim 145, wherein the agent is a toxin conjugated to the AB via a linker, and wherein the linker and the toxin conjugated to the AB comprise a moiety selected from the group consisting of: an SPDB-DM4 moiety, a vc-MMAD moiety, a vc-MMAE moiety, a vc-duocarmycin moiety, or a PEG2-vc-MMAD moiety.
160. The method of claim 157, wherein the linker is a cleavable linker.
161. A method of treating, alleviating a symptom of, or delaying the progression of a disorder or disease in a subject in which diseased cells express CD166 or the disorder or disease is associated with cells expressing CD166, comprising: administering to the subject a therapeutically effective amount of a conjugated activatable antibody that in an activated state binds CD166, the conjugated activatable antibody comprising: an activatable antibody that in an activated state binds mammalian CD166; and a toxin conjugated to the activatable antibody, wherein the conjugated activatable antibody comprises amino acid sequences, a linker, and a toxin selected from a single row in Table C, wherein for the given combination: (a) the activatable antibody comprises a heavy chain comprising the amino acid sequence of the heavy chain sequence or heavy chain variable domain sequence corresponding to the given combination in the single row listed in Table C, (b) the activatable antibody comprises a light chain comprising the amino acid sequence of the light chain sequence or light chain variable domain sequence corresponding to the given combination in the single row listed in Table C, and (c) the linker and the toxin comprise the linker and the toxin corresponding to the given combination in the single row listed in Table C.
162. The method of claim 161, wherein the disorder or disease associated with cells expressing CD166 is cancer.
163. The method of claim 162, wherein the cancer is an adenocarcinoma, a bile duct (biliary) cancer, a bladder cancer, a bone cancer, a breast cancer, a Her2-negative breast cancer, a triple-negative breast cancer (TNBC), an endometrial cancer, an estrogen receptor-positive breast cancer, a carcinoid, a cervical cancer, a cholangiocarcinoma, a colorectal cancer, a colon cancer, an endometrial cancer, a glioma, a head and neck cancer, a head and neck squamous cell cancer (HNSCC), a leukemia, a liver cancer, a lung cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a lymphoma, a melanoma, an oropharyngeal cancer, an ovarian cancer, a pancreatic cancer, a prostate cancer, a metastatic castration-resistant prostate carcinoma, a renal cancer, a sarcoma, a skin cancer, a squamous cell cancer, a stomach cancer, a testis cancer, a thyroid cancer, a urogenital cancer, or a urothelial cancer.
164. The method of claim 162, wherein the cancer is a Her2-negative breast cancer.
165. The method of claim 162, wherein the cancer is an estrogen receptor-positive breast cancer.
166. The method of claim 162, wherein the cancer is a triple-negative breast cancer (TNBC).
167. A pharmaceutical composition comprising a conjugated activatable antibody that in an activated state binds CD166, and a carrier, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166, wherein the AB comprises the VH CDR1 amino acid sequence GFSLSTYGMGVG (SEQ ID NO: 127); the VH CDR2 amino acid sequence NIWWSEDKH (SEQ ID NO: 128); the VH CDR3 amino acid sequence IDYGNDYAFTY (SEQ ID NO: 129); the VL CDR1 amino acid sequence RSSKSLLHSNGITYLY (SEQ ID NO: 130) or RSSQSLLHSNGITYLY (SEQ ID NO: 131); the VL CDR2 amino acid sequence QMSNLAS (SEQ ID NO: 132) or QMSNRAS (SEQ ID NO: 133); and the VL CDR3 amino acid sequence AQNLELPYT (SEQ ID NO: 134); a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state, wherein the MM comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 135-238; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, the CM comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 18-87 and 318-358.
168. A pharmaceutical composition comprising a conjugated activatable antibody that in an activated state binds CD166, and a carrier, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166; a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, wherein the activatable antibody comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 121 and 122, and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 123-126, 363-370, 373, 374, 377, 378, 381, 382, 385, 386, 389, 390, 393, 394, 397, 398, 401, 402, 405, 406, 409, 410, 413, 414, 417, 418, 421, 422, 425, 426, 429, 430, 433, 434, 437, 438, 441, 442, 445, 446, 449, 450, 453, 454, 457, 458, 461, 462, 465, 466, 469, 470, 473, and 474.
169. A pharmaceutical composition comprising a conjugated activatable antibody that in an activated state binds CD166, and a carrier, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166; a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, wherein the activatable antibody comprises a combination of amino acid sequences, wherein the combination of amino acid sequences is selected from a single row in Table A, wherein for a given combination, (i) the heavy chain of the AB comprises the amino acid sequences of the VH CDR sequences corresponding to the given combination in the single row listed in Table A, (ii) the light chain of the AB comprises the amino acid sequences of the VL CDR sequences corresponding to the given combination in the single row listed in Table A, (iii) the MM comprises the amino acid sequence of the mask sequence (MM) corresponding to the given combination in the single row listed in Table A, and (iv) the CM comprises the amino acid sequence of the substrate sequence (CM) corresponding to the given combination in the single row listed in Table A.
170. A pharmaceutical composition comprising a conjugated activatable antibody that in an activated state binds CD166, and a carrier, the conjugated activatable antibody comprising: an activatable antibody conjugated to an agent, the activatable antibody comprising: an antibody or an antigen binding fragment thereof (AB) that specifically binds to mammalian CD166, wherein the AB specifically binds human CD166 and cynomolgus monkey CD166; a masking moiety (MM) that inhibits the binding of the AB to CD166 when the activatable antibody is in an uncleaved state; and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease, wherein the activatable antibody comprises a combination of amino acid sequences, wherein for a given combination of amino acid sequences, (i) the heavy chain of the AB comprises the amino acid sequences of the VH sequence or VH CDR sequences selected from the group consisting of: the VH sequence or VH CDR sequences listed in the corresponding column of Table B, (ii) the light chain of the AB comprises the amino acid sequences of the VL sequence or VL CDR sequences selected from the group consisting of: the VL sequence or VL CDR sequences listed in the corresponding column of Table B, (iii) the MM comprises the amino acid sequence of the mask sequence (MM) selected from the group consisting of: the MM sequences listed in the corresponding column of Table B, and (iv) the CM comprises the amino acid sequence of the substrate sequence (CM) selected from the group consisting of: the CM sequences listed in the corresponding column of Table B.
171. A pharmaceutical composition comprising a conjugated activatable antibody that in an activated state binds CD166, and a carrier, the conjugated activatable antibody comprising: an activatable antibody that in an activated state binds mammalian CD166; and a toxin conjugated to the activatable antibody, wherein the conjugated activatable antibody comprises amino acid sequences, a linker, and a toxin selected from a single row in Table C, wherein for the given combination: (a) the activatable antibody comprises a heavy chain comprising the amino acid sequence of the heavy chain sequence or heavy chain variable domain sequence corresponding to the given combination in the single row listed in Table C, (b) the activatable antibody comprises a light chain comprising the amino acid sequence of the light chain sequence or light chain variable domain sequence corresponding to the given combination in the single row listed in Table C, and (c) the linker and the toxin comprise the linker and the toxin corresponding to the given combination in the single row listed in Table C.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0251]
[0252]
[0253]
[0254]
[0255]
[0256]
[0257]
[0258]
[0259]
[0260]
[0261]
[0262]
[0263]
[0264]
[0265]
[0266]
[0267]
[0268]
[0269]
[0270]
[0271]
[0272]
[0273]
[0274]
[0275]
[0276]
DETAILED DESCRIPTION OF THE INVENTION
[0277] The present invention provides monoclonal antibodies (mAbs) and activatable monoclonal antibodies that specifically bind CD166, also known as activated leukocyte cell adhesion molecule (ALCAM). In some embodiments, the monoclonal antibodies and activatable monoclonal antibodies are internalized by CD166-containing cells. CD166 is a cell adhesion molecule that binds CD6, a cell surface receptor that belongs to the scavenger receptor cysteine-rich (SRCR) protein superfamily (SRCRSF). CD166 is known to be associated with cell-cell and cell-matrix interactions, cell adhesion, cell migration, and T-cell activation and proliferation. Aberrant expression and/or activity of CD166 and CD166-related signaling has been implicated in the pathogenesis of many diseases and disorders, such as cancer, inflammation, and autoimmunity. For example, CD166 is highly expressed in a variety of cancer types such as, for example, prostate cancer, breast cancer, lung cancer such as NSCLC and/or SCLC, oropharyngeal cancer, cervical cancer, and head and neck cancer such as HNSCC.
[0278] The disclosure provides anti-CD166 antibodies, conjugated anti-CD166 antibodies, activatable anti-CD166 antibodies, and/or conjugated activatable anti-CD166 antibodies that are useful in methods of treating, preventing, delaying the progression of, ameliorating and/or alleviating a symptom of a disease or disorder associated with aberrant CD166 expression and/or activity. For example, the activatable anti-CD166 antibodies are used in methods of treating, preventing, delaying the progression of, ameliorating and/or alleviating a symptom of a cancer or other neoplastic condition.
[0279] The disclosure provides anti-CD166 antibodies, conjugated anti-CD166 antibodies, activatable anti-CD166 antibodies, and/or conjugated activatable anti-CD166 antibodies that are useful in methods of treating, preventing, delaying the progression of, ameliorating and/or alleviating a symptom of a disease or disorder associated with cells expressing CD166. In some embodiments, the cells are associated with aberrant CD166 expression and/or activity. In some embodiments, the cells are associated with normal CD166 expression and/or activity. For example, the activatable anti-CD166 antibodies are used in methods of treating, preventing, delaying the progression of, ameliorating and/or alleviating a symptom of a cancer or other neoplastic condition.
[0280] The disclosure provides anti-CD166 antibodies, conjugated anti-CD166 antibodies, activatable anti-CD166 antibodies, and/or conjugated activatable anti-CD166 antibodies that are useful in methods of treating, preventing, delaying the progression of, ameliorating and/or alleviating a symptom of a disease or disorder in which diseased cells express CD166. In some embodiments, the diseased cells are associated with aberrant CD166 expression and/or activity. In some embodiments, the diseased cells are associated with normal CD166 expression and/or activity. For example, the activatable anti-CD166 antibodies are used in methods of treating, preventing, delaying the progression of, ameliorating and/or alleviating a symptom of a cancer or other neoplastic condition.
[0281] The activatable anti-CD166 antibodies and/or conjugated activatable anti-CD166 antibodies include an antibody or antigen-binding fragment thereof that specifically binds CD166 coupled to a masking moiety (MM), such that coupling of the MM reduces the ability of the antibody or antigen-binding fragment thereof to bind CD166. In some embodiments, the MM is coupled via a sequence that includes a substrate for a protease, for example, a protease that is co-localized with CD166 at a treatment site in a subject.
[0282] Exemplary activatable anti-CD166 antibodies of the invention include, for example, activatable antibodies that include a heavy chain and a light chain that are, or are derived from, the heavy chain variable and light chain variable sequences shown below (CDR sequences, which were defined according to the AbM definition provided in the website of Dr. Andrew C. R. Martin, available at www_bioinf_org_uk/abs/) are shown in bold and underline):
TABLE-US-00006 muM9VH: (SEQIDNO:119) QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVGWIRQPSGKGLEW LANIWWSEDKHYNSALKSRLTISKDTSNNQVFLKISSVDTADTATYYCV QIDYGNDYAFTYWGQGTLVTVSA muM9VL: (SEQIDNO:120) DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSNGITYLYWYLQKPGQSP QLLIYQMSNLASGVPDRESSSGSGTDFTLRISRVEAEDVGVYYCAQNLE LPYTFGGGTKLEIKR huM9bVH: (SEQIDNO:121) QITLKESGPTLVKPTQTLTLTCTFSGFSLSTYGMGVGWIRQPPGKALEW LANIWWSEDKHYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCV QIDYGNDYAFTYWGQGTLVTVSS huM9cVH: (SEQIDNO:122) QITLKESGPTLVKPTQTLTLTCTFSGFSLSTYGMGVGWIRQPPGKALEW LANIWWSEDKHYSPSLKSRLTITKDTSKNQVVLTITNVDPVDTATYYCV QIDYGNDYAFTYWGQGTLVTVSS hM9vK-1VL: (SEQIDNO:123) DIVMTQSPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSP QLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLE LPYTFGQGTKLEIK hM9vK-2VL: (SEQIDNO:124) DIVMTQSPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSP QLLIYQMSNLASGVPDRFSSSGSGTDFTLKISRVEAEDVGVYYCAQNLE LPYTFGQGTKLEIK hM9vK-3aVL: (SEQIDNO:125) DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGITYLYWYLQKPGQSP QLLIYQMSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLE LPYTFGQGTKLEIK hM9vK-3bVL: (SEQIDNO:126) DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGITYLYWYLQKPGQSP QLLIYQMSNRASGVPDRFSSSGSGTDFTLKISRVEAEDVGVYYCAQNLE LPYTFGQGTKLEIK
[0283] Exemplary activatable anti-CD 166 antibodies of the invention include, for example, activatable antibodies that include a heavy chain and a light chain that are, or are derived from, the heavy chain and light chain variable shown below:
TABLE-US-00007 HuCD166_HcC AminoAcidsequence (SEQIDNO:239) QITLKESGPTLVKPTQTLTLTCTFSGFSLSTYGMGVGWIRQPPGKALEW LANIWWSEDKHYSPSLKSRLTITKDTSKNQVVLTITNVDPVDTATYYCV QIDYGNDYAFTYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK HuCD166_Lc1 (SEQIDNO:240) DIVMTQSPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSP QLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLE LPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNTYPR EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC
[0284] Exemplary activatable anti-CD166 antibodies of the invention include, for example, activatable antibodies that include a combination of a variable heavy chain complementarity determining region 1 (VH CDR1, also referred to herein as CDRH1) sequence, a variable heavy chain complementarity determining region 2 (VH CDR2, also referred to herein as CDRH2) sequence, a variable heavy chain complementarity determining region 3 (VH CDR3, also referred to herein as CDRH3) sequence, a variable light chain complementarity determining region 1 (VL CDR1, also referred to herein as CDRL1) sequence, a variable light chain complementarity determining region 2 (VL CDR2, also referred to herein as CDRL2) sequence, and a variable light chain complementarity determining region 3 (VL CDR3, also referred to herein as CDRL3) sequence, wherein at least one CDR sequence is selected from the group consisting of a VH CDR1 sequence comprising the amino acid sequence GFSLSTYGMGVG (SEQ ID NO: 127); a VH CDR2 sequence comprising the amino acid sequence NIWWSEDKH (SEQ ID NO: 128); a VH CDR3 sequence comprising the amino acid sequence IDYGNDYAFTY (SEQ ID NO: 129); a VL CDR1 sequence comprising the amino acid sequence RSSKSLLHSNGITYLY (SEQ ID NO: 130) or RSSQSLLHSNGITYLY (SEQ ID NO: 131); a VL CDR2 sequence comprising the amino acid sequence QMSNLAS (SEQ ID NO: 132) or QMSNRAS (SEQ ID NO: 133); and a VL CDR3 sequence comprising the amino acid sequence AQNLELPYT (SEQ ID NO: 134).
[0285] In some embodiments, the activatable anti-CD166 antibody includes a heavy chain that comprises or is derived from a heavy chain amino acid sequence shown in US Patent Application Publication Nos. 20150071937, 20090070890, and/or 20090203538, the contents of each of which are hereby incorporated by reference in their entirety.
[0286] In some embodiments, the activatable anti-CD166 antibody includes a heavy chain that comprises a VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 sequence that comprises or is derived from a CDR acid sequence shown in US Patent Application Publication Nos. 20150071937, 20090070890, and/or 20090203538, the contents of each of which are hereby incorporated by reference in their entirety.
[0287] In some embodiments, the activatable anti-CD166 antibody includes a heavy chain that comprises or is derived from a heavy chain amino acid sequence shown in Table 12. In some embodiments, the activatable anti-CD166 antibody includes a light chain that comprises or is derived from a heavy chain amino acid sequence shown in Table 12. In some embodiments, the activatable anti-CD166 antibody includes a heavy chain that comprises or is derived from a heavy chain amino acid sequence shown in Table 12, and a light chain that comprises or is derived from a light chain amino acid sequence shown in Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of heavy chain variable region and light chain variable region sequences from the combinations shown in Group A in Table 12. In some embodiments, the activatable anti-CD166 antibody includes the combination of heavy chain variable region and light chain variable region sequences shown in Group B in Table 12. In some embodiments, the activatable anti-CD166 antibody includes the combination of heavy chain variable region and light chain variable region sequences shown in Group C in Table 12. In some embodiments, the activatable anti-CD166 antibody includes the combination of heavy chain variable region and light chain variable region sequences shown in Group D in Table 12.
[0288] In some embodiments, the activatable anti-CD166 antibody includes a combination of the complementarity determining region (CDR) sequences of a heavy chain sequence from the heavy chain sequences shown in Group A Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a light chain sequence from the light chain sequences shown in Group A Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a heavy chain sequence from the heavy chain sequences shown in Group A Table 12 and the CDRs of a light chain sequence from the heavy chain sequences shown in Group A Table 12.
[0289] In some embodiments, the activatable anti-CD166 antibody includes a combination of CDRs of a heavy chain sequence from the heavy chain sequences shown in Group B Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a light chain sequence from the light chain sequences shown in Group B Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a heavy chain sequence from the heavy chain sequences shown in Group B Table 12 and the CDRs of a light chain sequence from the heavy chain sequences shown in Group B Table 12.
[0290] In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a heavy chain sequence from the heavy chain sequences shown in Group C Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a light chain sequence from the light chain sequences shown in Group C Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a heavy chain sequence from the heavy chain sequences shown in Group C Table 12 and the CDRs of a light chain sequence from the heavy chain sequences shown in Group C Table 12.
[0291] In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a heavy chain sequence from the heavy chain sequences shown in Group D Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a light chain sequence from the light chain sequences shown in Group D Table 12. In some embodiments, the activatable anti-CD166 antibody includes a combination of the CDRs of a heavy chain sequence from the heavy chain sequences shown in Group D Table 12 and the CDRs of a light chain sequence from the heavy chain sequences shown in Group D Table 12.
TABLE-US-00008 TABLE12 VariableHeavyChainRegion(VH)andVariableLightChainRegion(VL)Sequences forActivatableAntibodiesthatBindCD166 GroupA VH QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISR DNSKDTLYLQMNSLRAEDTAVYYCASRSLLDYWGQGTLVTVSS(SEQIDNO:249) VH QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISR DNSKDTLYLQMNSLRAEDTAVYYCASRSLLDYWGQGTLVTVSS(SEQIDNO:250) VL NFMLTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPLLVIYGKNNRPSGIPDRFSGSSSGNTASL TITGAQAEDEADYYCNSRDSSGNPVFGGGTKVTVL(SEQIDNO:251) GroupB VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCARGGGVVEFWGQGTLVTVSS(SEQIDNO:252) VL DIRMTQSPSFLSASVGDRVTITCRASQDISSYFAWYQQKPGKAPKLLIYAASTLRSGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCQQSYSTPRITFGQGTRLEIK(SEQIDNO:253) GroupC VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISGSGGSTYYADSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCARGIVATSWGQGTLVTVSR(SEQIDNO:254) VH EVQLVESGGGVVQPGGSLRLSCAASGENEDVYGMNWVRQVPGKGLEWVSLINGDGGLRYYADSVKGRFTVSR DNSRNSLYLQMNSLRSEDTALYYCVKGNFQQWGQGTLVTVSR(SEQIDNO:255) VH EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISGDGGSTYYADSVKDRFTISR DNSKNSLYLQMNSLRAEDTAVYYCARGNYFDYWGQGTLVTVSR(SEQIDNO:256) VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYISSSSSTIYYADSVKGRFTISR DNAKNSLYLQMNSLRDEDTAVYYCARVMPSYYYYYGMDVWGQGTTVTVSR(SEQIDNO:257) VH EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCADYGMDVWGQGTTVTVSR(SEQIDNO:258) VL SYELTQPPSVSVAPGQTARITCGGNKIGSKSVHWYQQKQGQAPVLVIYLDRDRPSGIPERFSGSNSGNTATL TITRVEAEDEADYYCHLWDSGSDQVFGGGTKLTVLG(SEQIDNO:259) VL SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATL TISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLG(SEQIDNO:260) VL SYELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATL TISRAQAGDEADYYCQVWDSSVVFGGGTKLTVLG(SEQIDNO:261) VL NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSAPTTVIYEDSERPSGVPDRFSGSIDSSSN SASLTISGLKTQDEADYYCQSYDGVNWVFGGGTKLTVLG(SEQIDNO:262) VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCQQSYSTPVTFGQGTKVEIK(SEQIDNO:263) GroupD VH/ QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISR VL DNSKDTLYLQMNSLRAEDTAVYYCASRSLLDYWGQGTLVTVSSGGGGSGGGGSGGGGSNFMLTQDPAVSVAL GQTVRITCQGDSLRSYYASWYQQKPGQAPLLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYY CNSRDSSGNPVFGGGTKVTVL(SEQIDNO:475) VH/ QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISR VL DNSKDTLYLQMNSLRAEDTAVYYCASRSLLDYWGQGTLVTVSSGGGGSGGGGSGGGGSNFMLTQDPAVSVAL GQTVRITCQGDSLRSYYASWYQQKPGQAPLLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYY CNSRDSSGNPVFGGGTKVTVL(SEQIDNO:476)
[0292] In some embodiments, the activatable anti-CD166 antibody includes a CDR sequence shown in Table 13, a combination of VL CDR sequences (VL CDR1, VL CDR2, VL CDR3) selected from the group consisting of those combinations shown in a single row Table 13, a combination of VH CDR sequences (VH CDR1, VH CDR2, VH CDR3) selected from the group consisting of those combinations shown in Table 13, or a combination of VL CDR and VH CDR sequences (VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3) selected the group consisting of those combinations shown in Table 13.
TABLE-US-00009 TABLE13 CDRSequencesforAntibodiesandActivatableAntibodiesthatBindCD166 VL VH CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 (SEQID (SEQID (SEQID (SEQID (SEQID (SEQID NO) NO) NO) NO) NO) NO) QGDSLRSYYAS YGKNNRPS NSRDSSGNPV SYAMS AISGSGGSTYYADSVKG RSLLDY (264) (265) (266) (267) (268) (269) QGDSLRSYYAS YGKNNRPS NSRDSSGNPV SYAMG AISGSGGSTYYADSVKG RSLLDY (264) (265) (266) (477) (268) (269) RASQDISSYFA AASTLRS QQSYSTPRIT SYAMS AISGSGGSTYYADSVKG GGGVVEF (270) (271) (272) (267) (268) (273) GGNKIGSKSVH LDRDRPS HLWDSGSD SYAMS TISGSGGSTYYADSVKG GIVATS (274) (275) (276) (267) (277) (278) GGNNIGSKSVH YDSDRPS QVWDSSSDH VYGMN LINGDGGLRYYADSVKG GNFQQ (279) (280) (281) (282) (283) (284) GGNNIGSKNVH RDSNRPS QVWDSS DYAMH LISGDGGSTYYADSVKD GNYFDY(290) (285) (286) (287) (288) (289) TGSSGSIASNY EDSERPS QSYDGVN SYSMN YISSSSSTIYYADSVKG VMPSYYYYYGMDV VQ(291) (292) (293) (294) (295) (296) RASQSISSYLN AASSLQS QQSYSTP SYGMH VISYDGSNKYYADSVKG YGMDV (297) (298) (299) (300) (301) (302)
[0293] In some embodiments, the activatable anti-CD166 antibody comprises or is derived from an antibody that is manufactured, secreted or otherwise produced by a hybridoma, such as, for example, the hybridoma(s) disclosed in US Patent Application Publication No. 20040048319 and deposited with American Type Culture Collection (ATCC) under deposit number PTA-4478. In some embodiments, the activatable anti-CD166 antibody comprises or is derived from an antibody that is manufactured, secreted or otherwise produced by a hybridoma, such as, for example, the hybridoma(s) disclosed in U.S. Pat. No. 6,022,540 and deposited with ATCC under deposit number HB 11789.
[0294] In some embodiments, the activatable anti-CD166 antibody comprises or is derived from an antibody that is manufactured, secreted or otherwise produced by a hybridoma, such as, for example, the hybridoma(s) disclosed in U.S. Pat. No. 5,998,172 and deposited with ATCC under deposit number HB 12136, HB 12137, HB 12138, HB 12139, HB 12140, and/or HB 12141.
[0295] The anti-CD166 antibodies and the ABs in the activatable antibodies of the disclosure specifically bind a CD166 target, such as, for example, mammalian CD166, and/or human CD166. Also included in the disclosure are anti-CD166 antibodies and ABs that bind to the same CD166 epitope as an antibody of the disclosure and/or an activated activatable antibody described herein. Also included in the disclosure are anti-CD166 antibodies and ABs that compete with an anti-CD166 antibody and/or an activated anti-CD166 activatable antibody described herein for binding to a CD166 target, e.g., human CD166. Also included in the disclosure are anti-CD166 antibodies and ABs that cross-compete with an anti-CD166 antibody and/or an activated anti-CD166 activatable antibody described herein for binding to a CD166 target, e.g., human CD166.
[0296] The activatable anti-CD166 antibodies provided herein include a masking moiety. In some embodiments, the masking moiety is an amino acid sequence that is coupled or otherwise attached to the anti-CD166 antibody and is positioned within the activatable anti-CD166 antibody construct such that the masking moiety reduces the ability of the anti-CD166 antibody to specifically bind CD166. Suitable masking moieties are identified using any of a variety of known techniques. For example, peptide masking moieties are identified using the methods described in PCT Publication No. WO 2009/025846 by Daugherty et al., the contents of which are hereby incorporated by reference in their entirety.
[0297] The activatable anti-CD166 antibodies provided herein include a cleavable moiety. In some embodiments, the cleavable moiety includes an amino acid sequence that is a substrate for a protease, usually an extracellular protease. Suitable substrates are identified using any of a variety of known techniques. For example, peptide substrates are identified using the methods described in U.S. Pat. No. 7,666,817 by Daugherty et al.; in U.S. Pat. No. 8,563,269 by Stagliano et al.; and in PCT Publication No. WO 2014/026136 by La Porte et al., the contents of each of which are hereby incorporated by reference in their entirety. (See also Boulware et al. Evolutionary optimization of peptide substrates for proteases that exhibit rapid hydrolysis kinetics. Biotechnol Bioeng. 106.3 (2010): 339-46).
[0298] Exemplary substrates include but are not limited to substrates cleavable by one or more of the following enzymes or proteases listed in Table 4.
TABLE-US-00010 TABLE 4 Exemplary Proteases and/or Enzymes ADAMS, ADAMTS, e.g. ADAM8 ADAM9 ADAM10 ADAM12 ADAM15 ADAM17/TACE ADAMDEC1 ADAMTS1 ADAMTS4 ADAMTS5 Aspartate proteases, e.g., BACE Renin Aspartic cathepsins, e.g., Cathepsin D Cathepsin E Caspases, e.g., Caspase 1 Caspase 2 Caspase 3 Caspase 4 Caspase 5 Caspase 6 Caspase 7 Caspase 8 Caspase 9 Caspase 10 Caspase 14 Cysteine cathepsins, e.g., Cathepsin B Cathepsin C Cathepsin K Cathepsin L Cathepsin S Cathepsin V/L2 Cathepsin X/Z/P Cysteine proteinases, e.g., Cruzipain Legumain Otubain-2 KLKs, e.g., KLK4 KLK5 KLK6 KLK7 KLK8 KLK10 KLK11 KLK13 KLK14 Metallo proteinases, e.g., Meprin Neprilysin PSMA BMP-1 MMPs, e.g., MMP1 MMP2 MMP3 MMP7 MMP8 MMP9 MMP10 MMP11 MMP12 MMP13 MMP14 MMP15 MMP16 MMP17 MMP19 MMP20 MMP23 MMP24 MMP26 MMP27 Serine proteases, e.g., activated protein C Cathepsin A Cathepsin G Chymase coagulation factor proteases (e.g., FVIIa, FIXa, FXa, FXIa, FXIIa) Elastase Granzyme B Guanidinobenzoatase HtrA1 Human Neutrophil Elastase Lactoferrin Marapsin NS3/4A PACE4 Plasmin PSA tPA Thrombin Tryptase uPA Type II Transmembrane Serine Proteases (TTSPs), e.g., DESC1 DPP-4 FAP Hepsin Matriptase-2 MT-SP1/Matriptase TMPRSS2 TMPRSS3 TMPRSS4
[0299] The activatable anti-CD166 antibodies described herein overcome a limitation of antibody therapeutics, particularly antibody therapeutics that are known to be toxic to at least some degree in vivo. Target-mediated toxicity constitutes a major limitation for the development of therapeutic antibodies. The activatable anti-CD166 antibodies provided herein are designed to address the toxicity associated with the inhibition of the target in normal tissues by traditional therapeutic antibodies. These activatable anti-CD166 antibodies remain masked until proteolytically activated at the site of disease. Starting with an anti-CD166 antibody as a parental therapeutic antibody, the activatable anti-CD166 antibodies of the invention were engineered by coupling the antibody to an inhibitory mask through a linker that incorporates a protease substrate.
[0300] When the AB is modified with a MM and is in the presence of the target, specific binding of the AB to its target is reduced or inhibited, as compared to the specific binding of the AB not modified with an MM or the specific binding of the parental AB to the target.
[0301] The K.sub.d of the AB modified with a MM towards the target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times greater than the K.sub.d of the AB not modified with an MM or of the parental AB towards the target. Conversely, the binding affinity of the AB modified with a MM towards the target is at least 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of the AB not modified with an MM or of the parental AB towards the target.
[0302] The dissociation constant (K.sub.d) of the MM towards the AB is generally greater than the K.sub.d of the AB towards the target. The K.sub.d of the MM towards the AB can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times greater than the K.sub.d of the AB towards the target. Conversely, the binding affinity of the MM towards the AB is generally lower than the binding affinity of the AB towards the target. The binding affinity of MM towards the AB can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times lower than the binding affinity of the AB towards the target.
[0303] In some embodiments, the dissociation constant (Kd) of the MM towards the AB is approximately equal to the Kd of the AB towards the target. In some embodiments, the dissociation constant (Kd) of the MM towards the AB is no more than the dissociation constant of the AB towards the target.
[0304] In some embodiments, the dissociation constant (K.sub.d) of the MM towards the AB is less than the dissociation constant of the AB towards the target.
[0305] In some embodiments, the dissociation constant (K.sub.d) of the MM towards the AB is greater than the dissociation constant of the AB towards the target.
[0306] In some embodiments, the MM has a Kd for binding to the AB that is no more than the Kd for binding of the AB to the target.
[0307] In some embodiments, the MM has a Kd for binding to the AB that is no less than the Kd for binding of the AB to the target.
[0308] In some embodiments, the MM has a Kd for binding to the AB that is approximately equal to the Kd for binding of the AB to the target.
[0309] In some embodiments, the MM has a Kd for binding to the AB that is less than the Kd for binding of the AB to the target.
[0310] In some embodiments, the MM has a Kd for binding to the AB that is greater than the Kd for binding of the AB to the target.
[0311] In some embodiments, the MM has a Kd for binding to the AB that is no more than 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, or 1,000 fold greater than the Kd for binding of the AB to the target. In some embodiments, the MM has a Kd for binding to the AB that is between 1-5, 2-5, 2-10, 5-10, 5-20, 5-50, 5-100, 10-100, 10-1,000, 20-100, 20-1000, or 100-1,000 fold greater than the Kd for binding of the AB to the target.
[0312] In some embodiments, the MM has an affinity for binding to the AB that is less than the affinity of binding of the AB to the target.
[0313] In some embodiments, the MM has an affinity for binding to the AB that is no more than the affinity of binding of the AB to the target.
[0314] In some embodiments, the MM has an affinity for binding to the AB that is approximately equal of the affinity of binding of the AB to the target.
[0315] In some embodiments, the MM has an affinity for binding to the AB that is no less than the affinity of binding of the AB to the target.
[0316] In some embodiments, the MM has an affinity for binding to the AB that is greater than the affinity of binding of the AB to the target.
[0317] In some embodiments, the MM has an affinity for binding to the AB that is 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, or 1,000 less than the affinity of binding of the AB to the target. I In some embodiments, the MM has an affinity for binding to the AB that is between 1-5, 2-5, 2-10, 5-10, 5-20, 5-50, 5-100, 10-100, 10-1,000, 20-100, 20-1000, or 100-1,000 fold less than the affinity of binding of the AB to the target. In some embodiments, the MM has an affinity for binding to the AB that is 2 to 20 fold less than the affinity of binding of the AB to the target. In some embodiments, a MM not covalently linked to the AB and at equimolar concentration to the AB does not inhibit the binding of the AB to the target.
[0318] When the AB is modified with a MM and is in the presence of the target specific binding of the AB to its target is reduced or inhibited, as compared to the specific binding of the AB not modified with an MM or the specific binding of the parental AB to the target. When compared to the binding of the AB not modified with an MM or the binding of the parental AB to the target the AB's ability to bind the target when modified with an MM can be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and even 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or more when measured in vivo or in an in vitro assay.
[0319] The MM inhibits the binding of the AB to the target. The MM binds the antigen binding domain of the AB and inhibits binding of the AB to the target. The MM can sterically inhibit the binding of the AB to the target. The MM can allosterically inhibit the binding of the AB to its target. In these embodiments when the AB is modified or coupled to a MM and in the presence of target there is no binding or substantially no binding of the AB to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the AB to the target, as compared to the binding of the AB not modified with an MM, the parental AB, or the AB not coupled to an MM to the target, for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or longer when measured in vivo or in an in vitro assay.
[0320] When an AB is coupled to or modified by a MM, the MM masks or reduces or otherwise inhibits the specific binding of the AB to the target. When an AB is coupled to or modified by a MM, such coupling or modification can effect a structural change that reduces or inhibits the ability of the AB to specifically bind its target.
[0321] An AB coupled to or modified with an MM can be represented by the following formulae (in order from an amino (N) terminal region to carboxyl (C) terminal region: [0322] (MM)-(AB) [0323] (AB)-(MM) [0324] (MM)-L-(AB) [0325] (AB)-L-(MM)
where MM is a masking moiety, the AB is an antibody or antibody fragment thereof, and the L is a linker. In many embodiments, it may be desirable to insert one or more linkers, e.g., flexible linkers, into the composition so as to provide for flexibility.
[0326] In certain embodiments, the MM is not a natural binding partner of the AB. In some embodiments, the MM contains no or substantially no homology to any natural binding partner of the AB. In some embodiments, the MM is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to any natural binding partner of the AB. In some embodiments, the MM is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 25% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 50% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 20% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 10% identical to any natural binding partner of the AB.
[0327] In some embodiments, the activatable antibodies include an AB that is modified by an MM and also includes one or more cleavable moieties (CM). Such activatable antibodies exhibit activatable/switchable binding, to the AB's target. Activatable antibodies generally include an antibody or antibody fragment (AB), modified by or coupled to a masking moiety (MM) and a modifiable or cleavable moiety (CM). In some embodiments, the CM contains an amino acid sequence that serves as a substrate for at least one protease.
[0328] The elements of the activatable antibodies are arranged so that the MM and CM are positioned such that in a cleaved (or relatively active) state and in the presence of a target, the AB binds a target while the activatable antibody is in an uncleaved (or relatively inactive) state in the presence of the target, specific binding of the AB to its target is reduced or inhibited. The specific binding of the AB to its target can be reduced due to the inhibition or masking of the AB's ability to specifically bind its target by the MM.
[0329] The K.sub.d of the AB modified with a MM and a CM towards the target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times greater than the K.sub.d of the AB not modified with an MM and a CM or of the parental AB towards the target. Conversely, the binding affinity of the AB modified with a MM and a CM towards the target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of the AB not modified with an MM and a CM or of the parental AB towards the target.
[0330] When the AB is modified with a MM and a CM and is in the presence of the target but not in the presence of a modifying agent (for example at least one protease), specific binding of the AB to its target is reduced or inhibited, as compared to the specific binding of the AB not modified with an MM and a CM or of the parental AB to the target. When compared to the binding of the parental AB or the binding of an AB not modified with an MM and a CM to its target, the AB's ability to bind the target when modified with an MM and a CM can be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and even 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or longer when measured in vivo or in an in vitro assay.
[0331] As used herein, the term cleaved state refers to the condition of the activatable antibodies following modification of the CM by at least one protease. The term uncleaved state, as used herein, refers to the condition of the activatable antibodies in the absence of cleavage of the CM by a protease. As discussed above, the term activatable antibodies is used herein to refer to an activatable antibody in both its uncleaved (native) state, as well as in its cleaved state. It will be apparent to the ordinarily skilled artisan that in some embodiments a cleaved activatable antibody may lack an MM due to cleavage of the CM by protease, resulting in release of at least the MM (e.g., where the MM is not joined to the activatable antibodies by a covalent bond (e.g., a disulfide bond between cysteine residues).
[0332] By activatable or switchable is meant that the activatable antibody exhibits a first level of binding to a target when the activatable antibody is in a inhibited, masked or uncleaved state (i.e., a first conformation), and a second level of binding to the target in the uninhibited, unmasked and/or cleaved state (i.e., a second conformation), where the second level of target binding is greater than the first level of binding. In general, the access of target to the AB of the activatable antibody is greater in the presence of a cleaving agent capable of cleaving the CM, i.e., a protease, than in the absence of such a cleaving agent. Thus, when the activatable antibody is in the uncleaved state, the AB is inhibited from target binding and can be masked from target binding (i.e., the first conformation is such the AB cannot bind the target), and in the cleaved state the AB is not inhibited or is unmasked to target binding.
[0333] The CM and AB of the activatable antibodies are selected so that the AB represents a binding moiety for a given target, and the CM represents a substrate for a protease. In some embodiments, the protease is co-localized with the target at a treatment site or diagnostic site in a subject. As used herein, co-localized refers to being at the same site or relatively close nearby. In some embodiments, a protease cleaves a CM yielding an activated antibody that binds to a target located nearby the cleavage site. The activatable antibodies disclosed herein find particular use where, for example, a protease capable of cleaving a site in the CM, i.e., a protease, is present at relatively higher levels in target-containing tissue of a treatment site or diagnostic site than in tissue of non-treatment sites (for example in healthy tissue). In some embodiments, a CM of the disclosure is also cleaved by one or more other proteases. In some embodiments, it is the one or more other proteases that is co-localized with the target and that is responsible for cleavage of the CM in vivo.
[0334] In some embodiments activatable antibodies provide for reduced toxicity and/or adverse side effects that could otherwise result from binding of the AB at non-treatment sites if the AB were not masked or otherwise inhibited from binding to the target.
[0335] In general, an activatable antibody can be designed by selecting an AB of interest and constructing the remainder of the activatable antibody so that, when conformationally constrained, the MM provides for masking of the AB or reduction of binding of the AB to its target. Structural design criteria can be to be taken into account to provide for this functional feature.
[0336] Activatable antibodies exhibiting a switchable phenotype of a desired dynamic range for target binding in an inhibited versus an uninhibited conformation are provided. Dynamic range generally refers to a ratio of (a) a maximum detected level of a parameter under a first set of conditions to (b) a minimum detected value of that parameter under a second set of conditions. For example, in the context of an activatable antibody, the dynamic range refers to the ratio of (a) a maximum detected level of target protein binding to an activatable antibody in the presence of at least one protease capable of cleaving the CM of the activatable antibodies to (b) a minimum detected level of target protein binding to an activatable antibody in the absence of the protease. The dynamic range of an activatable antibody can be calculated as the ratio of the dissociation constant of an activatable antibody cleaving agent (e.g., enzyme) treatment to the dissociation constant of the activatable antibodies cleaving agent treatment. The greater the dynamic range of an activatable antibody, the better the switchable phenotype of the activatable antibody. Activatable antibodies having relatively higher dynamic range values (e.g., greater than 1) exhibit more desirable switching phenotypes such that target protein binding by the activatable antibodies occurs to a greater extent (e.g., predominantly occurs) in the presence of a cleaving agent (e.g., enzyme) capable of cleaving the CM of the activatable antibodies than in the absence of a cleaving agent.
[0337] Activatable antibodies can be provided in a variety of structural configurations. Exemplary formulae for activatable antibodies are provided below. It is specifically contemplated that the N- to C-terminal order of the AB, MM and CM may be reversed within an activatable antibody. It is also specifically contemplated that the CM and MM may overlap in amino acid sequence, e.g., such that the CM is contained within the MM.
[0338] For example, activatable antibodies can be represented by the following formula (in order from an amino (N) terminal region to carboxyl (C) terminal region: [0339] (MM)-(CM)-(AB) [0340] (AB)-(CM)-(MM)
where MM is a masking moiety, CM is a cleavable moiety, and AB is an antibody or fragment thereof. It should be noted that although MM and CM are indicated as distinct components in the formulae above, in all exemplary embodiments (including formulae) disclosed herein it is contemplated that the amino acid sequences of the MM and the CM could overlap, e.g., such that the CM is completely or partially contained within the MM. In addition, the formulae above provide for additional amino acid sequences that may be positioned N-terminal or C-terminal to the activatable antibodies elements.
[0341] In certain embodiments, the MM is not a natural binding partner of the AB. In some embodiments, the MM contains no or substantially no homology to any natural binding partner of the AB. In some embodiments, the MM is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to any natural binding partner of the AB. In some embodiments, the MM is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 50% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 25% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 20% identical to any natural binding partner of the AB. In some embodiments, the MM is no more than 10% identical to any natural binding partner of the AB.
[0342] In many embodiments it may be desirable to insert one or more linkers, e.g., flexible linkers, into the activatable antibody construct so as to provide for flexibility at one or more of the MM-CM junction, the CM-AB junction, or both. For example, the AB, MM, and/or CM may not contain a sufficient number of residues (e.g., Gly, Ser, Asp, Asn, especially Gly and Ser, particularly Gly) to provide the desired flexibility. As such, the switchable phenotype of such activatable antibody constructs may benefit from introduction of one or more amino acids to provide for a flexible linker. In addition, as described below, where the activatable antibody is provided as a conformationally constrained construct, a flexible linker can be operably inserted to facilitate formation and maintenance of a cyclic structure in the uncleaved activatable antibody.
[0343] For example, in certain embodiments an activatable antibody comprises one of the following formulae (where the formula below represent an amino acid sequence in either N- to C-terminal direction or C- to N-terminal direction): [0344] (MM)-L1-(CM)-(AB) [0345] (MM)-(CM)-L2-(AB) [0346] (MM)-L1-(CM)-L2-(AB)
wherein MM, CM, and AB are as defined above; wherein L1 and L2 are each independently and optionally present or absent, are the same or different flexible linkers that include at least 1 flexible amino acid (e.g., Gly). In addition, the formulae above provide for additional amino acid sequences that may be positioned N-terminal or C-terminal to the activatable antibodies elements. Examples include, but are not limited to, targeting moieties (e.g., a ligand for a receptor of a cell present in a target tissue) and serum half-life extending moieties (e.g., polypeptides that bind serum proteins, such as immunoglobulin (e.g., IgG) or serum albumin (e.g., human serum albumin (HAS)).
[0347] The CM is specifically cleaved by at least one protease at a rate of about 0.001-150010.sup.4M.sup.1S.sup.1 or at least 0.001, 0.005, 0.01, 0.05, 0.1, 0.5, 1, 2.5, 5, 7.5, 10, 15, 20, 25, 50, 75, 100, 125, 150, 200, 250, 500, 750, 1000, 1250, or 150010.sup.4 M.sup.1S.sup.1. In some embodiments, the CM is specifically cleaved at a rate of about 100,000 M.sup.1S.sup.1. In some embodiments, the CM is specifically cleaved at a rate from about 110E2 to about 110E6 M.sup.1S.sup.1 (i.e., from about 110.sup.2 to about 110.sup.6 M.sup.1S.sup.1).
[0348] For specific cleavage by an enzyme, contact between the enzyme and CM is made. When the activatable antibody comprising an AB coupled to a MM and a CM is in the presence of target and sufficient enzyme activity, the CM can be cleaved. Sufficient enzyme activity can refer to the ability of the enzyme to make contact with the CM and effect cleavage. It can readily be envisioned that an enzyme may be in the vicinity of the CM but unable to cleave because of other cellular factors or protein modification of the enzyme.
[0349] Linkers suitable for use in compositions described herein are generally ones that provide flexibility of the modified AB or the activatable antibodies to facilitate the inhibition of the binding of the AB to the target. Such linkers are generally referred to as flexible linkers. Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in length.
[0350] Exemplary flexible linkers include glycine polymers (G)n, glycine-serine polymers (including, for example, (GS)n, (GSGGS)n (SEQ ID NO: 1) and (GGGS)n (SEQ ID NO: 2), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). Exemplary flexible linkers include, but are not limited to Gly-Gly-Ser-Gly (SEQ ID NO: 3), Gly-Gly-Ser-Gly-Gly (SEQ ID NO: 4), Gly-Ser-Gly-Ser-Gly (SEQ ID NO: 5), Gly-Ser-Gly-Gly-Gly (SEQ ID NO: 6), Gly-Gly-Gly-Ser-Gly (SEQ ID NO: 7), Gly-Ser-Ser-Ser-Gly (SEQ ID NO: 8), and the like. The ordinarily skilled artisan will recognize that design of an activatable antibodies can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired activatable antibodies structure.
[0351] The disclosure also provides compositions and methods that include an activatable anti-CD166 antibody that includes an antibody or antibody fragment (AB) that specifically binds CD166, where the AB is coupled to a masking moiety (MM) that decreases the ability of the AB to bind its target. In some embodiments, the activatable anti-CD166 antibody further includes a cleavable moiety (CM) that is a substrate for a protease. The compositions and methods provided herein enable the attachment of one or more agents to one or more cysteine residues in the AB without compromising the activity (e.g., the masking, activating or binding activity) of the activatable anti-CD166 antibody. In some embodiments, the compositions and methods provided herein enable the attachment of one or more agents to one or more cysteine residues in the AB without reducing or otherwise disturbing one or more disulfide bonds within the MM. The compositions and methods provided herein produce an activatable anti-CD166 antibody that is conjugated to one or more agents, e.g., any of a variety of therapeutic, diagnostic and/or prophylactic agents, for example, in some embodiments, without any of the agent(s) being conjugated to the MM of the activatable anti-CD166 antibody. The compositions and methods provided herein produce conjugated activatable anti-CD166 antibodies in which the MM retains the ability to effectively and efficiently mask the AB of the activatable antibody in an uncleaved state. The compositions and methods provided herein produce conjugated activatable anti-CD166 antibodies in which the activatable antibody is still activated, i.e., cleaved, in the presence of a protease that can cleave the CM.
[0352] The activatable anti-CD166 antibodies have at least one point of conjugation for an agent, but in the methods and compositions provided herein less than all possible points of conjugation are available for conjugation to an agent. In some embodiments, the one or more points of conjugation are sulfur atoms involved in disulfide bonds. In some embodiments, the one or more points of conjugation are sulfur atoms involved in interchain disulfide bonds. In some embodiments, the one or more points of conjugation are sulfur atoms involved in interchain sulfide bonds, but not sulfur atoms involved in intrachain disulfide bonds. In some embodiments, the one or more points of conjugation are sulfur atoms of cysteine or other amino acid residues containing a sulfur atom. Such residues may occur naturally in the antibody structure or may be incorporated into the antibody by site-directed mutagenesis, chemical conversion, or mis-incorporation of non-natural amino acids.
[0353] Also provided are methods of preparing a conjugate of an activatable anti-CD166 antibody having one or more interchain disulfide bonds in the AB and one or more intrachain disulfide bonds in the MM, and a drug reactive with free thiols is provided. The method generally includes partially reducing interchain disulfide bonds in the activatable antibody with a reducing agent, such as, for example, TCEP; and conjugating the drug reactive with free thiols to the partially reduced activatable antibody. As used herein, the term partial reduction refers to situations where an activatable anti-CD166 antibody is contacted with a reducing agent and less than all disulfide bonds, e.g., less than all possible sites of conjugation are reduced. In some embodiments, less than 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10% or less than 5% of all possible sites of conjugation are reduced.
[0354] In yet other embodiments, a method of reducing and conjugating an agent, e.g., a drug, to an activatable anti-CD166 antibody resulting in selectivity in the placement of the agent is provided. The method generally includes partially reducing the activatable anti-CD166 antibody with a reducing agent such that any conjugation sites in the masking moiety or other non-AB portion of the activatable antibody are not reduced, and conjugating the agent to interchain thiols in the AB. The conjugation site(s) are selected so as to allow desired placement of an agent to allow conjugation to occur at a desired site. The reducing agent is, for example, TCEP. The reduction reaction conditions such as, for example, the ratio of reducing agent to activatable antibody, the length of incubation, the temperature during the incubation, the pH of the reducing reaction solution, etc., are determined by identifying the conditions that produce a conjugated activatable antibody in which the MM retains the ability to effectively and efficiently mask the AB of the activatable antibody in an uncleaved state. The ratio of reduction agent to activatable anti-CD166 antibody will vary depending on the activatable antibody. In some embodiments, the ratio of reducing agent to activatable anti-CD166 antibody will be in a range from about 20:1 to 1:1, from about 10:1 to 1:1, from about 9:1 to 1:1, from about 8:1 to 1:1, from about 7:1 to 1:1, from about 6:1 to 1:1, from about 5:1 to 1:1, from about 4:1 to 1:1, from about 3:1 to 1:1, from about 2:1 to 1:1, from about 20:1 to 1:1.5, from about 10:1 to 1:1.5, from about 9:1 to 1:1.5, from about 8:1 to 1:1.5, from about 7:1 to 1:1.5, from about 6:1 to 1:1.5, from about 5:1 to 1:1.5, from about 4:1 to 1:1.5, from about 3:1 to 1:1.5, from about 2:1 to 1:1.5, from about 1.5:1 to 1:1.5, or from about 1:1 to 1:1.5. In some embodiments, the ratio is in a range of from about 5:1 to 1:1. In some embodiments, the ratio is in a range of from about 5:1 to 1.5:1. In some embodiments, the ratio is in a range of from about 4:1 to 1:1. In some embodiments, the ratio is in a range from about 4:1 to 1.5:1. In some embodiments, the ratio is in a range from about 8:1 to about 1:1. In some embodiments, the ratio is in a range of from about 2.5:1 to 1:1.
[0355] In some embodiments, a method of reducing interchain disulfide bonds in the AB of an activatable anti-CD166 antibody and conjugating an agent, e.g., a thiol-containing agent such as a drug, to the resulting interchain thiols to selectively locate agent(s) on the AB is provided. The method generally includes partially reducing the AB with a reducing agent to form at least two interchain thiols without forming all possible interchain thiols in the activatable antibody; and conjugating the agent to the interchain thiols of the partially reduced AB. For example, the AB of the activatable antibody is partially reduced for about 1 hour at about 37 C. at a desired ratio of reducing agent:activatable antibody. In some embodiments, the ratio of reducing agent to activatable antibody will be in a range from about 20:1 to 1:1, from about 10:1 to 1:1, from about 9:1 to 1:1, from about 8:1 to 1:1, from about 7:1 to 1:1, from about 6:1 to 1:1, from about 5:1 to 1:1, from about 4:1 to 1:1, from about 3:1 to 1:1, from about 2:1 to 1:1, from about 20:1 to 1:1.5, from about 10:1 to 1:1.5, from about 9:1 to 1:1.5, from about 8:1 to 1:1.5, from about 7:1 to 1:1.5, from about 6:1 to 1:1.5, from about 5:1 to 1:1.5, from about 4:1 to 1:1.5, from about 3:1 to 1:1.5, from about 2:1 to 1:1.5, from about 1.5:1 to 1:1.5, or from about 1:1 to 1:1.5. In some embodiments, the ratio is in a range of from about 5:1 to 1:1. In some embodiments, the ratio is in a range of from about 5:1 to 1.5:1. In some embodiments, the ratio is in a range of from about 4:1 to 1:1. In some embodiments, the ratio is in a range from about 4:1 to 1.5:1. In some embodiments, the ratio is in a range from about 8:1 to about 1:1. In some embodiments, the ratio is in a range of from about 2.5:1 to 1:1.
[0356] The thiol-containing reagent can be, for example, cysteine or N-acetyl cysteine. The reducing agent can be, for example, TCEP. In some embodiments, the reduced activatable antibody can be purified prior to conjugation, using for example, column chromatography, dialysis, or diafiltration. Alternatively, the reduced antibody is not purified after partial reduction and prior to conjugation.
[0357] The invention also provides partially reduced activatable anti-CD166 antibodies in which at least one interchain disulfide bond in the activatable antibody has been reduced with a reducing agent without disturbing any intrachain disulfide bonds in the activatable antibody, wherein the activatable antibody includes an antibody or an antigen binding fragment thereof (AB) that specifically binds to CD166, a masking moiety (MM) that inhibits the binding of the AB of the activatable antibody in an uncleaved state to the CD166 target, and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease. In some embodiments the MM is coupled to the AB via the CM. In some embodiments, one or more intrachain disulfide bond(s) of the activatable antibody is not disturbed by the reducing agent. In some embodiments, one or more intrachain disulfide bond(s) of the MM within the activatable antibody is not disturbed by the reducing agent. In some embodiments, the activatable antibody in the uncleaved state has the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM. In some embodiments, reducing agent is TCEP.
[0358] The disclosure also provides partially reduced activatable antibodies in which at least one interchain disulfide bond in the activatable antibody has been reduced with a reducing agent without disturbing any intrachain disulfide bonds in the activatable antibody, wherein the activatable antibody includes an antibody or an antigen binding fragment thereof (AB) that specifically binds to the target, e.g., CD166, a masking moiety (MM) that inhibits the binding of the AB of the activatable antibody in an uncleaved state to the target, and a cleavable moiety (CM) coupled to the AB, wherein the CM is a polypeptide that functions as a substrate for at least one protease. In some embodiments, the MM is coupled to the AB via the CM. In some embodiments, one or more intrachain disulfide bond(s) of the activatable antibody is not disturbed by the reducing agent. In some embodiments, one or more intrachain disulfide bond(s) of the MM within the activatable antibody is not disturbed by the reducing agent. In some embodiments, the activatable antibody in the uncleaved state has the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM. In some embodiments, reducing agent is TCEP.
[0359] In yet other embodiments, a method of reducing and conjugating an agent, e.g., a drug, to an activatable anti-CD166 antibody resulting in selectivity in the placement of the agent by providing an activatable anti-CD166 antibody with a defined number and positions of lysine and/or cysteine residues. In some embodiments, the defined number of lysine and/or cysteine residues is higher or lower than the number of corresponding residues in the amino acid sequence of the parent antibody or activatable antibody. In some embodiments, the defined number of lysine and/or cysteine residues may result in a defined number of agent equivalents that can be conjugated to the anti-CD166 antibody or activatable anti-CD166 antibody. In some embodiments, the defined number of lysine and/or cysteine residues may result in a defined number of agent equivalents that can be conjugated to the anti-CD166 antibody or activatable anti-CD166 antibody in a site-specific manner. In some embodiments, the modified activatable antibody is modified with one or more non-natural amino acids in a site-specific manner, thus in some embodiments limiting the conjugation of the agents to only the sites of the non-natural amino acids. In some embodiments, the anti-CD166 antibody or activatable anti-CD166 antibody with a defined number and positions of lysine and/or cysteine residues may be partially reduced with a reducing agent as discussed herein such that any conjugation sites in the masking moiety or other non-AB portion of the activatable antibody are not reduced, and conjugating the agent to interchain thiols in the AB.
[0360] In some embodiments, the activatable antibodies described herein also include an agent conjugated to the activatable antibody. In some embodiments, the conjugated agent is a therapeutic agent, such as an anti-inflammatory and/or an antineoplastic agent. In such embodiments, the agent is conjugated to a carbohydrate moiety of the activatable antibody, for example, in some embodiments, where the carbohydrate moiety is located outside the antigen-binding region of the antibody or antigen-binding fragment in the activatable antibody. In some embodiments, the agent is conjugated to a sulfhydryl group of the antibody or antigen-binding fragment in the activatable antibody.
[0361] In some embodiments, the agent is a cytotoxic agent such as a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
[0362] In some embodiments, the agent is a detectable moiety such as, for example, a label or other marker. For example, the agent is or includes a radiolabeled amino acid, one or more biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods), one or more radioisotopes or radionuclides, one or more fluorescent labels, one or more enzymatic labels, and/or one or more chemiluminescent agents. In some embodiments, detectable moieties are attached by spacer molecules.
[0363] The disclosure also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate). Suitable cytotoxic agents include, for example, dolastatins and derivatives thereof (e.g. auristatin E, AFP, MMAF, MMAE, MMAD, DMAF, DMAE). For example, the agent is monomethyl auristatin E (MMAE) or monomethyl auristatin D (MMAD). In some embodiments, the agent is an agent selected from the group listed in Table 5. In some embodiments, the agent is a dolastatin. In some embodiments, the agent is an auristatin or derivative thereof. In some embodiments, the agent is auristatin E or a derivative thereof. In some embodiments, the agent is monomethyl auristatin E (MMAE). In some embodiments, the agent is monomethyl auristatin D (MMAD). In some embodiments, the agent is a maytansinoid or maytansinoid derivative. In some embodiments, the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or derivative thereof. In some embodiments, the agent is a calicheamicin or derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine.
[0364] In some embodiments, the agent is linked to the AB using a maleimide caproyl-valine-citrulline linker or a maleimide PEG-valine-citrulline linker. In some embodiments, the agent is linked to the AB using a maleimide caproyl-valine-citrulline linker. In some embodiments, the agent is linked to the AB using a maleimide PEG-valine-citrulline linker In some embodiments, the agent is monomethyl auristatin D (MMAD) linked to the AB using a maleimide PEG-valine-citrulline-para-aminobenzyloxycarbonyl linker, and this linker payload construct is referred to herein as vc-MMAD. In some embodiments, the agent is monomethyl auristatin E (MMAE) linked to the AB using a maleimide PEG-valine-citrulline-para-aminobenzyloxycarbonyl linker, and this linker payload construct is referred to herein as ye-MMAE. In some embodiments, the agent is linked to the AB using a maleimide PEG-valine-citrulline linker In some embodiments, the agent is monomethyl auristatin D (MMAD) linked to the AB using a maleimide bis-PEG-valine-citrulline-para-aminobenzyloxycarbonyl linker, and this linker payload construct is referred to herein as PEG2-vc-MMAD. The structures of ye-MMAD, vc-MMAE, and PEG2-vc-MMAD are shown below:
##STR00001##
[0365] The disclosure also provides conjugated activatable antibodies that include an activatable antibody linked to monomethyl auristatin D (MMAD) payload, wherein the activatable antibody includes an antibody or an antigen binding fragment thereof (AB) that specifically binds to a target, a masking moiety (MM) that inhibits the binding of the AB of the activatable antibody in an uncleaved state to the target, and cleavable moiety (CM) coupled to the AB, and the CM is a polypeptide that functions as a substrate for at least one MMP protease.
[0366] In some embodiments, the MMAD-conjugated activatable antibody can be conjugated using any of several methods for attaching agents to ABs: (a) attachment to the carbohydrate moieties of the AB, or (b) attachment to sulfhydryl groups of the AB, or (c) attachment to amino groups of the AB, or (d) attachment to carboxylate groups of the AB.
[0367] In some embodiments, the MMAD payload is conjugated to the AB via a linker. In some embodiments, the MMAD payload is conjugated to a cysteine in the AB via a linker. In some embodiments, the MMAD payload is conjugated to a lysine in the AB via a linker. In some embodiments, the MMAD payload is conjugated to another residue of the AB via a linker, such as those residues disclosed herein. In some embodiments, the linker is a thiol-containing linker. In some embodiments, the linker is a cleavable linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker is selected from the group consisting of the linkers shown in Tables 6 and 7. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimide caproyl-valine-citrulline linker. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimide PEG-valine-citrulline linker. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimide caproyl-valine-citrulline-para-aminobenzyloxycarbonyl linker. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimide PEG-valine-citrulline-para-aminobenzyloxycarbonyl linker. In some embodiments, the MMAD payload is conjugated to the AB using the partial reduction and conjugation technology disclosed herein.
[0368] In some embodiments, the polyethylene glycol (PEG) component of a linker of the present disclosure is formed from 2 ethylene glycol monomers, 3 ethylene glycol monomers, 4 ethylene glycol monomers, 5 ethylene glycol monomers, 6 ethylene glycol monomers, 7 ethylene glycol monomers 8 ethylene glycol monomers, 9 ethylene glycol monomers, or at least 10 ethylene glycol monomers. In some embodiments of the present disclosure, the PEG component is a branched polymer. In some embodiments of the present disclosure, the PEG component is an unbranched polymer. In some embodiments, the PEG polymer component is functionalized with an amino group or derivative thereof, a carboxyl group or derivative thereof, or both an amino group or derivative thereof and a carboxyl group or derivative thereof.
[0369] In some embodiments, the PEG component of a linker of the present disclosure is an amino-tetra-ethylene glycol-carboxyl group or derivative thereof. In some embodiments, the PEG component of a linker of the present disclosure is an amino-tri-ethylene glycol-carboxyl group or derivative thereof. In some embodiments, the PEG component of a linker of the present disclosure is an amino-di-ethylene glycol-carboxyl group or derivative thereof. In some embodiments, an amino derivative is the formation of an amide bond between the amino group and a carboxyl group to which it is conjugated. In some embodiments, a carboxyl derivative is the formation of an amide bond between the carboxyl group and an amino group to which it is conjugated. In some embodiments, a carboxyl derivative is the formation of an ester bond between the carboxyl group and an hydroxyl group to which it is conjugated.
[0370] Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include .sup.212Bi, .sup.131I, .sup.131In, .sup.90Y, and .sup.186Re.
[0371] Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. (See WO94/11026).
[0372] Table 5 lists some of the exemplary pharmaceutical agents that may be employed in the herein described disclosure but in no way is meant to be an exhaustive list.
TABLE-US-00011 TABLE 5 Exemplary Pharmaceutical Agents for Conjugation CYTOTOXIC AGENTS Auristatins Auristatin E Monomethyl auristatin D (MMAD) Monomethyl auristatin E (MMAE) Desmethyl auristatin E (DMAE) Auristatin F Monomethyl auristatin F (MMAF) Desmethyl auristatin F (DMAF) Auristatin derivatives, e.g., amides thereof Auristatin tyramine Auristatin quinoline Dolastatins Dolastatin derivatives Dolastatin 16 DmJ Dolastatin 16 Dpv Maytansinoids, e.g. DM-1; DM-4 Maytansinoid derivatives Duocarmycin Duocarmycin derivatives Alpha-amanitin Anthracyclines Doxorubicin Daunorubicin Bryostatins Camptothecin Camptothecin derivatives 7-substituted Camptothecin 10, 11- Difluoromethylenedioxycamptothecin Combretastatins Debromoaplysiatoxin Kahalalide-F Discodermolide Ecteinascidins Turbostatin Phenstatins Hydroxyphenstatin Spongistatin 5 Spongistatin 7 Halistatin 1 Halistatin 2 Halistatin 3 Modified Bryostatins Halocomstatins Pyrrolobenzimidazoles (PBI) Cibrostatin6 Doxaliform Anthracyclins analogues Cemadotin analogue (CemCH2-SH) Pseudomonas toxin A (PE38) variant Pseudomonas toxin A (ZZ-PE38) variant ZJ-101 OSW-1 4-Nitrobenzyloxycarbonyl Derivatives of O6-Benzylguanine Topoisomerase inhibitors Hemiasterlin Cephalotaxine Homoharringtonine Pyrrolobenzodiazepine dimers (PBDs) Functionalized pyrrolobenzodiazepenes Calicheamicins Podophyllotoxins Taxanes Vinca alkaloids ANTIVIRALS Acyclovir Vira A Symmetrel ANTIFUNGALS Nystatin ADDITIONAL ANTI-NEOPLASTICS Adriamycin Cerubidine Bleomycin Alkeran Velban Oncovin Fluorouracil Methotrexate Thiotepa Bisantrene Novantrone Thioguanine Procarabizine Cytarabine ANTI-BACTERIALS Aminoglycosides Streptomycin Neomycin Kanamycin Amikacin Gentamicin Tobramycin Streptomycin B Spectinomycin Ampicillin Sulfanilamide Polymyxin Chloramphenicol CONJUGATABLE DETECTION REAGENTS Fluorescein and derivatives thereof Fluorescein isothiocyanate (FITC) RADIOPHARMACEUTICALS .sup.125I .sup.131I .sup.89Zr .sup.111In .sup.123I .sup.131I .sup.99mTc .sup.201Tl .sup.133Xe .sup.11C .sup.62Cu .sup.18F .sup.68Ga .sup.13N .sup.15O .sup.38K .sup.82Rb .sup.99mTc (Technetium) HEAVY METALS Barium Gold Platinum ANTI-MYCOPLASMALS Tylosine Spectinomycin
[0373] Those of ordinary skill in the art will recognize that a large variety of possible moieties can be coupled to the resultant antibodies of the disclosure. (See, for example, Conjugate Vaccines, Contributions to Microbiology and Immunology, J. M. Cruse and R. E. Lewis, Jr (eds), Carger Press, New York, (1989), the entire contents of which are incorporated herein by reference).
[0374] Coupling may be accomplished by any chemical reaction that will bind the two molecules so long as the antibody and the other moiety retain their respective activities. This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation. In some embodiments, the binding is, however, covalent binding. Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents are useful in coupling protein molecules, such as the antibodies of the present disclosure, to other molecules. For example, representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines. This listing is not intended to be exhaustive of the various classes of coupling agents known in the art but, rather, is exemplary of the more common coupling agents. (See Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984); Jansen et al., Immunological Reviews 62:185-216 (1982); and Vitetta et al., Science 238:1098 (1987).
[0375] In some embodiments, in addition to the compositions and methods provided herein, the conjugated activatable antibody can also be modified for site-specific conjugation through modified amino acid sequences inserted or otherwise included in the activatable antibody sequence. These modified amino acid sequences are designed to allow for controlled placement and/or dosage of the conjugated agent within a conjugated activatable antibody. For example, the activatable antibody can be engineered to include cysteine substitutions at positions on light and heavy chains that provide reactive thiol groups and do not negatively impact protein folding and assembly, nor alter antigen binding. In some embodiments, the activatable antibody can be engineered to include or otherwise introduce one or more non-natural amino acid residues within the activatable antibody to provide suitable sites for conjugation. In some embodiments, the activatable antibody can be engineered to include or otherwise introduce enzymatically activatable peptide sequences within the activatable antibody sequence.
[0376] Suitable linkers are described in the literature. (See, for example, Ramakrishnan, S. et al., Cancer Res. 44:201-208 (1984) describing use of MBS (M-maleimidobenzoyl-N-hydroxysuccinimide ester). See also, U.S. Pat. No. 5,030,719, describing use of halogenated acetyl hydrazide derivative coupled to an antibody by way of an oligopeptide linker. In some embodiments, suitable linkers include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2-pyridyldithio) propionamido]hexanoate (Pierce Chem. Co., Cat #21651G); (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6 [3-(2-pyridyldithio)-propianamide] hexanoate (Pierce Chem. Co. Cat. #2165-G); and (v) sulfo-NHS (N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510) conjugated to EDC. Additional linkers include, but are not limited to, SMCC ((succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate), sulfo-SMCC (sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate), SPDB (N-succinimidyl-4-(2-pyridyldithio) butanoate), or sulfo-SPDB (N-succinimidyl-4-(2-pyridyldithio)-2-sulfo butanoate).
[0377] The linkers described above contain components that have different attributes, thus leading to conjugates with differing physio-chemical properties. For example, sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NETS-ester containing linkers are less soluble than sulfo-NHS esters. Further, the linker SMPT contains a sterically hindered disulfide bond, and can form conjugates with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less conjugate available. Sulfo-NHS, in particular, can enhance the stability of carbodimide couplings. Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
[0378] In some embodiments, the linkers are cleavable. In some embodiments, the linkers are non-cleavable. In some embodiments, two or more linkers are present. The two or more linkers are all the same, i.e., cleavable or non-cleavable, or the two or more linkers are different, i.e., at least one cleavable and at least one non-cleavable.
[0379] The present disclosure utilizes several methods for attaching agents to ABs: (a) attachment to the carbohydrate moieties of the AB, or (b) attachment to sulfhydryl groups of the AB, or (c) attachment to amino groups of the AB, or (d) attachment to carboxylate groups of the AB. According to the disclosure, ABs may be covalently attached to an agent through an intermediate linker having at least two reactive groups, one to react with AB and one to react with the agent. The linker, which may include any compatible organic compound, can be chosen such that the reaction with AB (or agent) does not adversely affect AB reactivity and selectivity. Furthermore, the attachment of linker to agent might not destroy the activity of the agent. Suitable linkers for reaction with oxidized antibodies or oxidized antibody fragments include those containing an amine selected from the group consisting of primary amine, secondary amine, hydrazine, hydrazide, hydroxylamine, phenylhydrazine, semicarbazide and thiosemicarbazide groups. Such reactive functional groups may exist as part of the structure of the linker, or may be introduced by suitable chemical modification of linkers not containing such groups.
[0380] According to the present disclosure, suitable linkers for attachment to reduced ABs include those having certain reactive groups capable of reaction with a sulfhydryl group of a reduced antibody or fragment. Such reactive groups include, but are not limited to: reactive haloalkyl groups (including, for example, haloacetyl groups), p-mercuribenzoate groups and groups capable of Michael-type addition reactions (including, for example, maleimides and groups of the type described by Mitra and Lawton, 1979, J. Amer. Chem. Soc. 101: 3097-3110).
[0381] According to the present disclosure, suitable linkers for attachment to neither oxidized nor reduced Abs include those having certain functional groups capable of reaction with the primary amino groups present in unmodified lysine residues in the Ab. Such reactive groups include, but are not limited to, NHS carboxylic or carbonic esters, sulfo-NHS carboxylic or carbonic esters, 4-nitrophenyl carboxylic or carbonic esters, pentafluorophenyl carboxylic or carbonic esters, acyl imidazoles, isocyanates, and isothiocyanates.
[0382] According to the present disclosure, suitable linkers for attachment to neither oxidized nor reduced Abs include those having certain functional groups capable of reaction with the carboxylic acid groups present in aspartate or glutamate residues in the Ab, which have been activated with suitable reagents. Suitable activating reagents include EDC, with or without added NHS or sulfo-NHS, and other dehydrating agents utilized for carboxamide formation. In these instances, the functional groups present in the suitable linkers would include primary and secondary amines, hydrazines, hydroxylamines, and hydrazides.
[0383] The agent may be attached to the linker before or after the linker is attached to the AB. In certain applications it may be desirable to first produce an AB-linker intermediate in which the linker is free of an associated agent. Depending upon the particular application, a specific agent may then be covalently attached to the linker. In some embodiments, the AB is first attached to the MM, CM and associated linkers and then attached to the linker for conjugation purposes.
[0384] Branched Linkers:
[0385] In specific embodiments, branched linkers that have multiple sites for attachment of agents are utilized. For multiple site linkers, a single covalent attachment to an AB would result in an AB-linker intermediate capable of binding an agent at a number of sites. The sites may be aldehyde or sulfhydryl groups or any chemical site to which agents can be attached.
[0386] In some embodiments, higher specific activity (or higher ratio of agents to AB) can be achieved by attachment of a single site linker at a plurality of sites on the AB. This plurality of sites may be introduced into the AB by either of two methods. First, one may generate multiple aldehyde groups and/or sulfhydryl groups in the same AB. Second, one may attach to an aldehyde or sulfhydryl of the AB a branched linker having multiple functional sites for subsequent attachment to linkers. The functional sites of the branched linker or multiple site linker may be aldehyde or sulfhydryl groups, or may be any chemical site to which linkers may be attached. Still higher specific activities may be obtained by combining these two approaches, that is, attaching multiple site linkers at several sites on the AB.
[0387] Cleavable Linkers:
[0388] Peptide linkers that are susceptible to cleavage by enzymes of the complement system, such as but not limited to u-plasminogen activator, tissue plasminogen activator, trypsin, plasmin, or another enzyme having proteolytic activity may be used in one embodiment of the present disclosure. According to one method of the present disclosure, an agent is attached via a linker susceptible to cleavage by complement. The antibody is selected from a class that can activate complement. The antibody-agent conjugate, thus, activates the complement cascade and releases the agent at the target site. According to another method of the present disclosure, an agent is attached via a linker susceptible to cleavage by enzymes having a proteolytic activity such as a u-plasminogen activator, a tissue plasminogen activator, plasmin, or trypsin. These cleavable linkers are useful in conjugated activatable antibodies that include an extracellular toxin, e.g., by way of non-limiting example, any of the extracellular toxins shown in Table 5.
[0389] Non-limiting examples of cleavable linker sequences are provided in Table 6.
TABLE-US-00012 TABLE6 ExemplaryLinkerSequencesforConjugation TypesofCleavableSequences AminoAcidSequence Plasmincleavablesequences Pro-urokinase PRFKIIGG(SEQIDNO:89) PRFRIIGG(SEQIDNO:90) TGF SSRHRRALD(SEQIDNO:91) Plasminogen RKSSIIIRMRDVVL(SEQIDNO:92) Staphylokinase SSSFDKGKYKKGDDA(SEQIDNO:93) SSSFDKGKYKRGDDA(SEQIDNO:94) FactorXacleavablesequences IEGR(SEQIDNO:95) IDGR(SEQIDNO:96) GGSIDGR(SEQIDNO:97) MMPcleavablesequences GelatinaseA PLGLWA(SEQIDNO:98) Collagenasecleavablesequences Calfskincollagen(1(I)chain) GPQGIAGQ(SEQIDNO:99) Calfskincollagen(2(I)chain) GPQGLLGA(SEQIDNO:100) Bovinecartilagecollagen(1(II)chain) GIAGQ(SEQIDNO:101) Humanlivercollagen(1(III)chain) GPLGIAGI(SEQIDNO:102) Human.sub.2M GPEGLRVG(SEQIDNO:103) HumanPZP YGAGLGVV(SEQIDNO:104) AGLGVVER(SEQIDNO:105) AGLGISST(SEQIDNO:106) Rat.sub.1M EPQALAMS(SEQIDNO:107) QALAMSAI(SEQIDNO:108) Rat.sub.2M AAYHLVSQ(SEQIDNO:109) MDAFLESS(SEQIDNO:110) Rat.sub.1I.sub.3(2J) ESLPVVAV(SEQIDNO:111) Rat.sub.1I.sub.3(27J) SAPAVESE(SEQIDNO:112) Humanfibroblastcollagenase DVAQFVLT(SEQIDNO:113) (autolyticcleavages) VAQFVLTE(SEQIDNO:114) AQFVLTEG(SEQIDNO:115) PVQPIGPQ(SEQIDNO:116)
[0390] In addition, agents may be attached via disulfide bonds (for example, the disulfide bonds on a cysteine molecule) to the AB. Since many tumors naturally release high levels of glutathione (a reducing agent) this can reduce the disulfide bonds with subsequent release of the agent at the site of delivery. In some embodiments, the reducing agent that would modify a CM would also modify the linker of the conjugated activatable antibody.
[0391] Spacers and Cleavable Elements:
[0392] In some embodiments, it may be necessary to construct the linker in such a way as to optimize the spacing between the agent and the AB of the activatable antibody. This may be accomplished by use of a linker of the general structure:
W(CH.sub.2)n-Q
wherein
W is either NHCH.sub.2 or CH.sub.2;
Q is an amino acid, peptide; and
n is an integer from 0 to 20.
[0393] In some embodiments, the linker may comprise a spacer element and a cleavable element. The spacer element serves to position the cleavable element away from the core of the AB such that the cleavable element is more accessible to the enzyme responsible for cleavage. Certain of the branched linkers described above may serve as spacer elements.
[0394] Throughout this discussion, it should be understood that the attachment of linker to agent (or of spacer element to cleavable element, or cleavable element to agent) need not be particular mode of attachment or reaction. Any reaction providing a product of suitable stability and biological compatibility is acceptable.
[0395] Serum Complement and Selection of Linkers:
[0396] According to one method of the present disclosure, when release of an agent is desired, an AB that is an antibody of a class that can activate complement is used. The resulting conjugate retains both the ability to bind antigen and activate the complement cascade. Thus, according to this embodiment of the present disclosure, an agent is joined to one end of the cleavable linker or cleavable element and the other end of the linker group is attached to a specific site on the AB. For example, if the agent has an hydroxy group or an amino group, it may be attached to the carboxy terminus of a peptide, amino acid or other suitably chosen linker via an ester or amide bond, respectively. For example, such agents may be attached to the linker peptide via a carbodimide reaction. If the agent contains functional groups that would interfere with attachment to the linker, these interfering functional groups can be blocked before attachment and deblocked once the product conjugate or intermediate is made. The opposite or amino terminus of the linker is then used either directly or after further modification for binding to an AB that is capable of activating complement.
[0397] Linkers (or spacer elements of linkers) may be of any desired length, one end of which can be covalently attached to specific sites on the AB of the activatable antibody. The other end of the linker or spacer element may be attached to an amino acid or peptide linker.
[0398] Thus when these conjugates bind to antigen in the presence of complement the amide or ester bond that attaches the agent to the linker will be cleaved, resulting in release of the agent in its active form. These conjugates, when administered to a subject, will accomplish delivery and release of the agent at the target site, and are particularly effective for the in vivo delivery of pharmaceutical agents, antibiotics, antimetabolites, antiproliferative agents and the like as presented in but not limited to those in Table 5.
[0399] Linkers for Release without Complement Activation:
[0400] In yet another application of targeted delivery, release of the agent without complement activation is desired since activation of the complement cascade will ultimately lyse the target cell. Hence, this approach is useful when delivery and release of the agent should be accomplished without killing the target cell. Such is the goal when delivery of cell mediators such as hormones, enzymes, corticosteroids, neurotransmitters, genes or enzymes to target cells is desired. These conjugates may be prepared by attaching the agent to an AB that is not capable of activating complement via a linker that is mildly susceptible to cleavage by serum proteases. When this conjugate is administered to an individual, antigen-antibody complexes will form quickly whereas cleavage of the agent will occur slowly, thus resulting in release of the compound at the target site.
[0401] Biochemical Cross Linkers:
[0402] In some embodiments, the activatable antibody may be conjugated to one or more therapeutic agents using certain biochemical cross-linkers. Cross-linking reagents form molecular bridges that tie together functional groups of two different molecules. To link two different proteins in a step-wise manner, hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.
[0403] Peptidyl linkers cleavable by lysosomal proteases are also useful, for example, Val-Cit, Val-Ala or other dipeptides. In addition, acid-labile linkers cleavable in the low-pH environment of the lysosome may be used, for example: bis-sialyl ether. Other suitable linkers include cathepsin-labile substrates, particularly those that show optimal function at an acidic pH.
[0404] Exemplary hetero-bifunctional cross-linkers are referenced in Table 7.
TABLE-US-00013 TABLE 7 Exemplary Hetero-Bifunctional Cross Linkers HETERO-BIFUNCTIONAL CROSS-LINKERS Spacer Arm Length after cross-linking Linker Reactive Toward Advantages and Applications (Angstroms) SMPT Primary amines Greater stability 11.2 Sulfhydryls SPDP Primary amines Thiolation 6.8 Sulfhydryls Cleavable cross-linking LC-SPDP Primary amines Extended spacer arm 15.6 Sulfhydryls Sulfo-LC-SPDP Primary amines Extender spacer arm 15.6 Sulfhydryls Water-soluble SMCC Primary amines Stable maleimide reactive 11.6 group Sulfhydryls Enzyme-antibody conjugation Hapten-carrier protein conjugation Sulfo-SMCC Primary amines Stable maleimide reactive 11.6 group Sulfhydryls Water-soluble Enzyme-antibody conjugation MBS Primary amines Enzyme-antibody conjugation 9.9 Sulfhydryls Hapten-carrier protein conjugation Sulfo-MBS Primary amines Water-soluble 9.9 Sulfhydryls SIAB Primary amines Enzyme-antibody conjugation 10.6 Sulfhydryls Sulfo-SIAB Primary amines Water-soluble 10.6 Sulfhydryls SMPB Primary amines Extended spacer arm 14.5 Sulfhydryls Enzyme-antibody conjugation Sulfo-SMPB Primary amines Extended spacer arm 14.5 Sulfhydryls Water-soluble EDE/Sulfo-NHS Primary amines Hapten-Carrier conjugation 0 Carboxyl groups ABH Carbohydrates Reacts with sugar groups 11.9 Nonselective
[0405] Non-Cleavable Linkers or Direct Attachment:
[0406] In some embodiments of the disclosure, the conjugate may be designed so that the agent is delivered to the target but not released. This may be accomplished by attaching an agent to an AB either directly or via a non-cleavable linker.
[0407] These non-cleavable linkers may include amino acids, peptides, D-amino acids or other organic compounds that may be modified to include functional groups that can subsequently be utilized in attachment to ABs by the methods described herein. A-general formula for such an organic linker could be
W(CH.sub.2)n-Q
wherein
W is either NHCH.sub.2 or CH.sub.2;
Q is an amino acid, peptide; and
n is an integer from 0 to 20.
[0408] Non-Cleavable Conjugates:
[0409] In some embodiments, a compound may be attached to ABs that do not activate complement. When using ABs that are incapable of complement activation, this attachment may be accomplished using linkers that are susceptible to cleavage by activated complement or using linkers that are not susceptible to cleavage by activated complement.
[0410] The antibodies disclosed herein can also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
[0411] Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. Fab fragments of the antibody of the present disclosure can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction.
Definitions
[0412] Unless otherwise defined, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. The term a entity or an entity refers to one or more of that entity. For example, a compound refers to one or more compounds. As such, the terms a, an, one or more and at least one can be used interchangeably. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Generally, nomenclatures utilized in connection with, and techniques of, cell and tissue culture, molecular biology, and protein and oligo- or polynucleotide chemistry and hybridization described herein are those well-known and commonly used in the art. Standard techniques are used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection). Enzymatic reactions and purification techniques are performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The foregoing techniques and procedures are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. See e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)). The nomenclatures utilized in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art. Standard techniques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.
[0413] As utilized in accordance with the present disclosure, the following terms, unless otherwise indicated, shall be understood to have the following meanings:
[0414] As used herein, the term antibody refers to immunoglobulin molecules and immunologically active, e.g., antigen-binding, portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. By specifically bind or immunoreacts with or immunospecifically bind is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides or binds at much lower affinity (K.sub.d>10.sup.6). Antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, domain antibody, single chain, Fab, and F(ab).sub.2 fragments, scFvs, and an Fab expression library.
[0415] The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one light (about 25 kDa) and one heavy chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. In general, antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG.sub.1, IgG.sub.2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.
[0416] The term monoclonal antibody (mAb) or monoclonal antibody composition, as used herein, refers to a population of antibody molecules that contain only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population. MAbs contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.
[0417] The term antigen-binding site or binding portion refers to the part of the immunoglobulin molecule that participates in antigen binding. The antigen binding site is formed by amino acid residues of the N-terminal variable (V) regions of the heavy (H) and light (L) chains. Three highly divergent stretches within the V regions of the heavy and light chains, referred to as hypervariable regions, are interposed between more conserved flanking stretches known as framework regions, or FRs. Thus, the term FR refers to amino acid sequences that are naturally found between, and adjacent to, hypervariable regions in immunoglobulins. In an antibody molecule, the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as complementarity-determining regions, or CDRs. The assignment of amino acids to each domain is in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk J. Mol. Biol. 196:901-917 (1987), Chothia et al. Nature 342:878-883 (1989).
[0418] As used herein, the term epitope includes any protein determinant capable of specific binding to an immunoglobulin, an scFv, or a T-cell receptor. The term epitope includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. For example, antibodies may be raised against N-terminal or C-terminal peptides of a polypeptide. An antibody is said to specifically bind an antigen when the dissociation constant is 1 M; in some embodiments, 100 nM and in some embodiments, 10 nM.
[0419] As used herein, the terms specific binding, immunological binding, and immunological binding properties refer to the non-covalent interactions of the type which occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific. The strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K.sub.d) of the interaction, wherein a smaller K.sub.d represents a greater affinity. Immunological binding properties of selected polypeptides can be quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions. Thus, both the on rate constant (K.sub.on) and the off rate constant (K.sub.off) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)). The ratio of K.sub.off/K.sub.on enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant K.sub.d. (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473). An antibody of the present disclosure is said to specifically bind to the target, when the binding constant (K.sub.d) is M, in some embodiments 100 nM, in some embodiments 10 nM, and in some embodiments 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art.
[0420] The term isolated polynucleotide as used herein shall mean a polynucleotide of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the isolated polynucleotide (1) is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence. Polynucleotides in accordance with the disclosure include the nucleic acid molecules encoding the heavy chain immunoglobulin molecules shown herein, and nucleic acid molecules encoding the light chain immunoglobulin molecules shown herein.
[0421] The term isolated protein referred to herein means a protein of cDNA, recombinant RNA, or synthetic origin or some combination thereof, which by virtue of its origin, or source of derivation, the isolated protein (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, e.g., free of murine proteins, (3) is expressed by a cell from a different species, or (4) does not occur in nature.
[0422] The term polypeptide is used herein as a generic term to refer to native protein, fragments, or analogs of a polypeptide sequence. Hence, native protein fragments, and analogs are species of the polypeptide genus. Polypeptides in accordance with the disclosure comprise the heavy chain immunoglobulin molecules shown herein, and the light chain immunoglobulin molecules shown herein, as well as antibody molecules formed by combinations comprising the heavy chain immunoglobulin molecules with light chain immunoglobulin molecules, such as kappa light chain immunoglobulin molecules, and vice versa, as well as fragments and analogs thereof.
[0423] The term naturally-occurring as used herein as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and that has not been intentionally modified by man in the laboratory or otherwise is naturally-occurring.
[0424] The term operably linked as used herein refers to positions of components so described are in a relationship permitting them to function in their intended manner. A control sequence operably linked to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
[0425] The term control sequence as used herein refers to polynucleotide sequences that are necessary to effect the expression and processing of coding sequences to which they are ligated. The nature of such control sequences differs depending upon the host organism in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence in eukaryotes, generally, such control sequences include promoters and transcription termination sequence. The term control sequences is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences. The term polynucleotide as referred to herein means nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide. The term includes single and double stranded forms of DNA.
[0426] The term oligonucleotide referred to herein includes naturally occurring, and modified nucleotides linked together by naturally occurring, and non-naturally occurring oligonucleotide linkages. Oligonucleotides are a polynucleotide subset generally comprising a length of 200 bases or fewer. In some embodiments, oligonucleotides are 10 to 60 bases in length and in some embodiments, 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 bases in length. Oligonucleotides are usually single stranded, e.g., for probes, although oligonucleotides may be double stranded, e.g., for use in the construction of a gene mutant. Oligonucleotides of the disclosure are either sense or antisense oligonucleotides.
[0427] The term naturally occurring nucleotides referred to herein includes deoxyribonucleotides and ribonucleotides. The term modified nucleotides referred to herein includes nucleotides with modified or substituted sugar groups and the like. The term oligonucleotide linkages referred to herein includes oligonucleotide linkages such as phosphorothioate, phosphorodithioate, phosphoroselerloate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate, phosphoronmidate, and the like. See e.g., LaPlanche et al. Nucl. Acids Res. 14:9081 (1986); Stec et al. J. Am. Chem. Soc. 106:6077 (1984), Stein et al. Nucl. Acids Res. 16:3209 (1988), Zon et al. Anti Cancer Drug Design 6:539 (1991); Zon et al. Oligonucleotides and Analogues: A Practical Approach, pp. 87-108 (F. Eckstein, Ed., Oxford University Press, Oxford England (1991)); Stec et al. U.S. Pat. No. 5,151,510; Uhlmann and Peyman Chemical Reviews 90:543 (1990). An oligonucleotide can include a label for detection, if desired.
[0428] As used herein, the twenty conventional amino acids and their abbreviations follow conventional usage. See ImmunologyA Synthesis (2nd Edition, E. S. Golub and D. R. Green, Eds., Sinauer Associates, Sunderland, Mass. (1991)). Stereoisomers (e.g., D-amino acids) of the twenty conventional amino acids, unnatural amino acids such as -, -disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids may also be suitable components for polypeptides of the present disclosure. Examples of unconventional amino acids include: 4 hydroxyproline, -carboxyglutamate, -N,N,N-trimethyllysine, -N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, -N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline). In the polypeptide notation used herein, the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy-terminal direction, in accordance with standard usage and convention.
[0429] Similarly, unless specified otherwise, the left-hand end of single-stranded polynucleotide sequences is the 5 end the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5 direction. The direction of 5 to 3 addition of nascent RNA transcripts is referred to as the transcription direction sequence regions on the DNA strand having the same sequence as the RNA and that are 5 to the 5 end of the RNA transcript are referred to as upstream sequences, sequence regions on the DNA strand having the same sequence as the RNA and that are 3 to the 3 end of the RNA transcript are referred to as downstream sequences.
[0430] As applied to polypeptides, the term substantial identity means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 80 percent sequence identity, in some embodiments, at least 90 percent sequence identity, in some embodiments, at least 95 percent sequence identity, and in some embodiments, at least 99 percent sequence identity.
[0431] In some embodiments, residue positions that are not identical differ by conservative amino acid substitutions.
[0432] As discussed herein, minor variations in the amino acid sequences of antibodies or immunoglobulin molecules are contemplated as being encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain at least 75%, in some embodiments, at least 80%, 90%, 95%, and in some embodiments, 99%. In particular, conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids are generally divided into families: (1) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non-polar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. The hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine. The hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine. Other families of amino acids include (i) serine and threonine, which are the aliphatic-hydroxy family; (ii) asparagine and glutamine, which are the amide containing family; (iii) alanine, valine, leucine and isoleucine, which are the aliphatic family; and (iv) phenylalanine, tryptophan, and tyrosine, which are the aromatic family. For example, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid will not have a major effect on the binding or properties of the resulting molecule, especially if the replacement does not involve an amino acid within a framework site. Whether an amino acid change results in a functional peptide can readily be determined by assaying the specific activity of the polypeptide derivative. Assays are described in detail herein. Fragments or analogs of antibodies or immunoglobulin molecules can be readily prepared by those of ordinary skill in the art. Suitable amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. In some embodiments, computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. Bowie et al. Science 253:164 (1991). Thus, the foregoing examples demonstrate that those of skill in the art can recognize sequence motifs and structural conformations that may be used to define structural and functional domains in accordance with the disclosure.
[0433] Suitable amino acid substitutions are those that: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (5) confer or modify other physicochemical or functional properties of such analogs. Analogs can include various muteins of a sequence other than the naturally-occurring peptide sequence. For example, single or multiple amino acid substitutions (for example, conservative amino acid substitutions) may be made in the naturally-occurring sequence (for example, in the portion of the polypeptide outside the domain(s) forming intermolecular contacts. A conservative amino acid substitution should not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that characterizes the parent sequence). Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et at. Nature 354:105 (1991).
[0434] The term polypeptide fragment as used herein refers to a polypeptide that has an amino terminal and/or carboxy-terminal deletion and/or one or more internal deletion(s), but where the remaining amino acid sequence is identical to the corresponding positions in the naturally-occurring sequence deduced, for example, from a full length cDNA sequence. Fragments typically are at least 5, 6, 8 or 10 amino acids long, in some embodiments, at least 14 amino acids long, in some embodiments, at least 20 amino acids long, usually at least 50 amino acids long, and in some embodiments, at least 70 amino acids long. The term analog as used herein refers to polypeptides that are comprised of a segment of at least 25 amino acids that has substantial identity to a portion of a deduced amino acid sequence and that has specific binding to the target, under suitable binding conditions. Typically, polypeptide analogs comprise a conservative amino acid substitution (or addition or deletion) with respect to the naturally-occurring sequence. Analogs typically are at least 20 amino acids long, in some embodiments, at least 50 amino acids long or longer, and can often be as long as a full-length naturally-occurring polypeptide.
[0435] The term agent is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials.
[0436] As used herein, the terms label or labeled refers to incorporation of a detectable marker, e.g., by incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods). In certain situations, the label or marker can also be therapeutic. Various methods of labeling polypeptides and glycoproteins are known in the art and may be used. Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., .sup.3H, .sup.14C, .sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, p-galactosidase, luciferase, alkaline phosphatase), chemiluminescent, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags). In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance. The term pharmaceutical agent or drug as used herein refers to a chemical compound or composition capable of inducing a desired therapeutic effect when properly administered to a patient.
[0437] Other chemistry terms herein are used according to conventional usage in the art, as exemplified by The McGraw-Hill Dictionary of Chemical Terms (Parker, S., Ed., McGraw-Hill, San Francisco (1985)).
[0438] As used herein, substantially pure means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and in some embodiments, a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all macromolecular species present.
[0439] Generally, a substantially pure composition will comprise more than about 80 percent of all macromolecular species present in the composition, in some embodiments, more than about 85%, 90%, 95%, and 99%. In some embodiments, the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
[0440] The term patient includes human and veterinary subjects.
[0441] Antibodies and/or activatable antibodies of the disclosure specifically bind a given target, e.g., a human target protein such as human CD166. Also included in the disclosure are antibodies and/or activatable antibodies that bind to the same epitope as the antibodies and/or activatable antibodies described herein. Also included in the disclosure are antibodies and/or antibodies activatable antibodies that compete with an anti-CD166 antibody and/or an anti-CD166 activatable antibody described herein for binding to CD166, e.g., human CD166. Also included in the disclosure are antibodies and/or antibodies activatable antibodies that cross-compete with an anti-CD166 antibody and/or an anti-CD166 activatable antibody described herein for binding to CD166, e.g., human CD166.
[0442] Those skilled in the art will recognize that it is possible to determine, without undue experimentation, if a monoclonal antibody (e.g., a murine monoclonal or humanized antibody) has the same specificity as a monoclonal antibody used in the methods described herein by ascertaining whether the former prevents the latter from binding to the target. If the monoclonal antibody being tested competes with the monoclonal antibody of the disclosure, as shown by a decrease in binding by the monoclonal antibody of the disclosure, then the two monoclonal antibodies bind to the same, or a closely related, epitope. An alternative method for determining whether a monoclonal antibody has the specificity of a monoclonal antibody of the disclosure is to pre-incubate the monoclonal antibody of the disclosure with the target and then add the monoclonal antibody being tested to determine if the monoclonal antibody being tested is inhibited in its ability to bind the target. If the monoclonal antibody being tested is inhibited then, in all likelihood, it has the same, or functionally equivalent, epitopic specificity as the monoclonal antibody of the disclosure.
[0443] Multispecific Activatable Antibodies
[0444] The disclosure also provides multispecific anti-CD166 activatable antibodies. The multispecific activatable antibodies provided herein are multispecific antibodies that recognize CD166 and at least one or more different antigens or epitopes and that include at least one masking moiety (MM) linked to at least one antigen- or epitope-binding domain of the multispecific antibody such that coupling of the MM reduces the ability of the antigen- or epitope-binding domain to bind its target. In some embodiments, the MM is coupled to the antigen- or epitope-binding domain of the multispecific antibody via a cleavable moiety (CM) that functions as a substrate for at least one protease. The activatable multispecific antibodies provided herein are stable in circulation, activated at intended sites of therapy and/or diagnosis but not in normal, i.e., healthy tissue, and, when activated, exhibit binding to a target that is at least comparable to the corresponding, unmodified multispecific antibody.
[0445] In some embodiments, the multispecific activatable antibodies are designed to engage immune effector cells, also referred to herein as immune-effector cell engaging multispecific activatable antibodies. In some embodiments, the multispecific activatable antibodies are designed to engage leukocytes, also referred to herein as leukocyte engaging multispecific activatable antibodies. In some embodiments, the multispecific activatable antibodies are designed to engage T cells, also referred to herein as T-cell engaging multispecific activatable antibodies. In some embodiments, the multispecific activatable antibodies engage a surface antigen on a leukocyte, such as on a T cell, on a natural killer (NK) cell, on a myeloid mononuclear cell, on a macrophage, and/or on another immune effector cell. In some embodiments, the immune effector cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. In some embodiments, the immune effector cell is a NK cell. In some embodiments, the immune effector cell is a mononuclear cell, such as a myeloid mononuclear cell. In some embodiments, the multispecific activatable antibodies are designed to bind or otherwise interact with more than one target and/or more than one epitope, also referred to herein as multi-antigen targeting activatable antibodies. As used herein, the terms target and antigen are used interchangeably.
[0446] In some embodiments, immune effector cell engaging multispecific activatable antibodies of the disclosure include a targeting antibody or antigen-binding fragment thereof that binds CD166 and an immune effector cell engaging antibody or antigen-binding portion thereof, where at least one of the targeting antibody or antigen-binding fragment thereof and/or the immune effector cell engaging antibody or antigen-binding portion thereof is masked. In some embodiments, the immune effector cell engaging antibody or antigen binding fragment thereof includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first, immune effector cell engaging target, where the AB1 is attached to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind the first target. In some embodiments, the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (AB2) that binds CD166, where the AB2 is attached to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind CD166. In some embodiments, the immune effector cell engaging antibody or antigen binding fragment thereof includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first, immune effector cell engaging target, where the AB1 is attached to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind the first target, and the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (AB2) that binds CD166, where the AB2 is attached to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind CD166. In some embodiments, the non-immune effector cell engaging antibody is a cancer targeting antibody. In some embodiments the non-immune cell effector antibody is an IgG. In some embodiments the immune effector cell engaging antibody is a scFv. In some embodiments the CD166-targeting antibody (e.g., non-immune cell effector antibody) is an IgG and the immune effector cell engaging antibody is a scFv. In some embodiments, the immune effector cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. In some embodiments, the immune effector cell is a NK cell. In some embodiments, the immune effector cell is a myeloid mononuclear cell.
[0447] In some embodiments, T-cell engaging multispecific activatable antibodies of the disclosure include a CD166-targeting antibody or antigen-binding fragment thereof and a T-cell engaging antibody or antigen-binding portion thereof, where at least one of the CD166-targeting antibody or antigen-binding fragment thereof and/or the T-cell engaging antibody or antigen-binding portion thereof is masked. In some embodiments, the T-cell engaging antibody or antigen binding fragment thereof includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first, T-cell engaging target, where the AB1 is attached to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind the first target. In some embodiments, the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (AB2) that binds CD166, where the AB2 is attached to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind CD166. In some embodiments, the T-cell engaging antibody or antigen binding fragment thereof includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first, T-cell engaging target, where the AB1 is attached to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind the first target, and the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (AB2) that binds CD166, where the AB2 is attached to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind CD166.
[0448] In some embodiments of an immune effector cell engaging multispecific activatable antibody, one antigen is CD166, and another antigen is typically a stimulatory or inhibitory receptor present on the surface of a T-cell, natural killer (NK) cell, myeloid mononuclear cell, macrophage, and/or other immune effector cell, such as, but not limited to, B7-H4, BTLA, CD3, CD4, CD8, CD16a, CD25, CD27, CD28, CD32, CD56, CD137, CTLA-4, GITR, HVEM, ICOS, LAG3, NKG2D, OX40, PD-1, TIGIT, TIM3, or VISTA. In some embodiments, the antigen is a stimulatory receptor present on the surface of a T cell or NK cell; examples of such stimulatory receptors include, but are not limited to, CD3, CD27, CD28, CD137 (also referred to as 4-1BB), GITR, HVEM, ICOS, NKG2D, and OX40. In some embodiments, the antigen is an inhibitory receptor present on the surface of a T-cell; examples of such inhibitory receptors include, but are not limited to, BTLA, CTLA-4, LAG3, PD-1, TIGIT, TIM3, and NK-expressed KIRs. The antibody domain conferring specificity to the T-cell surface antigen may also be substituted by a ligand or ligand domain that binds to a T-cell receptor, a NK-cell receptor, a macrophage receptor, and/or other immune effector cell receptor, such as, but not limited to, B7-1, B7-2, B7H3, PDL1, PDL2, or TNFSF9.
[0449] In some embodiments, the T-cell engaging multispecific activatable antibody includes an anti-CD3 epsilon (CD3c, also referred to herein as CD3e and CD3) scFv and a targeting antibody or antigen-binding fragment thereof, where at least one of the anti-CD3c scFv and/or the targeting antibody or antigen-binding portion thereof is masked. In some embodiments, the CD3c scFv includes a first antibody or antigen-binding fragment thereof (AB1) that binds CD3c, where the AB1 is attached to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind CD3c. In some embodiments, the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (AB2) that binds CD166, where the AB2 is attached to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind CD166. In some embodiments, the CD3c scFv includes a first antibody or antigen-binding fragment thereof (AB1) that binds CD3c, where the AB1 is attached to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind CD3 c, and the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (AB2) that binds CD166, where the AB2 is attached to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind CD166.
[0450] In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies include at least a first antibody or antigen-binding fragment thereof that binds a first target and/or first epitope and a second antibody or antigen-binding fragment thereof that binds a second target and/or a second epitope. In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind two or more different targets. In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind two or more different epitopes on the same target. In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind a combination of two or more different targets and two or more different epitopes on the same target.
[0451] In some embodiments, a multispecific activatable antibody comprising an IgG has the IgG variable domains masked. In some embodiments, a multispecific activatable antibody comprising a scFv has the scFv domains masked. In some embodiments, a multispecific activatable antibody has both IgG variable domains and scFv domains, where at least one of the IgG variable domains is coupled to a masking moiety. In some embodiments, a multispecific activatable antibody has both IgG variable domains and scFv domains, where at least one of the scFv domains is coupled to a masking moiety. In some embodiments, a multispecific activatable antibody has both IgG variable domains and scFv domains, where at least one of the IgG variable domains is coupled to a masking moiety and at least one of the scFv domains is coupled to a masking moiety. In some embodiments, a multispecific activatable antibody has both IgG variable domains and scFv domains, where each of the IgG variable domains and the scFv domains is coupled to its own masking moiety. In some embodiments, one antibody domain of a multispecific activatable antibody has specificity for a target antigen and another antibody domain has specificity for a T-cell surface antigen. In some embodiments, one antibody domain of a multispecific activatable antibody has specificity for a target antigen and another antibody domain has specificity for another target antigen. In some embodiments, one antibody domain of a multispecific activatable antibody has specificity for an epitope of a target antigen and another antibody domain has specificity for another epitope of the target antigen.
[0452] In a multispecific activatable antibody, a scFv can be fused to the carboxyl terminus of the heavy chain of an IgG activatable antibody, to the carboxyl terminus of the light chain of an IgG activatable antibody, or to the carboxyl termini of both the heavy and light chains of an IgG activatable antibody. In a multispecific activatable antibody, a scFv can be fused to the amino terminus of the heavy chain of an IgG activatable antibody, to the amino terminus of the light chain of an IgG activatable antibody, or to the amino termini of both the heavy and light chains of an IgG activatable antibody. In a multispecific activatable antibody, a scFv can be fused to any combination of one or more carboxyl termini and one or more amino termini of an IgG activatable antibody. In some embodiments, a masking moiety (MM) linked to a cleavable moiety (CM) is attached to and masks an antigen binding domain of the IgG. In some embodiments, a masking moiety (MM) linked to a cleavable moiety (CM) is attached to and masks an antigen binding domain of at least one scFv. In some embodiments, a masking moiety (MM) linked to a cleavable moiety (CM) is attached to and masks an antigen binding domain of an IgG and a masking moiety (MM) linked to a cleavable moiety (CM) is attached to and masks an antigen binding domain of at least one scFv.
[0453] The disclosure provides examples of multispecific activatable antibody structures which include, but are not limited to, the following: (VL-CL).sub.2:(VH-CH1-CH2-CH3-L4-VH*-L3-VL*-L2-CM-L1-MM).sub.2; (VL-CL).sub.2:(VH-CH1-CH2-CH3-L4-VL*-L3-VH*-L2-CM-L1-MM).sub.2; (MM-L1-CM-L2-VL-CL).sub.2:(VH-CH1-CH2-CH3-L4-VH*-L3-VL*).sub.2; (MM-L1-CM-L2-VL-CL).sub.2:(VH-CH1-CH2-CH3-L4-VL*-L3-VH*).sub.2; (VL-CL).sub.2:(MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL).sub.2:(MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (MM-L1-CM-L2-VL-CL).sub.2:(VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (MM-L1-CM-L2-VL-CL).sub.2:(VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM).sub.2: (VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM).sub.2: (VH-CH1-CH2-CH3).sub.2; (MM-L1-CM-L2-VL*-L3-VH*-L4-VL-CL).sub.2:(VH-CH1-CH2-CH3).sub.2; (MM-L1-CM-L2-VH*-L3-VL*-L4-VL-CL).sub.2:(VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM).sub.2: (MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM).sub.2: (MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM).sub.2: (MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM).sub.2: (MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*).sub.2: (MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*).sub.2: (MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VL*-L3-VH*).sub.2: (MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VL*-L3-VH*).sub.2: (MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM).sub.2: (VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM).sub.2: (VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM).sub.2: (VL*-L3-VH*-L4-VH-CH1-CH2-CH3).sub.2; or (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM).sub.2: (VH*-L3-VL*-L4-VH-CH1-CH2-CH3).sub.2, wherein: VL and VH represent the light and heavy variable domains of the first specificity, contained in the IgG; VL* and VH* represent the variable domains of the second specificity, contained in the scFv; L1 is a linker peptide connecting the masking moiety (MM) and the cleavable moiety (CM); L2 is a linker peptide connecting the cleavable moiety (CM), and the antibody; L3 is a linker peptide connecting the variable domains of the scFv; L4 is a linker peptide connecting the antibody of the first specificity to the antibody of the second specificity; CL is the light-chain constant domain; and CH1, CH2, CH3 are the heavy chain constant domains. The first and second specificities may be toward any antigen or epitope.
[0454] In some embodiments of a T-cell engaging multispecific activatable antibody, one antigen is CD166, and another antigen is typically a stimulatory (also referred to herein as activating) or inhibitory receptor present on the surface of a T-cell, natural killer (NK) cell, myeloid mononuclear cell, macrophage, and/or other immune effector cell, such as, but not limited to, B7-H4, BTLA, CD3, CD4, CD8, CD16a, CD25, CD27, CD28, CD32, CD56, CD137 (also referred to as TNFRSF9), CTLA-4, GITR, HVEM, ICOS, LAG3, NKG2D, OX40, PD-1, TIGIT, TIM3, or VISTA. The antibody domain conferring specificity to the T-cell surface antigen may also be substituted by a ligand or ligand domain that binds to a T-cell receptor, a NK-cell receptor, a macrophage receptor, and/or other immune effector cell receptor.
[0455] In some embodiments, the targeting antibody is an anti-CD166 antibody disclosed herein. In some embodiments, the targeting antibody can be in the form an activatable antibody. In some embodiments, the scFv(s) can be in the form of a Pro-scFv (see, e.g., WO 2009/025846, WO 2010/081173).
[0456] In some embodiments, the scFv is specific for binding CDR, and comprises or is derived from an antibody or fragment thereof that binds CDR, e.g., CH2527, FN18, H2C, OKT3, 2C11, UCHT1, or V9. In some embodiments, the scFv is specific for binding CTLA-4 (also referred to herein as CTLA and CTLA4).
[0457] In some embodiments, the anti-CTLA-4 scFv includes the amino acid sequence:
TABLE-US-00014 (SEQIDNO:117) GGGSGGGGSGSGGGSGGGGSGGGEIVLTQSPGTLSLSPGERATLSCRASQ SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTIS RLEPEDFAVYYCQQYGSSPLTFGGGTKVEIKRSGGSTITSYNVYYTKLSS SGTQVQLVQTGGGVVQPGRSLRLSCAASGSTFSSYAMSWVRQAPGKGLEW VSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA TNSLYWYFDLWGRGTLVTVSSAS
[0458] In some embodiments, the anti-CTLA-4 scFv includes the amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to the amino acid sequence of SEQ ID NO: 117.
[0459] In some embodiments, the anti-CDR scFv includes the amino acid sequence:
TABLE-US-00015 (SEQIDNO:118) GGGSGGGGSGSGGGSGGGGSGGGQVQLQQSGAELARPGASVKMSCKASGY TFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSS TAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSGGGGSGGG GSGGGGSQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSP KRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSN PFTFGSGTKLEINR
[0460] In some embodiments, the anti-CDR scFv includes the amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to the amino acid sequence of SEQ ID NO: 118.
[0461] In some embodiments, the scFv is specific for binding one or more T-cells, one or more NK-cells and/or one or more macrophages. In some embodiments, the scFv is specific for binding a target selected from the group consisting of B7-H4, BTLA, CD3, CD4, CD8, CD16a, CD25, CD27, CD28, CD32, CD56, CD137, CTLA-4, GITR, HVEM, ICOS, LAG3, NKG2D, OX40, PD-1, TIGIT, TIM3, or VISTA.
[0462] In some embodiments, the multispecific activatable antibody also includes an agent conjugated to the AB. In some embodiments, the agent is a therapeutic agent. In some embodiments, the agent is an antineoplastic agent. In some embodiments, the agent is a toxin or fragment thereof. In some embodiments, the agent is conjugated to the multispecific activatable antibody via a linker. In some embodiments, the agent is conjugated to the AB via a cleavable linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the agent is a microtubule inhibitor. In some embodiments, the agent is a nucleic acid damaging agent, such as a DNA alkylator or DNA intercalator, or other DNA damaging agent. In some embodiments, the linker is a cleavable linker. In some embodiments, the agent is an agent selected from the group listed in Table 5. In some embodiments, the agent is a dolastatin. In some embodiments, the agent is an auristatin or derivative thereof. In some embodiments, the agent is auristatin E or a derivative thereof. In some embodiments, the agent is monomethyl auristatin E (MMAE). In some embodiments, the agent is monomethyl auristatin D (MMAD). In some embodiments, the agent is a maytansinoid or maytansinoid derivative. In some embodiments, the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or derivative thereof. In some embodiments, the agent is a calicheamicin or derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine. In some embodiments, the agent is a pyrrolobenzodiazepine dimer.
[0463] In some embodiments, the multispecific activatable antibody also includes a detectable moiety. In some embodiments, the detectable moiety is a diagnostic agent.
[0464] In some embodiments, the multispecific activatable antibody naturally contains one or more disulfide bonds. In some embodiments, the multispecific activatable antibody can be engineered to include one or more disulfide bonds.
[0465] The disclosure also provides an isolated nucleic acid molecule encoding a multispecific activatable antibody described herein, as well as vectors that include these isolated nucleic acid sequences. The disclosure provides methods of producing a multispecific activatable antibody by culturing a cell under conditions that lead to expression of the activatable antibody, wherein the cell comprises such a nucleic acid molecule. In some embodiments, the cell comprises such a vector.
[0466] The disclosure also provides a method of manufacturing multispecific activatable antibodies of the disclosure by (a) culturing a cell comprising a nucleic acid construct that encodes the multispecific activatable antibody under conditions that lead to expression of the multispecific activatable, and (b) recovering the multispecific activatable antibody. Suitable AB, MM, and/or CM include any of the AB, MM, and/or CM disclosed herein.
[0467] The disclosure also provides multispecific activatable antibodies and/or multispecific activatable antibody compositions that include at least a first antibody or antigen-binding fragment thereof (AB1) that specifically binds a first target or first epitope and a second antibody or antigen-biding fragment thereof (AB2) that binds a second target or a second epitope, where at least AB1 is coupled or otherwise attached to a masking moiety (MM1), such that coupling of the MM1 reduces the ability of AB1 to bind its target. In some embodiments, the MM1 is coupled to AB1 via a first cleavable moiety (CM1) sequence that includes a substrate for a protease, for example, a protease that is co-localized with the target of AB1 at a treatment site or a diagnostic site in a subject. The multispecific activatable antibodies provided herein are stable in circulation, activated at intended sites of therapy and/or diagnosis but not in normal, i.e., healthy tissue, and, when activated, exhibit binding to the target of AB1 that is at least comparable to the corresponding, unmodified multispecific antibody. Suitable AB, MM, and/or CM include any of the AB, MM, and/or CM disclosed herein.
[0468] The disclosure also provides compositions and methods that include a multispecific activatable antibody that includes at least a first antibody or antibody fragment (AB1) that specifically binds a target and a second antibody or antibody fragment (AB2), where at least the first AB in the multispecific activatable antibody is coupled to a masking moiety (MM1) that decreases the ability of AB1 to bind its target. In some embodiments, each AB is coupled to a MM that decreases the ability of its corresponding AB to each target. For example, in bispecific activatable antibody embodiments, AB1 is coupled to a first masking moiety (MM1) that decreases the ability of AB1 to bind its target, and AB2 is coupled to a second masking moiety (MM2) that decreases the ability of AB2 to bind its target. In some embodiments, the multispecific activatable antibody comprises more than two AB regions; in such embodiments, AB1 is coupled to a first masking moiety (MM1) that decreases the ability of AB1 to bind its target, AB2 is coupled to a second masking moiety (MM2) that decreases the ability of AB2 to bind its target, AB3 is coupled to a third masking moiety (MM3) that decreases the ability of AB3 to bind its target, and so on for each AB in the multispecific activatable antibody. Suitable AB, MM, and/or CM include any of the AB, MM, and/or CM disclosed herein.
[0469] In some embodiments, the multispecific activatable antibody further includes at least one cleavable moiety (CM) that is a substrate for a protease, where the CM links a MM to an AB. For example, in some embodiments, the multispecific activatable antibody includes at least a first antibody or antibody fragment (AB1) that specifically binds a target and a second antibody or antibody fragment (AB2), where at least the first AB in the multispecific activatable antibody is coupled via a first cleavable moiety (CM1) to a masking moiety (MM1) that decreases the ability of AB1 to bind its target. In some bispecific activatable antibody embodiments, AB1 is coupled via CM1 to MM1, and AB2 is coupled via a second cleavable moiety (CM2) to a second masking moiety (MM2) that decreases the ability of AB2 to bind its target. In some embodiments, the multispecific activatable antibody comprises more than two AB regions; in some of these embodiments, AB1 is coupled via CM1 to MM1, AB2 is coupled via CM2 to MM2, and AB3 is coupled via a third cleavable moiety (CM3) to a third masking moiety (MM3) that decreases the ability of AB3 to bind its target, and so on for each AB in the multispecific activatable antibody. Suitable AB, MM, and/or CM include any of the AB, MM, and/or CM disclosed herein.
[0470] Activatable Antibodies Having Non-Binding Steric Moieties or Binding Partners for Non-Binding Steric Moieties
[0471] The disclosure also provides activatable antibodies that include non-binding steric moieties (NB) or binding partners (BP) for non-binding steric moieties, where the BP recruits or otherwise attracts the NB to the activatable antibody. The activatable antibodies provided herein include, for example, an activatable antibody that includes a non-binding steric moiety (NB), a cleavable linker (CL) and antibody or antibody fragment (AB) that binds a target; an activatable antibody that includes a binding partner for a non-binding steric moiety (BP), a CL and an AB; and an activatable antibody that includes a BP to which an NB has been recruited, a CL and an AB that binds the target. Activatable antibodies in which the NB is covalently linked to the CL and AB of the activatable antibody or is associated by interaction with a BP that is covalently linked to the CL and AB of the activatable antibody are referred to herein as NB-containing activatable antibodies. By activatable or switchable is meant that the activatable antibody exhibits a first level of binding to a target when the activatable antibody is in an inhibited, masked or uncleaved state (i.e., a first conformation), and a second level of binding to the target when the activatable antibody is in an uninhibited, unmasked and/or cleaved state (i.e., a second conformation, i.e., activated antibody), where the second level of target binding is greater than the first level of target binding. The activatable antibody compositions can exhibit increased bioavailability and more favorable biodistribution compared to conventional antibody therapeutics.
[0472] In some embodiments, activatable antibodies provide for reduced toxicity and/or adverse side effects that could otherwise result from binding of the at non-treatment sites and/or non-diagnostic sites if the AB were not masked or otherwise inhibited from binding to such a site.
[0473] Anti-CD166 activatable antibodies that include a non-binding steric moiety (NB) can be made using the methods set forth in PCT Publication No. WO 2013/192546, the contents of which are hereby incorporated by reference in their entirety.
[0474] Use of Antibodies, Conjugated Antibodies, Activatable Antibodies, and Conjugated Activatable Antibodies
[0475] It will be appreciated that administration of therapeutic entities in accordance with the disclosure will be administered with suitable carriers, excipients, and other agents that are incorporated into formulations to provide improved transfer, delivery, tolerance, and the like. A multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences (15th ed, Mack Publishing Company, Easton, Pa. (1975)), particularly Chapter 87 by Blaug, Seymour, therein. These formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as Lipofectin), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. Any of the foregoing mixtures may be appropriate in treatments and therapies in accordance with the present disclosure, provided that the active ingredient in the formulation is not inactivated by the formulation and the formulation is physiologically compatible and tolerable with the route of administration. See also Baldrick P. Pharmaceutical excipient development: the need for preclinical guidance. Regul. Toxicol Pharmacol. 32(2):210-8 (2000), Wang W. Lyophilization and development of solid protein pharmaceuticals. Int. J. Pharm. 203(1-2):1-60 (2000), Charman W N Lipids, lipophilic drugs, and oral drug delivery-some emerging concepts. J Pharm Sci.89(8):967-78 (2000), Powell et al. Compendium of excipients for parenteral formulations PDA J Pharm Sci Technol. 52:238-311 (1998) and the citations therein for additional information related to formulations, excipients and carriers well known to pharmaceutical chemists.
[0476] Therapeutic formulations of the disclosure, which include an anti-CD166 antibody and/or activatable anti-CD166 antibody, such as by way of non-limiting example, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody, are used to prevent, treat or otherwise ameliorate a disease or disorder associated with aberrant target expression and/or activity. For example, therapeutic formulations of the disclosure, which include an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody, are used to treat or otherwise ameliorate a cancer or other neoplastic condition, inflammation, an inflammatory disorder, and/or an autoimmune disease. In some embodiments, the cancer is a solid tumor or a hematologic malignancy where the target is expressed. In some embodiments, the cancer is a solid tumor where the target is expressed. In some embodiments, the cancer is a hematologic malignancy where the target is expressed. In some embodiments, the target is expressed on parenchyma (e.g., in cancer, the portion of an organ or tissue that often carries out function(s) of the organ or tissue). In some embodiments, the target is expressed on a cell, tissue, or organ. In some embodiments, the target is expressed on stroma (i.e., the connective supportive framework of a cell, tissue, or organ). In some embodiments, the target is expressed on an osteoblast. In some embodiments, the target is expressed on the endothelium (vasculature). In some embodiments, the target is expressed on a cancer stem cell. In some embodiments, the agent to which the antibody and/or the activatable antibody is conjugated is a microtubule inhibitor. In some embodiments, the agent to which the antibody and/or the activatable antibody is conjugated is a nucleic acid damaging agent.
[0477] Efficaciousness of prevention, amelioration or treatment is determined in association with any known method for diagnosing or treating the disease or disorder associated with target expression and/or activity, such as, for example, aberrant target expression and/or activity. Prolonging the survival of a subject or otherwise delaying the progression of the disease or disorder associated with target expression and/or activity, e.g., aberrant target expression and/or activity, in a subject indicates that the antibody, conjugated antibody, activatable antibody and/or conjugated activatable antibody confers a clinical benefit.
[0478] An antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody can be administered in the form of pharmaceutical compositions. Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington: The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al., editors) Mack Pub. Co., Easton, Pa.: 1995; Drug Absorption Enhancement: Concepts, Possibilities, Limitations, And Trends, Harwood Academic Publishers, Langhorne, Pa., 1994; and Peptide And Protein Drug Delivery (Advances In Parenteral Sciences, Vol. 4), 1991, M. Dekker, New York.
[0479] In some embodiments where antibody fragments are used, the smallest fragment that specifically binds to the binding domain of the target protein is selected. For example, based upon the variable-region sequences of an antibody, peptide molecules can be designed that retain the ability to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. (See, e.g., Marasco et al., Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993)). The formulation can also contain more than one active compounds as necessary for the particular indication being treated, for example, in some embodiments, those with complementary activities that do not adversely affect each other. In some embodiments, or in addition, the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
[0480] The active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
[0481] The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
[0482] Sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-()-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
[0483] In some embodiments, the antibody, the conjugated antibody, activatable antibody and/or conjugated activatable antibody contains a detectable label. An intact antibody, or a fragment thereof (e.g., Fab, scFv, or F(ab).sub.2) is used. The term labeled, with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin. The term biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term biological sample, therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph. That is, the detection method of the disclosure can be used to detect an analyte mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of an analyte mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, immunochemical staining, and immunofluorescence. In vitro techniques for detection of an analyte genomic DNA include Southern hybridizations. Procedures for conducting immunoassays are described, for example in ELISA: Theory and Practice: Methods in Molecular Biology, Vol. 42, J. R. Crowther (Ed.) Human Press, Totowa, N.J., 1995; Immunoassay, E. Diamandis and T. Christopoulus, Academic Press, Inc., San Diego, Calif., 1996; and Practice and Theory of Enzyme Immunoassays, P. Tijssen, Elsevier Science Publishers, Amsterdam, 1985. Furthermore, in vivo techniques for detection of an analyte protein include introducing into a subject a labeled anti-analyte protein antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
[0484] The antibodies, conjugated antibodies, activatable antibodies and/or conjugated activatable antibodies of the disclosure are also useful in a variety of diagnostic and prophylactic formulations. In one embodiment, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody is administered to patients that are at risk of developing one or more of the aforementioned disorders. A patient's or organ's predisposition to one or more of the aforementioned disorders can be determined using genotypic, serological or biochemical markers.
[0485] In some embodiments of the disclosure, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody is administered to human individuals diagnosed with a clinical indication associated with one or more of the aforementioned disorders. Upon diagnosis, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody is administered to mitigate or reverse the effects of the clinical indication.
[0486] An antibody, a conjugated antibody, an activatable antibody, and/or a conjugated activatable antibody of the disclosure is also useful in the detection of a target in patient samples and accordingly are useful as diagnostics. For example, the antibodies and/or activatable antibodies, and conjugated versions thereof, of the disclosure are used in in vitro assays, e.g., ELISA, to detect target levels in a patient sample.
[0487] In one embodiment, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody of the disclosure is immobilized on a solid support (e.g., the well(s) of a microtiter plate). The immobilized antibody, conjugated antibody, activatable antibody and/or conjugated activatable antibody serves as a capture antibody for any target that may be present in a test sample. Prior to contacting the immobilized antibody and/or activatable antibody, and/or conjugated versions thereof, with a patient sample, the solid support is rinsed and treated with a blocking agent such as milk protein or albumin to prevent nonspecific adsorption of the analyte.
[0488] Subsequently the wells are treated with a test sample suspected of containing the antigen, or with a solution containing a standard amount of the antigen. Such a sample is, e.g., a serum sample from a subject suspected of having levels of circulating antigen considered to be diagnostic of a pathology. After rinsing away the test sample or standard, the solid support is treated with a second antibody that is detectably labeled. The labeled second antibody serves as a detecting antibody. The level of detectable label is measured, and the concentration of target antigen in the test sample is determined by comparison with a standard curve developed from the standard samples.
[0489] It will be appreciated that based on the results obtained using the antibodies and activatable antibodies of the disclosure, and conjugated versions thereof, in an in vitro diagnostic assay, it is possible to stage a disease in a subject based on expression levels of the target antigen. For a given disease, samples of blood are taken from subjects diagnosed as being at various stages in the progression of the disease, and/or at various points in the therapeutic treatment of the disease. Using a population of samples that provides statistically significant results for each stage of progression or therapy, a range of concentrations of the antigen that may be considered characteristic of each stage is designated.
[0490] An antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody can also be used in diagnostic and/or imaging methods. In some embodiments, such methods are in vitro methods. In some embodiments, such methods are in vivo methods. In some embodiments, such methods are in situ methods. In some embodiments, such methods are ex vivo methods. For example, activatable antibodies having an enzymatically cleavable CM can be used to detect the presence or absence of an enzyme that is capable of cleaving the CM. Such activatable antibodies can be used in diagnostics, which can include in vivo detection (e.g., qualitative or quantitative) of enzyme activity (or, in some embodiments, an environment of increased reduction potential such as that which can provide for reduction of a disulfide bond) through measured accumulation of activated antibodies (i.e., antibodies resulting from cleavage of an activatable antibody) in a given cell or tissue of a given host organism. Such accumulation of activated antibodies indicates not only that the tissue expresses enzymatic activity (or an increased reduction potential depending on the nature of the CM) but also that the tissue expresses target to which the activated antibody binds.
[0491] For example, the CM can be selected to be substrate for at least one protease found at the site of a tumor, at the site of a viral or bacterial infection at a biologically confined site (e.g., such as in an abscess, in an organ, and the like), and the like. The AB can be one that binds a target antigen. Using methods as disclosed herein, or when appropriate, methods familiar to one skilled in the art, a detectable label (e.g., a fluorescent label or radioactive label or radiotracer) can be conjugated to an AB or other region of an antibody and/or activatable antibody. Suitable detectable labels are discussed in the context of the above screening methods and additional specific examples are provided below. Using an AB specific to a protein or peptide of the disease state, along with at least one protease whose activity is elevated in the disease tissue of interest, activatable antibodies will exhibit an increased rate of binding to disease tissue relative to tissues where the CM specific enzyme is not present at a detectable level or is present at a lower level than in disease tissue or is inactive (e.g., in zymogen form or in complex with an inhibitor). Since small proteins and peptides are rapidly cleared from the blood by the renal filtration system, and because the enzyme specific for the CM is not present at a detectable level (or is present at lower levels in non-disease tissues or is present in inactive conformation), accumulation of activated antibodies in the disease tissue is enhanced relative to non-disease tissues.
[0492] In another example, activatable antibodies can be used to detect the presence or absence of a cleaving agent in a sample. For example, where the activatable antibodies contain a CM susceptible to cleavage by an enzyme, the activatable antibodies can be used to detect (either qualitatively or quantitatively) the presence of an enzyme in the sample. In another example, where the activatable antibodies contain a CM susceptible to cleavage by reducing agent, the activatable antibodies can be used to detect (either qualitatively or quantitatively) the presence of reducing conditions in a sample. To facilitate analysis in these methods, the activatable antibodies can be detectably labeled, and can be bound to a support (e.g., a solid support, such as a slide or bead). The detectable label can be positioned on a portion of the activatable antibody that is not released following cleavage, for example, the detectable label can be a quenched fluorescent label or other label that is not detectable until cleavage has occurred. The assay can be conducted by, for example, contacting the immobilized, detectably labeled activatable antibodies with a sample suspected of containing an enzyme and/or reducing agent for a time sufficient for cleavage to occur, then washing to remove excess sample and contaminants. The presence or absence of the cleaving agent (e.g., enzyme or reducing agent) in the sample is then assessed by a change in detectable signal of the activatable antibodies prior to contacting with the sample e.g., the presence of and/or an increase in detectable signal due to cleavage of the activatable antibody by the cleaving agent in the sample.
[0493] Such detection methods can be adapted to also provide for detection of the presence or absence of a target that is capable of binding the AB of the activatable antibodies when cleaved. Thus, the assays can be adapted to assess the presence or absence of a cleaving agent and the presence or absence of a target of interest. The presence or absence of the cleaving agent can be detected by the presence of and/or an increase in detectable label of the activatable antibodies as described above, and the presence or absence of the target can be detected by detection of a target-AB complex e.g., by use of a detectably labeled anti-target antibody.
[0494] Activatable antibodies are also useful in in situ imaging for the validation of activatable antibody activation, e.g., by protease cleavage, and binding to a particular target. In situ imaging is a technique that enables localization of proteolytic activity and target in biological samples such as cell cultures or tissue sections. Using this technique, it is possible to confirm both binding to a given target and proteolytic activity based on the presence of a detectable label (e.g., a fluorescent label).
[0495] These techniques are useful with any frozen cells or tissue derived from a disease site (e.g. tumor tissue) or healthy tissues. These techniques are also useful with fresh cell or tissue samples.
[0496] In these techniques, an activatable antibody is labeled with a detectable label. The detectable label may be a fluorescent dye, (e.g. a fluorophore, Fluorescein Isothiocyanate (FITC), Rhodamine Isothiocyanate (TRITC), an Alexa Fluor label), a near infrared (NIR) dye (e.g., Qdot nanocrystals), a colloidal metal, a hapten, a radioactive marker, biotin and an amplification reagent such as streptavidin, or an enzyme (e.g. horseradish peroxidase or alkaline phosphatase).
[0497] Detection of the label in a sample that has been incubated with the labeled, activatable antibody indicates that the sample contains the target and contains a protease that is specific for the CM of the activatable antibody. In some embodiments, the presence of the protease can be confirmed using broad spectrum protease inhibitors such as those described herein, and/or by using an agent that is specific for the protease, for example, an antibody such as A11, which is specific for the protease matriptase and inhibits the proteolytic activity of matriptase; see e.g., International Publication Number WO 2010/129609, published 11 Nov. 2010. The same approach of using broad spectrum protease inhibitors such as those described herein, and/or by using a more selective inhibitory agent can be used to identify a protease that is specific for the CM of the activatable antibody. In some embodiments, the presence of the target can be confirmed using an agent that is specific for the target, e.g., another antibody, or the detectable label can be competed with unlabeled target. In some embodiments, unlabeled activatable antibody could be used, with detection by a labeled secondary antibody or more complex detection system.
[0498] Similar techniques are also useful for in vivo imaging where detection of the fluorescent signal in a subject, e.g., a mammal, including a human, indicates that the disease site contains the target and contains a protease that is specific for the CM of the activatable antibody.
[0499] These techniques are also useful in kits and/or as reagents for the detection, identification or characterization of protease activity in a variety of cells, tissues, and organisms based on the protease-specific CM in the activatable antibody.
[0500] The disclosure provides methods of using the antibodies and/or activatable antibodies in a variety of diagnostic and/or prophylactic indications. For example, the disclosure provides methods of detecting presence or absence of a cleaving agent and a target of interest in a subject or a sample by (i) contacting a subject or sample with an activatable antibody, wherein the activatable antibody comprises a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, e.g., a protease, and an antigen binding domain or fragment thereof (AB) that specifically binds the target of interest, wherein the activatable antibody in an uncleaved, non-activated state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB and is not a modified form of a natural binding partner of the AB; and (b) wherein, in an uncleaved, non-activated state, the MM interferes with specific binding of the AB to the target, and in a cleaved, activated state the MM does not interfere or compete with specific binding of the AB to the target; and (ii) measuring a level of activated activatable antibody in the subject or sample, wherein a detectable level of activated activatable antibody in the subject or sample indicates that the cleaving agent and the target are present in the subject or sample and wherein no detectable level of activated activatable antibody in the subject or sample indicates that the cleaving agent, the target or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or sample. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0501] The disclosure also provides methods of detecting presence or absence of a cleaving agent in a subject or a sample by (i) contacting a subject or sample with an activatable antibody in the presence of a target of interest, e.g., the target, wherein the activatable antibody comprises a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, e.g., a protease, and an antigen binding domain or fragment thereof (AB) that specifically binds the target of interest, wherein the activatable antibody in an uncleaved, non-activated state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB and is not a modified form of a natural binding partner of the AB; and (b) wherein, in an uncleaved, non-activated state, the MM interferes with specific binding of the AB to the target, and in a cleaved, activated state the MM does not interfere or compete with specific binding of the AB to the target; and (ii) measuring a level of activated activatable antibody in the subject or sample, wherein a detectable level of activated activatable antibody in the subject or sample indicates that the cleaving agent is present in the subject or sample and wherein no detectable level of activated activatable antibody in the subject or sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or sample. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0502] The disclosure also provides kits for use in methods of detecting presence or absence of a cleaving agent and the target in a subject or a sample, where the kits include at least an activatable antibody comprises a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, e.g., a protease, and an antigen binding domain or fragment thereof (AB) that specifically binds the target of interest, wherein the activatable antibody in an uncleaved, non-activated state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB and is not a modified form of a natural binding partner of the AB; and (b) wherein, in an uncleaved, non-activated state, the MM interferes with specific binding of the AB to the target, and in a cleaved, activated state the MM does not interfere or compete with specific binding of the AB to the target; and (ii) measuring a level of activated activatable antibody in the subject or sample, wherein a detectable level of activated activatable antibody in the subject or sample indicates that the cleaving agent is present in the subject or sample and wherein no detectable level of activated activatable antibody in the subject or sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or sample. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0503] The disclosure also provides methods of detecting presence or absence of a cleaving agent in a subject or a sample by (i) contacting a subject or sample with an activatable antibody, wherein the activatable antibody comprises a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, e.g., a protease, an antigen binding domain (AB) that specifically binds the target, and a detectable label, wherein the activatable antibody in an uncleaved, non-activated state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB and is not a modified form of a natural binding partner of the AB; wherein, in an uncleaved, non-activated state, the MM interferes with specific binding of the AB to the target, and in a cleaved, activated state the MM does not interfere or compete with specific binding of the AB to the target; and wherein the detectable label is positioned on a portion of the activatable antibody that is released following cleavage of the CM; and (ii) measuring a level of detectable label in the subject or sample, wherein a detectable level of the detectable label in the subject or sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or sample and wherein no detectable level of the detectable label in the subject or sample indicates that the cleaving agent is present in the subject or sample. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0504] The disclosure also provides kits for use in methods of detecting presence or absence of a cleaving agent and the target in a subject or a sample, where the kits include at least an activatable antibody and/or conjugated activatable antibody (e.g., an activatable antibody to which a therapeutic agent is conjugated) described herein for use in contacting a subject or biological sample and means for detecting the level of activated activatable antibody and/or conjugated activatable antibody in the subject or biological sample, wherein a detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent and the target are present in the subject or biological sample and wherein no detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent, the target or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or biological sample, such that the target binding and/or protease cleavage of the activatable antibody cannot be detected in the subject or biological sample.
[0505] The disclosure also provides methods of detecting presence or absence of a cleaving agent in a subject or a sample by (i) contacting a subject or biological sample with an activatable antibody in the presence of the target, and (ii) measuring a level of activated activatable antibody in the subject or biological sample, wherein a detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent is present in the subject or biological sample and wherein no detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or biological sample at a detectable level, such that protease cleavage of the activatable antibody cannot be detected in the subject or biological sample. Such an activatable antibody includes a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, e.g., a protease, and an antigen binding domain or fragment thereof (AB) that specifically binds the target, wherein the activatable antibody in an uncleaved (i.e., non-activated) state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB; and (b) wherein the MM of the activatable antibody in an uncleaved state interferes with specific binding of the AB to the target, and wherein the MM of an activatable antibody in a cleaved (i.e., activated) state does not interfere or compete with specific binding of the AB to the target. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the detectable label is attached to the masking moiety. In some embodiments, the detectable label is attached to the cleavable moiety N-terminal to the protease cleavage site. In some embodiments, a single antigen binding site of the AB is masked. In some embodiments wherein an antibody of the disclosure has at least two antigen binding sites, at least one antigen binding site is masked and at least one antigen binding site is not masked. In some embodiments all antigen binding sites are masked. In some embodiments, the measuring step includes use of a secondary reagent comprising a detectable label.
[0506] The disclosure also provides kits for use in methods of detecting presence or absence of a cleaving agent and the target in a subject or a sample, where the kits include at least an activatable antibody and/or conjugated activatable antibody described herein for use in contacting a subject or biological sample with an activatable antibody in the presence of the target, and measuring a level of activated activatable antibody in the subject or biological sample, wherein a detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent is present in the subject or biological sample and wherein no detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or biological sample at a detectable level, such that protease cleavage of the activatable antibody cannot be detected in the subject or biological sample. Such an activatable antibody includes a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, e.g., a protease, and an antigen binding domain or fragment thereof (AB) that specifically binds the target, wherein the activatable antibody in an uncleaved (i.e., non-activated) state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB; and (b) wherein the MM of the activatable antibody in an uncleaved state interferes with specific binding of the AB to the target, and wherein the MM of an activatable antibody in a cleaved (i.e., activated) state does not interfere or compete with specific binding of the AB to the target. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the detectable label is attached to the masking moiety. In some embodiments, the detectable label is attached to the cleavable moiety N-terminal to the protease cleavage site. In some embodiments, a single antigen binding site of the AB is masked. In some embodiments wherein an antibody of the disclosure has at least two antigen binding sites, at least one antigen binding site is masked and at least one antigen binding site is not masked. In some embodiments all antigen binding sites are masked. In some embodiments, the measuring step includes use of a secondary reagent comprising a detectable label.
[0507] The disclosure also provides kits for use in methods of detecting presence or absence of a cleaving agent in a subject or a sample, where the kits include at least an activatable antibody and/or conjugated activatable antibody described herein for use in contacting a subject or biological sample and means for detecting the level of activated activatable antibody and/or conjugated activatable antibody in the subject or biological sample, wherein the activatable antibody includes a detectable label that is positioned on a portion of the activatable antibody that is released following cleavage of the CM, wherein a detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or biological sample such that the target binding and/or protease cleavage of the activatable antibody cannot be detected in the subject or biological sample, and wherein no detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent is present in the subject or biological sample at a detectable level.
[0508] The disclosure provides methods of detecting presence or absence of a cleaving agent and the target in a subject or a sample by (i) contacting a subject or biological sample with an activatable antibody, wherein the activatable antibody includes a detectable label that is positioned on a portion of the activatable antibody that is released following cleavage of the CM and (ii) measuring a level of activated activatable antibody in the subject or biological sample, wherein a detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent, the target or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or biological sample, such that the target binding and/or protease cleavage of the activatable antibody cannot be detected in the subject or biological sample, and wherein a reduced detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent and the target are present in the subject or biological sample. A reduced level of detectable label is, for example, a reduction of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% and/or about 100%. Such an activatable antibody includes a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, and an antigen binding domain or fragment thereof (AB) that specifically binds the target, wherein the activatable antibody in an uncleaved (i.e., non-activated) state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB; and (b) wherein the MM of the activatable antibody in an uncleaved state interferes with specific binding of the AB to the target, and wherein the MM of an activatable antibody in a cleaved (i.e., activated) state does not interfere or compete with specific binding of the AB to the target. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0509] The disclosure also provides kits for use in methods of detecting presence or absence of a cleaving agent and the target in a subject or a sample, where the kits include at least an activatable antibody and/or conjugated activatable antibody described herein for use in contacting a subject or biological sample and means for detecting the level of activated activatable antibody and/or conjugated activatable antibody in the subject or biological sample, wherein a detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent, the target or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or biological sample, such that the target binding and/or protease cleavage of the activatable antibody cannot be detected in the subject or biological sample, and wherein a reduced detectable level of activated activatable antibody in the subject or biological sample indicates that the cleaving agent and the target are present in the subject or biological sample. A reduced level of detectable label is, for example, a reduction of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% and/or about 100%.
[0510] The disclosure also provides methods of detecting presence or absence of a cleaving agent in a subject or a sample by (i) contacting a subject or biological sample with an activatable antibody, wherein the activatable antibody includes a detectable label that is positioned on a portion of the activatable antibody that is released following cleavage of the CM; and (ii) measuring a level of detectable label in the subject or biological sample, wherein a detectable level of the detectable label in the subject or biological sample indicates that the cleaving agent is absent and/or not sufficiently present in the subject or biological sample at a detectable level, such that protease cleavage of the activatable antibody cannot be detected in the subject or biological sample, and wherein a reduced detectable level of the detectable label in the subject or biological sample indicates that the cleaving agent is present in the subject or biological sample. A reduced level of detectable label is, for example, a reduction of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% and/or about 100%. Such an activatable antibody includes a masking moiety (MM), a cleavable moiety (CM) that is cleaved by the cleaving agent, and an antigen binding domain or fragment thereof (AB) that specifically binds the target, wherein the activatable antibody in an uncleaved (i.e., non-activated) state comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM-AB or AB-CM-MM; (a) wherein the MM is a peptide that inhibits binding of the AB to the target, and wherein the MM does not have an amino acid sequence of a naturally occurring binding partner of the AB; and (b) wherein the MM of the activatable antibody in an uncleaved state interferes with specific binding of the AB to the target, and wherein the MM of an activatable antibody in a cleaved (i.e., activated) state does not interfere or compete with specific binding of the AB to the target. In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0511] The disclosure also provides kits for use in methods of detecting presence or absence of a cleaving agent of interest in a subject or a sample, where the kits include at least an activatable antibody and/or conjugated activatable antibody described herein for use in contacting a subject or biological sample and means for detecting the level of activated activatable antibody and/or conjugated activatable antibody in the subject or biological sample, wherein the activatable antibody includes a detectable label that is positioned on a portion of the activatable antibody that is released following cleavage of the CM, wherein a detectable level of the detectable label in the subject or biological sample indicates that the cleaving agent, the target, or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or biological sample, such that the target binding and/or protease cleavage of the activatable antibody cannot be detected in the subject or biological sample, and wherein a reduced detectable level of the detectable label in the subject or biological sample indicates that the cleaving agent and the target are present in the subject or biological sample. A reduced level of detectable label is, for example, a reduction of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% and/or about 100%.
[0512] In some embodiments of these methods and kits, the activatable antibody includes a detectable label. In some embodiments of these methods and kits, the detectable label includes an imaging agent, a contrasting agent, an enzyme, a fluorescent label, a chromophore, a dye, one or more metal ions, or a ligand-based label. In some embodiments of these methods and kits, the imaging agent comprises a radioisotope. In some embodiments of these methods and kits, the radioisotope is indium or technetium. In some embodiments of these methods and kits, the contrasting agent comprises iodine, gadolinium or iron oxide. In some embodiments of these methods and kits, the enzyme comprises horseradish peroxidase, alkaline phosphatase, or -galactosidase. In some embodiments of these methods and kits, the fluorescent label comprises yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), green fluorescent protein (GFP), modified red fluorescent protein (mRFP), red fluorescent protein tdimer2 (RFP tdimer2), HCRED, or a europium derivative. In some embodiments of these methods and kits, the luminescent label comprises an N-methylacrydium derivative. In some embodiments of these methods, the label comprises an Alexa Fluor label, such as Alex Fluor 680 or Alexa Fluor 750. In some embodiments of these methods and kits, the ligand-based label comprises biotin, avidin, streptavidin or one or more haptens.
[0513] In some embodiments of these methods and kits, the subject is a mammal. In some embodiments of these methods and kits, the subject is a human. In some embodiments, the subject is a non-human mammal, such as a non-human primate, companion animal (e.g., cat, dog, horse), farm animal, work animal, or zoo animal. In some embodiments, the subject is a rodent.
[0514] In some embodiments of these methods, the method is an in vivo method. In some embodiments of these methods, the method is an in situ method. In some embodiments of these methods, the method is an ex vivo method. In some embodiments of these methods, the method is an in vitro method.
[0515] In some embodiments, in situ imaging and/or in vivo imaging are useful in methods to identify which patients to treat. For example, in in situ imaging, the activatable antibodies are used to screen patient samples to identify those patients having the appropriate protease(s) and target(s) at the appropriate location, e.g., at a tumor site.
[0516] In some embodiments in situ imaging is used to identify or otherwise refine a patient population suitable for treatment with an activatable antibody of the disclosure. For example, patients that test positive for both the target (e.g., the target) and a protease that cleaves the substrate in the cleavable moiety (CM) of the activatable antibody being tested (e.g., accumulate activated antibodies at the disease site) are identified as suitable candidates for treatment with such an activatable antibody comprising such a CM. Likewise, patients that test negative for either or both of the target (e.g., the target) and the protease that cleaves the substrate in the CM in the activatable antibody being tested using these methods might be identified as suitable candidates for another form of therapy. In some embodiments, such patients that test negative with respect to a first activatable antibody can be tested with other activatable antibodies comprising different CMs until a suitable activatable antibody for treatment is identified (e.g., an activatable antibody comprising a CM that is cleaved by the patient at the site of disease). In some embodiments, the patient is then administered a therapeutically effective amount of the activatable antibody for which the patient tested positive.
[0517] In some embodiments in vivo imaging is used to identify or otherwise refine a patient population suitable for treatment with an activatable antibody of the disclosure. For example, patients that test positive for both the target (e.g., the target) and a protease that cleaves the substrate in the cleavable moiety (CM) of the activatable antibody being tested (e.g., accumulate activated antibodies at the disease site) are identified as suitable candidates for treatment with such an activatable antibody comprising such a CM. Likewise, patients that test negative might be identified as suitable candidates for another form of therapy. In some embodiments, such patients that test negative with respect to a first activatable antibody can be tested with other activatable antibodies comprising different CMs until a suitable activatable antibody for treatment is identified (e.g., an activatable antibody comprising a CM that is cleaved by the patient at the site of disease). In some embodiments, the patient is then administered a therapeutically effective amount of the activatable antibody for which the patient tested positive.
[0518] In some embodiments of the methods and kits, the method or kit is used to identify or otherwise refine a patient population suitable for treatment with an activatable antibody of the disclosure. For example, patients that test positive for both the target (e.g., the target) and a protease that cleaves the substrate in the cleavable moiety (CM) of the activatable antibody being tested in these methods are identified as suitable candidates for treatment with such an activatable antibody comprising such a CM. Likewise, patients that test negative for both of the targets (e.g., the target) and the protease that cleaves the substrate in the CM in the activatable antibody being tested using these methods might be identified as suitable candidates for another form of therapy. In some embodiments, such patients can be tested with other activatable antibodies until a suitable activatable antibody for treatment is identified (e.g., an activatable antibody comprising a CM that is cleaved by the patient at the site of disease). In some embodiments, patients that test negative for either of the target (e.g., the target) are identified as suitable candidates for treatment with such an activatable antibody comprising such a CM. In some embodiments, patients that test negative for either of the target (e.g., the target) are identified as not being suitable candidates for treatment with such an activatable antibody comprising such a CM. In some embodiments, such patients can be tested with other activatable antibodies until a suitable activatable antibody for treatment is identified (e.g., an activatable antibody comprising a CM that is cleaved by the patient at the site of disease). In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is positioned on the AB. In some embodiments, measuring the level of activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activated antibody, wherein the reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody comprising a detectable label.
[0519] In some embodiments, a method or kit is used to identify or otherwise refine a patient population suitable for treatment with an anti-the target activatable antibody and/or conjugated activatable antibody (e.g., activatable antibody to which a therapeutic agent is conjugated) of the disclosure, followed by treatment by administering that activatable antibody and/or conjugated activatable antibody to a subject in need thereof. For example, patients that test positive for both the targets (e.g., the target) and a protease that cleaves the substrate in the cleavable moiety (CM) of the activatable antibody and/or conjugated activatable antibody being tested in these methods are identified as suitable candidates for treatment with such antibody and/or such a conjugated activatable antibody comprising such a CM, and the patient is then administered a therapeutically effective amount of the activatable antibody and/or conjugated activatable antibody that was tested. Likewise, patients that test negative for either or both of the target (e.g., the target) and the protease that cleaves the substrate in the CM in the activatable antibody being tested using these methods might be identified as suitable candidates for another form of therapy. In some embodiments, such patients can be tested with other antibody and/or conjugated activatable antibody until a suitable antibody and/or conjugated activatable antibody for treatment is identified (e.g., an activatable antibody and/or conjugated activatable antibody comprising a CM that is cleaved by the patient at the site of disease). In some embodiments, the patient is then administered a therapeutically effective amount of the activatable antibody and/or conjugated activatable antibody for which the patient tested positive.
[0520] In some embodiments of these methods and kits, the MM is a peptide having a length from about 4 to 40 amino acids. In some embodiments of these methods and kits, the activatable antibody comprises a linker peptide, wherein the linker peptide is positioned between the MM and the CM. In some embodiments of these methods and kits, the activatable antibody comprises a linker peptide, where the linker peptide is positioned between the AB and the CM. In some embodiments of these methods and kits, the activatable antibody comprises a first linker peptide (L1) and a second linker peptide (L2), wherein the first linker peptide is positioned between the MM and the CM and the second linker peptide is positioned between the AB and the CM. In some embodiments of these methods and kits, each of L1 and L2 is a peptide of about 1 to 20 amino acids in length, and wherein each of L1 and L2 need not be the same linker. In some embodiments of these methods and kits, one or both of L1 and L2 comprises a glycine-serine polymer. In some embodiments of these methods and kits, at least one of L1 and L2 comprises an amino acid sequence selected from the group consisting of (GS).sub.n, (GSGGS).sub.n (SEQ ID NO: 1) and (GGGS).sub.n (SEQ ID NO: 2), where n is an integer of at least one. In some embodiments of these methods and kits, at least one of L1 and L2 comprises an amino acid sequence having the formula (GGS).sub.n, where n is an integer of at least one. In some embodiments of these methods and kits, at least one of L1 and L2 comprises an amino acid sequence selected from the group consisting of Gly-Gly-Ser-Gly (SEQ ID NO: 3), Gly-Gly-Ser-Gly-Gly (SEQ ID NO: 4), Gly-Ser-Gly-Ser-Gly (SEQ ID NO: 5), Gly-Ser-Gly-Gly-Gly (SEQ ID NO: 6), Gly-Gly-Gly-Ser-Gly (SEQ ID NO: 7), and Gly-Ser-Ser-Ser-Gly (SEQ ID NO: 8).
[0521] In some embodiments of these methods and kits, the AB comprises an antibody or antibody fragment sequence selected from the cross-reactive antibody sequences presented herein. In some embodiments of these methods and kits, the AB comprises a Fab fragment, a scFv or a single chain antibody (scAb).
[0522] In some embodiments of these methods and kits, the cleaving agent is a protease that is co-localized in the subject or sample with the target and the CM is a polypeptide that functions as a substrate for the protease, wherein the protease cleaves the CM in the activatable antibody when the activatable antibody is exposed to the protease. In some embodiments of these methods and kits, the CM is a polypeptide of up to 15 amino acids in length. In some embodiments of these methods and kits, the CM is coupled to the N-terminus of the AB. In some embodiments of these methods and kits, the CM is coupled to the C-terminus of the AB. In some embodiments of these methods and kits, the CM is coupled to the N-terminus of a VL chain of the AB.
[0523] The antibodies, conjugated antibodies, activatable antibodies and/or conjugated activatable antibodies of the disclosure are used in diagnostic and prophylactic formulations. In one embodiment, an activatable antibody is administered to patients that are at risk of developing one or more of the aforementioned inflammation, inflammatory disorders, cancer or other disorders.
[0524] A patient's or organ's predisposition to one or more of the aforementioned disorders can be determined using genotypic, serological or biochemical markers.
[0525] In some embodiments of the disclosure, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody is administered to human individuals diagnosed with a clinical indication associated with one or more of the aforementioned disorders. Upon diagnosis, an antibody, a conjugated antibody, an activatable antibody and/or a conjugated activatable antibody is administered to mitigate or reverse the effects of the clinical indication.
[0526] Antibodies, conjugated antibodies, activatable antibodies and/or conjugated activatable antibodies of the disclosure are also useful in the detection of the target in patient samples and accordingly are useful as diagnostics. For example, the antibodies, conjugated antibodies, the activatable antibodies and/or conjugated activatable antibodies of the disclosure are used in in vitro assays, e.g., ELISA, to detect target levels in a patient sample.
[0527] In one embodiment, an antibody and/or activatable antibody of the disclosure is immobilized on a solid support (e.g., the well(s) of a microtiter plate). The immobilized antibody and/or activatable antibody serves as a capture antibody for any target that may be present in a test sample. Prior to contacting the immobilized antibody and/or activatable antibody with a patient sample, the solid support is rinsed and treated with a blocking agent such as milk protein or albumin to prevent nonspecific adsorption of the analyte.
[0528] Subsequently the wells are treated with a test sample suspected of containing the antigen, or with a solution containing a standard amount of the antigen. Such a sample is, e.g., a serum sample from a subject suspected of having levels of circulating antigen considered to be diagnostic of a pathology. After rinsing away the test sample or standard, the solid support is treated with a second antibody that is detectably labeled. The labeled second antibody serves as a detecting antibody. The level of detectable label is measured, and the concentration of target antigen in the test sample is determined by comparison with a standard curve developed from the standard samples.
[0529] It will be appreciated that based on the results obtained using the antibodies and/or activatable antibodies of the disclosure in an in vitro diagnostic assay, it is possible to stage a disease in a subject based on expression levels of the Target antigen. For a given disease, samples of blood are taken from subjects diagnosed as being at various stages in the progression of the disease, and/or at various points in the therapeutic treatment of the disease. Using a population of samples that provides statistically significant results for each stage of progression or therapy, a range of concentrations of the antigen that may be considered characteristic of each stage is designated.
[0530] Antibodies, conjugated antibodies, activatable antibodies and/or conjugated activatable antibodies can also be used in diagnostic and/or imaging methods. In some embodiments, such methods are in vitro methods. In some embodiments, such methods are in vivo methods. In some embodiments, such methods are in situ methods. In some embodiments, such methods are ex vivo methods. For example, activatable antibodies having an enzymatically cleavable CM can be used to detect the presence or absence of an enzyme that is capable of cleaving the CM. Such activatable antibodies can be used in diagnostics, which can include in vivo detection (e.g., qualitative or quantitative) of enzyme activity (or, in some embodiments, an environment of increased reduction potential such as that which can provide for reduction of a disulfide bond) through measured accumulation of activated antibodies (i.e., antibodies resulting from cleavage of an activatable antibody) in a given cell or tissue of a given host organism. Such accumulation of activated antibodies indicates not only that the tissue expresses enzymatic activity (or an increased reduction potential depending on the nature of the CM) but also that the tissue expresses target to which the activated antibody binds.
[0531] For example, the CM can be selected to be a protease substrate for a protease found at the site of a tumor, at the site of a viral or bacterial infection at a biologically confined site (e.g., such as in an abscess, in an organ, and the like), and the like. The AB can be one that binds a target antigen. Using methods familiar to one skilled in the art, a detectable label (e.g., a fluorescent label or radioactive label or radiotracer) can be conjugated to an AB or other region of an activatable antibody. Suitable detectable labels are discussed in the context of the above screening methods and additional specific examples are provided below. Using an AB specific to a protein or peptide of the disease state, along with a protease whose activity is elevated in the disease tissue of interest, activatable antibodies will exhibit an increased rate of binding to disease tissue relative to tissues where the CM specific enzyme is not present at a detectable level or is present at a lower level than in disease tissue or is inactive (e.g., in zymogen form or in complex with an inhibitor). Since small proteins and peptides are rapidly cleared from the blood by the renal filtration system, and because the enzyme specific for the CM is not present at a detectable level (or is present at lower levels in non-disease tissues or is present in inactive conformation), accumulation of activated antibodies in the disease tissue is enhanced relative to non-disease tissues.
[0532] In another example, activatable antibodies can be used to detect the presence or absence of a cleaving agent in a sample. For example, where the activatable antibodies contain a CM susceptible to cleavage by an enzyme, the activatable antibodies can be used to detect (either qualitatively or quantitatively) the presence of an enzyme in the sample. In another example, where the activatable antibodies contain a CM susceptible to cleavage by reducing agent, the activatable antibodies can be used to detect (either qualitatively or quantitatively) the presence of reducing conditions in a sample. To facilitate analysis in these methods, the activatable antibodies can be detectably labeled, and can be bound to a support (e.g., a solid support, such as a slide or bead). The detectable label can be positioned on a portion of the activatable antibody that is not released following cleavage, for example, the detectable label can be a quenched fluorescent label or other label that is not detectable until cleavage has occurred. The assay can be conducted by, for example, contacting the immobilized, detectably labeled activatable antibodies with a sample suspected of containing an enzyme and/or reducing agent for a time sufficient for cleavage to occur, then washing to remove excess sample and contaminants. The presence or absence of the cleaving agent (e.g., enzyme or reducing agent) in the sample is then assessed by a change in detectable signal of the activatable antibodies prior to contacting with the sample e.g., the presence of and/or an increase in detectable signal due to cleavage of the activatable antibody by the cleaving agent in the sample.
[0533] Such detection methods can be adapted to also provide for detection of the presence or absence of a target that is capable of binding the AB of the activatable antibodies when cleaved. Thus, the assays can be adapted to assess the presence or absence of a cleaving agent and the presence or absence of a target of interest. The presence or absence of the cleaving agent can be detected by the presence of and/or an increase in detectable label of the activatable antibodies as described above, and the presence or absence of the target can be detected by detection of a target-AB complex e.g., by use of a detectably labeled anti-target antibody.
[0534] Activatable antibodies are also useful in in situ imaging for the validation of activatable antibody activation, e.g., by protease cleavage, and binding to a particular target. In situ imaging is a technique that enables localization of proteolytic activity and target in biological samples such as cell cultures or tissue sections. Using this technique, it is possible to confirm both binding to a given target and proteolytic activity based on the presence of a detectable label (e.g., a fluorescent label).
[0535] These techniques are useful with any frozen cells or tissue derived from a disease site (e.g. tumor tissue) or healthy tissues. These techniques are also useful with fresh cell or tissue samples.
[0536] In these techniques, an activatable antibody is labeled with a detectable label. The detectable label may be a fluorescent dye, (e.g. Fluorescein Isothiocyanate (FITC), Rhodamine Isothiocyanate (TRITC), a near infrared (NIR) dye (e.g., Qdot nanocrystals), a colloidal metal, a hapten, a radioactive marker, biotin and an amplification reagent such as streptavidin, or an enzyme (e.g. horseradish peroxidase or alkaline phosphatase).
[0537] Detection of the label in a sample that has been incubated with the labeled, activatable antibody indicates that the sample contains the target and contains a protease that is specific for the CM of the activatable antibody. In some embodiments, the presence of the protease can be confirmed using broad spectrum protease inhibitors such as those described herein, and/or by using an agent that is specific for the protease, for example, an antibody such as A11, which is specific for the protease matriptase and inhibits the proteolytic activity of matriptase; see e.g., International Publication Number WO 2010/129609, published 11 Nov. 2010. The same approach of using broad spectrum protease inhibitors such as those described herein, and/or by using a more selective inhibitory agent can be used to identify a protease or class of proteases specific for the CM of the activatable antibody. In some embodiments, the presence of the target can be confirmed using an agent that is specific for the target, e.g., another antibody, or the detectable label can be competed with unlabeled target. In some embodiments, unlabeled activatable antibody could be used, with detection by a labeled secondary antibody or more complex detection system.
[0538] Similar techniques are also useful for in vivo imaging where detection of the fluorescent signal in a subject, e.g., a mammal, including a human, indicates that the disease site contains the target and contains a protease that is specific for the CM of the activatable antibody.
[0539] These techniques are also useful in kits and/or as reagents for the detection, identification or characterization of protease activity in a variety of cells, tissues, and organisms based on the protease-specific CM in the activatable antibody.
[0540] In some embodiments, in situ imaging and/or in vivo imaging are useful in methods to identify which patients to treat. For example, in in situ imaging, the activatable antibodies are used to screen patient samples to identify those patients having the appropriate protease(s) and target(s) at the appropriate location, e.g., at a tumor site.
[0541] In some embodiments in situ imaging is used to identify or otherwise refine a patient population suitable for treatment with an activatable antibody of the disclosure. For example, patients that test positive for both the target and a protease that cleaves the substrate in the cleavable moiety (CM) of the activatable antibody being tested (e.g., accumulate activated antibodies at the disease site) are identified as suitable candidates for treatment with such an activatable antibody comprising such a CM. Likewise, patients that test negative for either or both of the target and the protease that cleaves the substrate in the CM in the activatable antibody being tested using these methods are identified as suitable candidates for another form of therapy (i.e., not suitable for treatment with the activatable antibody being tested). In some embodiments, such patients that test negative with respect to a first activatable antibody can be tested with other activatable antibodies comprising different CMs until a suitable activatable antibody for treatment is identified (e.g., an activatable antibody comprising a CM that is cleaved by the patient at the site of disease).
[0542] In some embodiments in vivo imaging is used to identify or otherwise refine a patient population suitable for treatment with an activatable antibody of the disclosure. For example, patients that test positive for both the target and a protease that cleaves the substrate in the cleavable moiety (CM) of the activatable antibody being tested (e.g., accumulate activated antibodies at the disease site) are identified as suitable candidates for treatment with such an activatable antibody comprising such a CM. Likewise, patients that test negative are identified as suitable candidates for another form of therapy (i.e., not suitable for treatment with the activatable antibody being tested). In some embodiments, such patients that test negative with respect to a first activatable antibody can be tested with other activatable antibodies comprising different CMs until a suitable activatable antibody for treatment is identified (e.g., an activatable antibody comprising a CM that is cleaved by the patient at the site of disease).
[0543] Pharmaceutical Compositions
[0544] The antibodies, conjugated antibodies, activatable antibodies and/or conjugated activatable antibodies of the disclosure (also referred to herein as active compounds), and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the antibody, the conjugated antibody, activatable antibody and/or conjugated activatable antibody and a pharmaceutically acceptable carrier. As used herein, the term pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Suitable examples of such carriers or diluents include, but are not limited to, water, saline, ringer's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
[0545] A pharmaceutical composition of the disclosure is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
[0546] Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In some embodiments, it will be desirable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin.
[0547] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0548] Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
[0549] For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
[0550] Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
[0551] The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
[0552] In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811.
[0553] It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the disclosure are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
[0554] The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
[0555] The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
EXAMPLES
Example 1. Characterization of Anti-CD166 Antibodies
[0556] The studies provided herein were designed to evaluate binding of anti-CD166 antibodies of the disclosure.
[0557] Binding of various anti-CD166 antibodies of the disclosure was confirmed by ELISA (
TABLE-US-00016 Antibody Name VH SEQ VL SEQ CD166-M9_vK1/HcB SEQ ID NO: 121 SEQ ID NO: 123 CD166-M9_vK2/HcB SEQ ID NO: 121 SEQ ID NO: 124 CD166-M9_vK3a/HcB SEQ ID NO: 121 SEQ ID NO: 125 CD166-M9_vK3b/HcB SEQ ID NO: 121 SEQ ID NO: 126 CD166-M9_vK1/HcC SEQ ID NO: 122 SEQ ID NO: 123 CD166-M9_vK2/HcC SEQ ID NO: 122 SEQ ID NO: 124 CD166-M9_vK3a/HcC SEQ ID NO: 122 SEQ ID NO: 125 CD166-M9_vK3b/HcC SEQ ID NO: 122 SEQ ID NO: 126
[0558] The M9 mAb was obtained using mouse hybridoma technology, and the remaining sequences were generated by humanizing the M9 mAb sequence. Those of ordinary skill in the art will appreciate that the ability to raise anti-CD166 antibodies was hampered for a long time, because researchers could not generate hybridomas and/or antibodies in mice that were administered human CD166. In contrast, the anti-CD166 antibodies presented herein were generated against human CD166 in mice.
[0559] The antibody CD166-M9 antibody comprising VH of SEQ ID NO: 119, VL of SEQ ID NO: 120 was used a positive control, and an isotype control antibody was used a negative control.
[0560] As shown in
Example 2. Mask Discovery
[0561] The studies provided herein were designed to identify and characterize masking moieties for use in activatable anti-CD166 antibodies of the disclosure.
[0562] The mouse anti-CD166 Mab M9 (VH of SEQ ID NO: 119, VL of SEQ ID NO: 120 was used to screen a cysteine constrained X15 peptide library with a total diversity of 310, where X is any amino acid, using a method similar to that described in PCT International Publication Number WO 2010/081173, published 15 Jul. 2010. The screening consisted of two rounds of MACS and four rounds of FACS sorting. The sort process is outlined in
[0563] Individual clones from the M2F1.1, M2F2.1, M2F3.1, and M2F4.1 populations were sequenced and the results are shown in Table 9.
TABLE-US-00017 TABLE9 MaskingPeptideSequences: M2F1.1 JF16490 YLCQRHPLALKYCTN(SEQIDNO:135) JF16492 PLCVPTQLLRSCYNY(SEQIDNO:136) JF16493 AVCHPLANVETQCLD(SEQIDNO:137) JF16494 PHCHPLFNNTYCYRH(SEQIDNO:138) JF16495 PLCRPIELLASCPMK(SEQIDNO:139) JF16496 GAACVSAWGFFCECC(SEQIDNO:140) JF16498 DCAKDILHLMPHCSM(SEQIDNO:141) JF16501 NTCMHPLLLQGCKTY(SEQIDNO:142) JF16503 YLGCLLYAGPGCEGG(SEQIDNO:143) JF16506 ARCPHPLLLSICENN(SEQIDNO:144) JF16507 ELCPHPLPFGFCNNY(SEQIDNO:145) JF16508 ALYCHPPYIRCEEMT(SEQIDNO:146) M2F2.1 JF16534 TSLCHPVMIMYCKTG(SEQIDNO:147) JF16535 PLCHPLEQASWCNMD(SEQIDNO:148) JF16536 PHPCPRTGSRMCHFS(SEQIDNO:149) JF16537 SGCRHPLPLKACGTN(SEQIDNO:150) JF16538 GLCHPIRLHNTQCTI(SEQIDNO:151) JF16539 KCMHPLNLHNINCNH(SEQIDNO:152) JF16540 PICHPLREFMNTCFK(SEQIDNO:153) JF16541 NCHPLDVVGWLGCMK(SEQIDNO:154) JF16542 YNNVCHPLFCSQHTY(SEQIDNO:155) JF16543 TFCHPLFSLNYCGHK(SEQIDNO:156) JF16544 FCHPLTLSNNKQCNR(SEQIDNO:157) JF16545 LSHCAVLLLRVCSGS(SEQIDNO:158) JF16546 KIHCHPLRLGTCLVG(SEQIDNO:159) JF16547 ETCAHPLDMRMCRHN(SEQIDNO:160) JF16548 PLCYPLILMSSCWLG(SEQIDNO:161) JF16549 YGICHPAPDLPCMQI(SEQIDNO:162) JF16550 TACHPLYNVEHLCEI(SEQIDNO:163) JF16551 TACNKSVCVAGCCLL(SEQIDNO:164) JF16552 LHPLCSYMKSCMKNN(SEQIDNO:165) JF16553 THCHCMVYFCPCRWS(SEQIDNO:166) M2F3.1 JF16554 PKCPHPLHLANCYAS(SEQIDNO:167) JF16555 KTCYHPTPVIAXNSY(SEQIDNO:168) JF16556 AKCLPPLIQYCRCIK(SEQIDNO:169) JF16557 HACQHPLQLHTCKHN(SEQIDNO:170) JF16558 LCHPLVLSAWESCSN(SEQIDNO:171) JF16559 WPLCSFGKSFCAQNA(SEQIDNO:172) JF16560 ECQSFEHFLTNNCHS(SEQIDNO:173) JF16561 SCKHPLVMPNLKCTR(SEQIDNO:174) JF16562 YPCHPLQLSIPHCTK(SEQIDNO:175) JF16563 ICHPLTHTMEYMCMN(SEQIDNO:176) JF16564 TLCHPLTFSVPTCTN(SEQIDNO:177) JF16565 PLCQPNRLLQACGNT(SEQIDNO:178) JF16566 TLCRHPLALDGCQNN(SEQIDNO:179) JF16567 QPMCYQPAHPLCNTI(SEQIDNO:180) JF16568 SNCHPLLFQHYHCML(SEQIDNO:181) JF16569 EKCYHPLTLAHCQNH(SEQIDNO:182) JF16571 NKCFVHPLAMPNCNS(SEQIDNO:183) JF16572 VNNCLLMTRAHCTSY(SEQIDNO:184) JF16573 LPCWAFAVNPLHCGD(SEQIDNO:185) M2F4.1 J57503 VNNCLLMTRAHCTSY(SEQIDNO:186) J57504 SSCPHPLGLTGCNDK(SEQIDNO:187) J57505 NKCFVHPLAMPNCNS(SEQIDNO:188) J57506 FVGCHSVYVSGCLRA(SEQIDNO:189) J57507 NMCHPPHNIYSICNM(SEQIDNO:190) J57509 LTCHLLPGLTLH-TK(SEQIDNO:191) J57510 RTCHPLPGLTLHCTK(SEQIDNO:192) J57511 HPLCFESMKNCFPNY(SEQIDNO:193) J57513 TTCHPLSFTHNYCIT(SEQIDNO:194) J57515 RDCGFDAVRADCLFG(SEQIDNO:195) J57516 RTCSTHPLTMPQCNY(SEQIDNO:196) J57517 MKCHPLQLTGNTCSM(SEQIDNO:197) JS7518 SGCPHPLQLITCSTA(SEQIDNO:198) JS7519 KCFPAFHDGPLACAS(SEQIDNO:199) J57520 LKCQHPLPMSHCQPQ(SEQIDNO:200) J57521 AFCGFSVIHPLCSGA(SEQIDNO:201) J57522 SVHCAVLKLDGCLGW(SEQIDNO:202) J57523 TLPCHPIMVLGCTPM(SEQIDNO:203) J57525 HYPCMKYNPLNCSMS(SEQIDNO:204) J57526 LKCPHPLSLNGCTLK(SEQIDNO:205) J57527 VYSCMANNPLDCFTQ(SEQIDNO:206) J57528 PICHPLVTLMSYCNK(SEQIDNO:207) J57529 DWCSFWAGQSVWCTS(SEQIDNO:208) J57530 STCHPLTPFHDKCRY(SEQIDNO:209) J57531 PVCPPLVTLMSYCNK(SEQIDNO:210) J57532 STCHPLPTLMPYCNS(SEQIDNO:211) J57533 FPLCGIGPAFCDTTV(SEQIDNO:212) J57534 PTCHPLVLSVPCPKI(SEQIDNO:213) J57537 GPLCDYFVFYSCRGS(SEQIDNO:214) J57538 HTCYHPLKLGQCEMF(SEQIDNO:215) J57539 RTCIHPLPLHQCHKP(SEQIDNO:216) J57540 ACHPINFNSIVYCNN(SEQIDNO:217) J57542 SHPCSVVNLPGCEPD(SEQIDNO:218)
[0564] Masks were truncated and alanine scanned to generate families of activatable antibodies with different masking efficiencies. The sequences are shown below in Table 10. The a indicates the position of the alanine incorporated as part of the scan. It is equivalent to A.
TABLE-US-00018 TABLE10 TruncationandAlanineScanningofMasking Peptides 7614 LCHPLVLSAWESCSS(SEQIDNO:219) 7614.4 LCaPLVLSAWESCSS(SEQIDNO:220) 7614.5 LCHaLVLSAWESCSS(SEQIDNO:221) 7614.6 LCHPaVLSAWESCSS(SEQIDNO:222) 7614.7 LCHPLaLSAWESCSS(SEQIDNO:223) 7614.8 LCHPLVaSAWESCSS(SEQIDNO:224) 7614.9 LCHPLVLSAaESCSS(SEQIDNO:225) 7614.10 LCHPLVLSAWaSCSS(SEQIDNO:226) 7614.11 CHPLVLSAWESC(SEQIDNO:227) 7614.12 HPLVL(SEQIDNO:228) 7614.13 HPL(SEQIDNO:229) 16522 LEGWCLHPLCLWGAG(SEQIDNO:230) 16522.14 LEGaCLHPLCLWGAG(SEQIDNO:231) 16522.15 LEGWCaHPLCLWGAG(SEQIDNO:232) 16522.16 LEGWCLaPLCLWGAG(SEQIDNO:233) 16522.17 LEGWCLHaLCLWGAG(SEQIDNO:234) 16522.18 LEGWCLHPaCLWGAG(SEQIDNO:235) 16522.19 LEGWCLHPLCaWGAG(SEQIDNO:236) 16522.20 LEGWCLHPLCLaGAG(SEQIDNO:237) 16522.21 CLHPLC(SEQIDNO:238)
[0565] These masking peptides were used to generate anti-CD166 activatable antibodies of the disclosure. The sequences for certain of these anti-CD166 activatable antibodies are shown below in Table 11. In some embodiments, these anti-CD166 activatable antibodies include cleavable moiety 2001 (ISSGLLSGRSDNH; SEQ ID NO: 70), cleavable moiety 3001 (AVGLLAPPGGLSGRSDNH; SEQ ID NO: 76), cleavable moiety 2007 (ISSGLLSGRSDIH; SEQ ID NO: 342), cleavable moiety 2008 (ISSGLLSGRSDQH; SEQ ID NO: 343), cleavable moiety 2011 (ISSGLLSGRSDNP; SEQ ID NO: 346), cleavable moiety 2012 (ISSGLLSGRSANP; SEQ ID NO: 347), cleavable moiety 2013 (ISSGLLSGRSANI; SEQ ID NO: 348), cleavable moiety 3007 (AVGLLAPPGGLSGRSDIH; SEQ ID NO: 350), cleavable moiety 3008 (AVGLLAPPGGLSGRSDQH; SEQ ID NO: 351), cleavable moiety 3011 (AVGLLAPPGGLSGRSDNP; SEQ ID NO: 354), cleavable moiety 3012 (AVGLLAPPGGLSGRSANP; SEQ ID NO: 355), or cleavable moiety 3013 (AVGLLAPPGGLSGRSANI; SEQ ID NO: 356), as indicated.
[0566] While certain sequences shown below include the spacer sequence of SEQ ID NO: 305, those of ordinary skill in the art appreciate that the activatable anti-CD166 antibodies of the disclosure can include any suitable spacer sequence, such as, for example, a spacer sequence selected from the group consisting of QGQSGQG (SEQ ID NO: 305), QGQSGQ (SEQ ID NO: 88), QGQSG (SEQ ID NO: 306), QGQS (SEQ ID NO: 307), QGQ (SEQ ID NO: 308), QG (SEQ ID NO: 309), GQSGQG (SEQ ID NO: 359), QSGQG (SEQ ID NO: 360), SGQG (SEQ ID NO: 361), GQG (SEQ ID NO: 362), G or Q. In some embodiments, the activatable anti-CD166 antibodies of the disclosure can have no spacer sequence joined to its N-terminus.
TABLE-US-00019 TABLE11 Anti-CD166ActivatableAntibodySequences Anti-CD166ActivatableAntibodyHeavyChain(HuCD166HcC): AminoAcidsequence QITLKESGPTLVKPTQTLTLTCTFSGFSLSTYGMGVGWIRQPPGKALEWLANIWWSEDKHYSPSLKSRLT ITKDTSKNQVVLTITNVDPVDTATYYCVQIDYGNDYAFTYWGQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLIVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK(SEQIDNO:239) Nucleotidesequence CAGATCACCCTGAAAGAGTCCGGCCCCACCCTGGTGAAACCCACCCAGACCCTGACCCTGACATGCACCT TCTCCGGCTTCAGCCTGTCCACCTACGGCATGGGCGTGGGCTGGATCAGGCAGCCTCCTGGCAAGGCCCT GGAATGGCTGGCCAACATCTGGTGGTCCGAGGACAAGCACTACTCCCCCAGCCTGAAGTCCCGGCTGACC ATCACCAAGGACACCTCCAAGAACCAGGTGGTGCTGACAATCACAAACGTGGACCCCGTGGACACCGCCA CCTACTACTGCGTGCAGATCGACTACGGCAACGACTACGCCTTCACCTACTGGGGCCAGGGCACACTGGT GACAGTGTCCTCCGCCTCCACCAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTCCAGCAAGTCCACCTCT GGCGGCACAGCTGCCCTGGGCTGCCTGGTGAAAGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACT CTGGCGCCCTGACCAGCGGAGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTC CTCCGTGGTGACCGTGCCCTCCAGCTCTCTGGGCACCCAGACCTACATCTGCAACGTGAACCACAAGCCC TCCAACACCAAGGTGGACAAGAAGGTGGAACCCAAGTCCTGCGACAAGACCCACACCTGTCCCCCCTGCC CTGCCCCTGAACTGCTGGGCGGACCTTCCGTGTTTCTGTTCCCCCCAAAGCCTAAGGACACCCTGATGAT CTCCCGGACCCCCGAAGTGACCTGCGTGGTGGTGGACGTGTCCCACGAGGACCCTGAAGTGAAGTTCAAT TGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTACAACTCCACCT ACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAGGT GTCCAACAAGGCCCTGCCTGCCCCCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCT CAGGTGTACACACTGCCCCCTAGCCGGGAAGAGATGACCAAGAATCAGGTGTCCCTGACCTGTCTGGTGA AAGGCTTCTACCCCTCCGATATCGCCGTGGAATGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGAC CACCCCCCCTGTGCTGGACTCCGACGGCTCATTCTTCCTGTACTCCAAGCTGACCGTGGACAAGTCCCGG TGGCAGCAGGGCAACGTGTTCTCCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGT CCCTGTCCCTGAGCCCCGGCAAG(SEQIDNO:241) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2001(SEQIDNO:310)]Amino Acidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDNHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC](SEQID NO:242) [spacer(SEQIDNO:480)][HuCD166Lc1_7614.6_2001(SEQIDNO:311)] NucleotideSequence [CAGGGCCAGTCTGGACAGGGC][CTGTGTCACCCTGCCGTGCTGTCTGCCTGGGAGTCCTGTTCCTCCG GCGGTGGCTCCTCTGGCGGCTCCATCTCCTCTGGCCTGCTGTCCGGCAGATCCGACAACCACGGCGGAGG CAGCGACATCGTGATGACCCAGTCCCCCCTGTCCCTGCCCGTGACACCTGGCGAGCCTGCCTCCATCAGC TGCCGGTCCTCCAAGTCCCTGCTGCACTCCAACGGCATCACCTACCTGTACTGGTATCTGCAGAAGCCCG GCCAGTCCCCTCAGCTGCTGATCTACCAGATGTCCAACCTGGCCTCCGGCGTGCCCGACAGATTCTCCGG CTCTGGCTCCGGCACCGACTTCACCCTGAAGATCTCCCGGGTGGAAGCCGAGGACGTGGGCGTGTACTAC TGCGCCCAGAACCTGGAACTGCCCTACACCTTCGGCCAGGGCACCAAGCTGGAAATCAAGCGGACCGTGG CCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTG CCTGCTGAACAACTTCTACCCTCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGTCCGGC AACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCC TGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGAGCAGCCC CGTGACCAAGTCCTTCAACCGCGGCGAGTGC](SEQIDNO:243) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2001(SEQIDNO:312)] AminoAcidSequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDNHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC](SEQID NO:244) [spacer(SEQIDNO:480)][HuCD166Lc1_7614.6_2001(SEQIDNO:313)] NucleotideSequence [CAGGGCCAGTCTGGACAGGGC][CTGTGTCACCCTCTGGTGGCCTCTGCCTGGGAGTCCTGTTCCTCCG GCGGIGGCTCCICTGGCGGCTCCATCTCCICTGGCCTGCTGICCGGCAGATCCGACAACCACGGCGGAGG CAGCGACATCGTGATGACCCAGTCCCCCCTGTCCCTGCCCGTGACACCTGGCGAGCCTGCCTCCATCAGC TGCCGGICCTCCAAGTCCCTGCTGCACTCCAACGGCATCACCTACCTGTACTGGTATCTGCAGAAGCCCG GCCAGTCCCCTCAGCTGCTGATCTACCAGATGTCCAACCTGGCCTCCGGCGTGCCCGACAGATTCTCCGG CICTGGCTCCGGCACCGACTICACCCTGAAGATCTCCCGCGTGGAAGCCGAGGACGTGGGCGTGTACTAC TGCGCCCAGAACCTGGAACTGCCCTACACCTTCGGCCAGGGCACCAAGCTGGAAATCAAGCGGACCGTGG CCGCTCCCTCCGTGITCATCTICCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGIG CCTGCTGAACAACTICTACCCCCGCGAGGCCAAGGIGCAGIGGAAGGIGGACAACGCCCTGCAGTCCGGC AACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGICCTCCACCCTGACCC TGICCAAGGCCGACTACGAGAAGCACAAGGIGTACGCCTGCGAAGTGACCCACCAGGGCCTGAGCAGCCC CGTGACCAAGTCCTTCAACCGCGGCGAGTGC](SEQIDNO:245) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3001(SEQIDNO:314)] AminoAcidSequence [[QGQSGQG][LCHPAVLSAMESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC(SEQ IDNO:246) [spacer(SEQIDNO:481)][HuCD166Lc1_7614.6_3001(SEQIDNO:315)] NucleotideSequence [CAGGGACAGTCTGGCCAGGGC][CTGTGTCACCCTGCTGTGCTGTCTGCCTGGGAGTCCTGTTCCAGCG GCGGAGGCTCCTCTGGCGGCTCTGCTGTGGGCCTGCTGGCTCCACCTGGCGGCCTGTCCGGCAGATCTGA CAACCACGGCGGCTCCGACATCGTGATGACCCAGTCCCCCCTGTCCCTGCCCGTGACTCCTGGCGAGCCT GCCTCCATCTCCTGCCGGTCCTCCAAGTCCCTGCTGCACTCCAACGGCATCACCTACCTGTACTGGTATC TGCAGAAGCCCGGCCAGTCCCCTCAGCTGCTGATCTACCAGATGTCCAACCTGGCCTCCGGCGTGCCCGA CAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGAAGATCTCCCGGGTGGAAGCCGAGGACGTG GGCGTGTACTACTGCGCCCAGAACCTGGAACTGCCCTACACCTTCGGCCAGGGCACCAAGCTGGAAATCA AGCGGACCGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGC CTCCGTGGTCTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCC CTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCT CCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAGGG ACTGAGCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC](SEQIDNO:247) [spacer(SEQIDNO:309)][HuCD166Lc1_7614.6_3001(SEQIDNO:316)] AminoAcidSequence [QG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTPGEPASI SCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVY YCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVONKVDNALQS GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC](SEQID NO:248) [spacer(SEQIDNO:483)][HuCD166Lc1_7614.6_3001(SEQIDNO:317)] NucleotideSequence [[CAGGGCC][TGTGTCACCCTCTGGTGGCCTCTGCCTGGGAGTCCTGTTCCTCCGGCGGAGGCTCCTCT GGCGGCTCTGCTGTGGGCCTGCTGGCTCCACCTGGCGGCCTGTCCGGCAGATCTGACAACCACGGCGGCT CCGACATCGTGATGACCCAGTCCCCCCTGTCCCTGCCCGTGACTCCTGGCGAGCCTGCCTCCATCTCCTG CCGGTCCTCCAAGTCCCTGCTGCACTCCAACGGCATCACCTACCTGTACTGGTATCTGCAGAAGCCCGGC CAGTCCCCTCAGCTGCTGATCTACCAGATGTCCAACCTGGCCTCCGGCGTGCCCGACAGATTCTCCGGCT CTGGCTCCGGCACCGACTTCACCCTGAAGATCTCCCGGGTGGAAGCCGAGGACGTGGGCGTGTACTACTG CGCCCAGAACCTGGAACTGCCCTACACCTTCGGCCAGGGCACCAAGCTGGAAATCAAGCGGACCGTGGCC GCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCC TGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGTCCGGCAA CTCCCAGGAATCCGTGACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTG TCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGAGCAGCCCCG TGACCAAGTCCTTCAACCGGGGCGAGTGC](SEQIDNO:478) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3001(SEQIDNO:316)] AminoAcidSequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTPG EPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAE DVGVYYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVONKVD NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:303) [spacer(SEQIDNO:482)][HuCD166Lc1_7614.6_CM2(SEQIDNO:479)] NucleotideSequence [CAGGGCCAGTCTGGCCAGGGC][CTGTGTCACCCTCTGGTGGCCTCTGCCTGGGAGTCCTGTTCCTCCG GCGGAGGCTCCTCTGGCGGCTCTGCTGTGGGCCTGCTGGCTCCACCTGGCGGCCTGTCCGGCAGATCTGA CAACCACGGCGGCTCCGACATCGTGATGACCCAGTCCCCCCTGTCCCTGCCCGTGACTCCTGGCGAGCCT GCCTCCATCTCCTGCCGGTCCTCCAAGTCCCTGCTGCACTCCAACGGCATCACCTACCTGTACTGGTATC TGCAGAAGCCCGGCCAGTCCCCTCAGCTGCTGATCTACCAGATGTCCAACCTGGCCTCCGGCGTGCCCGA CAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGAAGATCTCCCGGGTGGAAGCCGAGGACGTG GGCGTGTACTACTGCGCCCAGAACCTGGAACTGCCCTACACCTTCGGCCAGGGCACCAAGCTGGAAATCA AGCGGACCGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGC CTCCGTCGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCC CTGCAGTCCGGCAACTCCCAGGAATCCGTGACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCT CCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAGGG CCTGAGCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC(SEQIDNO:304) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2001VLdomain(SEQIDNO: 364)]AminoAcidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDNHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:363) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2001VLdomain(SEQIDNO: 366)]AminoAcidSequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDNHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:365) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3001VLdomain(SEQIDNO: 368)]AminoAcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:367) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3001VLdomain(SEQIDNO: 370)]AminoAcidSequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTPG EPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAE DVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:369) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2007(SEQIDNO:372)]Amino Acidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDIHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:371) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2007VLdomain(SEQIDNO: 374)]AminoAcidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDIHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:373) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3007(SEQIDNO:376)]Amino AcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDIHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:375) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3007VLdomain(SEQIDNO: 378)]AminoAcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDIHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:377) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2008(SEQIDNO:380)]Amino Acidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDQHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:379) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2008VLdomain(SEQIDNO: 382)]AminoAcidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDQHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:381) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3008(SEQIDNO:384)]Amino AcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDQHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:383) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3008VLdomain(SEQIDNO: 386)]AminoAcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDQHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:385) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011(SEQIDNO:388)]Amino Acidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDNPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:387) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011VLdomain(SEQIDNO: 390)]AminoAcidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSDNPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:389) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3011(SEQIDNO:392)]Amino AcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:391) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3011VLdomain(SEQIDNO: 394)]AminoAcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:393) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2012(SEQIDNO:396)]Amino Acidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSANPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:395) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2012VLdomain(SEQIDNO: 398)]AminoAcidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSANPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:397) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3012(SEQIDNO:400)]Amino AcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:399) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3012VLdomain(SEQIDNO: 402)]AminoAcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:401) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2013(SEQIDNO:404)]Amino Acidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSANIGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:403) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2013VLdomain(SEQIDNO: 406)]AminoAcidsequence [QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSISSGLLSGRSANIGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:405) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3013(SEQIDNO:408)]Amino AcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANIGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:407) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3013VLdomain(SEQIDNO: 410)]AminoAcidSequence [[QGQSGQG][LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANIGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:409) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2007(SEQIDNO:412)]Amino Acidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDIHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:411) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2007VLdomain(SEQIDNO: 414)]AminoAcidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDIHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK(SEQIDNO:413) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3007(SEQIDNO:416)]Amino AcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDIHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:415) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3007VLdomain(SEQIDNO: 418)]AminoAcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDIHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:417) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2008(SEQIDNO:420)]Amino Acidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDQHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:419) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2008VLdomain(SEQIDNO: 422)]AminoAcidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDQHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:421) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3008(SEQIDNO:424)]Amino AcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDQHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:423) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3008VLdomain(SEQIDNO: 426)]AminoAcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDQHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:425) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011(SEQIDNO:428)]Amino Acidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSDNPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:427) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011VLdomain(SEQIDNO: 430)]AminoAcidsequence [QGQSGQG][LCHPLVASATNESCSSGGGSSGGSISSGLLSGRSDNPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYTNYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK(SEQIDNO:429) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011(SEQIDNO:432)]Amino AcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:431) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3011VLdomain(SEQIDNO: 434)]AminoAcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:433) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2012(SEQIDNO:436)]Amino Acidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSANPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:435) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2012VLdomain(SEQIDNO: 438)]AminoAcidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSANPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:437) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3012(SEQIDNO:440)]Amino AcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:439) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3012VLdomain(SEQIDNO: 442)]AminoAcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:441) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2013(SEQIDNO:444)]Amino Acidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSANIGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:443) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2013VLdomain(SEQIDNO: 446)]AminoAcidsequence [QGQSGQG][LCHPLVASAWESCSSGGGSSGGSISSGLLSGRSANIGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK(SEQIDNO:445) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3013(SEQIDNO:448)]Amino AcidSequence [[QGQSGQG][LCHPLVASAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANIGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:447) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3013VLdomain(SEQIDNO: 450)]AminoAcidSequence [[QGQSGQG][LCHPLVASATNESCSSGGGSSGGSAVGLLAPPGGLSGRSANIGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYTNYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:449) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2001(SEQIDNO:452)]Amino Acidsequence [QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSISSGLLSGRSDNHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:451) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2001VLdomain(SEQIDNO: 454)]AminoAcidsequence [QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSISSGLLSGRSDNHGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:453) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3001(SEQIDNO:456)]Amino AcidSequence [[QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:455) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3001VLdomain(SEQIDNO: 458)]AminoAcidSequence [[QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:457) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011(SEQIDNO:460)]Amino Acidsequence [QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSISSGLLSGRSDNPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:459) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2011VLdomain(SEQIDNO: 462)]AminoAcidsequence [QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSISSGLLSGRSDNPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIK](SEQIDNO:461) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3011(SEQIDNO:464)]Amino AcidSequence [[QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:463) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3011VLdomain(SEQIDNO: 466)]AminoAcidSequence [[QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCAQNLELPYTFGQGTKLEIK](SEQIDNO:465) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2012(SEQIDNO:468)]Amino Acidsequence [QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSISSGLLSGRSANPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQID NO:467) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_2012VLdomain(SEQIDNO: 470)]AminoAcidsequence [QGQSGQG][LCHPLVLSATNESCSSGGGSSGGSISSGLLSGRSANPGGGSDIVMTQSPLSLPVTPGEPAS ISCRSSKSLLHSNGITYLYTNYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFILKISRVEAEDVGV YYCAQNLELPTITGQGTKLEIK](SEQIDNO:469) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3012(SEQIDNO:472)]Amino AcidSequence [[QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFILKISRVEA EDVGVYYCAQNLELPYTEGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSILTLSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC](SEQ IDNO:471) [spacer(SEQIDNO:305)][HuCD166Lc1_7614.6_3012VLdomain(SEQIDNO: 474)]AminoAcidSequence [[QGQSGQG][LCHPLVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSANPGGSDIVMTQSPLSLPVTP GEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFILKISRVEA EDVGVYYCAQNLELPTITGQGTKLEIK](SEQIDNO:473)
Example 3. Generation of Activatable Anti-CD166 Antibodies
[0567] The studies provided herein were designed to generate activatable anti-CD166 antibodies of the disclosure.
[0568] Anti-CD166 activatable antibodies were generated with different masking efficiencies (i.e., a measurement of the ability of the MM of the activatable antibody to block binding of the AB of the activatable antibody to its target). The peptides 16522 and 7614 were mutated by truncation and alanine scanning as described in Example 2, and these masking peptide variants were used to generate families of anti-CD166 activatable antibodies with a range of fold masking. The ability of the anti-CD166 antibody CD166 M9 vK1/HcB (VH of SEQ ID NO: 121, VL of SEQ ID NO: 123) and various anti-CD166 activatable antibodies to bind human CD166 was evaluated using a CD166 binding ELISA (
[0569] Using a standard ELISA protocol, human CD166 protein is absorbed to ELISA plates and subsequently incubated with the indicated concentration of antibody or activatable antibody. Bound antibody or activatable antibody was detected with an anti-human FAB-peroxidase secondary. A summary of the exemplary apparent in vitro dissociation constants (Kd) of the activatable antibodies of the present invention to CD166 polypeptide as determined by ELISA is shown below in Table 17, as well as the respective increase in Kd relative to the parent anti-CD166 M9 antibody (vk-1/HcB). Except for the parental anti-CD166 M9 antibody, the mask for each activatable antibody is as indicated as described herein, and the substrate sequence was 2001 (ISSGLLSGRSDNH (SEQ ID NO: 70)).
TABLE-US-00020 TABLE 17 Apparent ELISA Dissociation Constants of Activatable Anti-CD166 Antibodies Antibody Construct Apparent Kd (nM) Fold Increase in Kd CD166 M9 vk1/HcB 4.4 1 CD166-16522-2001 423.7 95 CD166-7614-2001 998.6 225 CD166-7614.5-2001 495.0 112 CD166-7614.6-2001 265.6 60 CD166-7614.7-2001 618.6 139 CD166-7614.8-2001 82.2 19 CD166-7614.9-2001 534.0 120 CD166-7614.10-2001 685.2 154 CD166-7614.11-2001 544.0 123 CD166-7614.12-2001 331.9 75 CD166-7614.13-2001 77.7 18 CD166-16522.14-2001 422.1 95 CD166-16522.15-2001 447.7 101 CD166-16522.16-2001 47.4 11 CD166-16522.17-2001 61.6 14 CD166-16522.18-2001 57.7 13 CD166-16522.19-2001 49.2 11 CD166-16522.20-2001 700.3 158 CD166-16522.21-2001 144.7 33
Example 4. Activation of Activatable Anti-CD166 Antibodies
[0570] The studies provided herein were designed to evaluate activation of activatable anti-CD166 antibodies.
[0571]
[0572] Using a standard ELISA protocol, human CD166 protein is absorbed to ELISA plates and subsequently incubated with the indicated concentration of antibody or activatable antibody. Bound antibody or activatable antibody was detected with an anti-human FAB-peroxidase secondary.
[0573] In an exemplary study, the binding affinity of anti-CD166 antibodies (anti-CD166 HcC/vk-1 of the present disclosure and anti-CD166 activatable antibodies (anti-CD166-7614.6-3001) of the present disclosure to human cells (HCC1806 human breast cancer cells) and human CD166 were determined. Under these conditions, apparent exemplary binding affinities (K.sub.d) by ELISA are 96.2 nM and 1.3 nM for the anti-CD166 activatable antibody and the anti-CD166 antibody of the present disclosure, respectively. In the exemplary HCC1806 cell binding assay as measured by flow cytometry, apparent binding affinities (Kd) are 372 nM and 3.2 nM for the anti-CD166 activatable antibody and the anti-CD166 antibody of the present disclosure, respectively. These exemplary results demonstrated that the anti-CD166 activatable antibody, in an uncleaved state, demonstrated a lower binding affinity to isolated CD166 polypeptide and CD166 on cells, as compared to the anti-CD166 antibody of the present disclosure.
[0574]
[0575] As shown in
[0576] The next studies were designed to evaluate the activation and binding of anti-CD166 activatable antibodies in tumor samples upon exposure to one or more proteases.
[0577] Xenograft tumor samples and healthy tissue samples were analyzed using immunohistochemistry (IHC) analysis and an in situ imaging assay that is described in PCT Publication No. WO 2014/107599, the contents of which are hereby incorporated by reference in their entirety. Briefly, this in situ assay uses an activatable anti-CD166 antibody of the disclosure, the corresponding parental antibody, and a modified version of the activatable anti-CD166 antibody in which the CM is replaced with a non-cleavable linker, referred to herein generally as anti-CD166 NSUB modified antibody. The parental antibody is used as a positive control, while the non-cleavable version of the activatable anti-CD166 antibody is used as a negative control. Xenograft frozen tissue sections are then placed on the glass slide, rinsed two times with PBS-T followed by PBS, followed by 30 min pretreatment of tissue with broad spectrum protease inhibitors cocktail or buffer only. A detectable label such as Alexa Fluor-680 is then conjugated to each of the activatable anti-CD166 antibody and the anti-CD166 NSUB modified antibody. The detectably labeled activatable anti-CD166 antibody and the anti-CD166 NSUB modified antibody are then applied on the tissue and incubated for one hour in the dark (to prevent bleaching of fluorescence). After incubation with 1 g/ml of the incubated tumor sections were rinsed three times with PBS-T followed by PBS and counterstained with nuclear marker DAPI for 1 minute. Fluorescence microscopy analysis is then used to detect positive staining. Positive staining of the activatable anti-CD166 antibody that is abolished by the pretreatment of the tissue sections with protease inhibitors indicates that the binding of the activatable anti-CD166 antibody to the tissue sample is a result of the proteolytic event. Positive staining of the activatable anti-CD166 antibody should also be abolished when the tissue is pretreated with an excess of unlabeled (cold) parental antibody. Furthermore, incubation of the tumor tissue should reveal positive staining for parental antibody that is not affected by pretreatment of tissue with protease inhibitors, but is abolished when the tissue is pretreated with unlabeled parental antibody. No signal should be detected for the anti-CD166 NSUB modified antibody detected on the tissue pretreated, on the tissue not pretreated with protease inhibitors, or on the tissue pretreated with unlabeled parental antibody.
[0578]
[0579]
[0580]
Example 5. Potency of Conjugated Anti-CD166 Antibodies
[0581] This example demonstrates that a conjugated anti-CD166 antibody of the disclosure (CD166 ADC) displays in vitro killing activity as compared to a control antibody conjugate (Control ADC).
[0582]
Example 6. Efficacy of Conjugated Activatable Anti-CD166 Antibodies in Tumor Models
[0583] This example demonstrates the efficacy of a conjugated activatable anti-CD166 antibody of the disclosure (CD166 AADC or CD166 Activatable Antibody Drug Conjugate) in various cancer models.
[0584]
[0585] As shown in
[0586]
[0587] H292 xenograft tumors were treated with isotype-DM4 control, huCD166-DM4 ADC, huCD166_7614.6_CM2-DM4 AADC, or huCD166_7614.6_CM1-DM4 ADDC, where CM1 and CM2 are the 2001 and 3001 substrates described herein, respectively. Tumors were grown to an average of 150 mm.sup.3, then the mice were randomized into groups of eight and dosed on days 1 and 8 with the indicated test articles. Mean tumor volumeSEM is plotted.
[0588] As shown in
[0589]
[0590] As shown in
Example 7. Tolerability Analysis of Activatable Anti-CD166 Antibodies
[0591] Anti-CD166 antibodies of the disclosure were characterized for their species specificity towards binding to human CD166 and other closely related proteins.
[0592] As shown in
[0593] Next, CD166 expression levels were analyzed in various normal human and cynomolgus monkey tissue types. As shown in Table 3 below, CD166 expression levels were nearly identical the human and cynomolgus monkey tissue samples analyzed:
TABLE-US-00021 TABLE 3 CD166 Expression Levels in Normal Human and Cynomolgus Tissue Samples Tissue Type Cynomolgus Human Breast ++ ++ Brain Colon ++ ++ Esophagus Heart Kidney + + Liver ++ ++ Lung ++ + Nerve Ovary ++ + Pancreas ++ ++ Prostate +++ +++ Skin N/A /+ Small Intestine ++ ++ Salivary Gland ++ ++ Spleen Stomach +++ +++ Striated/Skeletal Muscle Testis Uterus ++ ++
[0594] Significant CD166 expression was detected in both human and cynomolgus liver tissue samples.
[0595] In initial pharmacokinetic studies, the conjugated anti-CD166 activatable antibodies of the disclosure were found to avoid antigen sink (i.e., rapid clearance of antibodies due to the abundance of naturally expressed CD166 antigen throughout the body).
[0596]
[0597] The pharmacokinetics of the huCD166-7614.6-CM1 DM4 drug conjugate (where CM1 is the 2001 substrate) and the un-conjugated huCD166 antibody were evaluated in cynomolgus monkeys after a single 5 mg/kg or 3 mg/kg dose, respectively. Total serum levels of human IgG were measured using an anti-human IgG sandwich ELISA. Consistent with avoiding on-target sinks, the CD166 AADC showed significantly more exposure than the antibody. Monkeys treated with the huCD166-7614.6-CM1 DM4 drug conjugate had no observable toxicities. After 21 days, there were no clinical observations, no signs of on-target toxicity, and no sign of liver toxicity. As shown in
[0598]
[0599] Thus, unlike traditional ADC therapy, there is no evidence of liver damage in the cynomolgus monkeys following administration of a conjugated anti-CD166 activatable antibody of the disclosure.
Example 8. Protease-Dependent Activation of Anti-CD166 Activatable Antibodies
[0600] The exemplary studies provided herein were designed to evaluate the protease-dependent activation of activatable anti-CD166 activatable antibodies and conjugated activatable antibodies of the disclosure.
[0601]
[0602] The binding of the anti-CD166 antibody (VH of SEQ ID NO: 122, VL of SEQ ID NO: 123), various conjugated and unconjugated anti-CD166 activatable antibodies of the disclosure, and protease-activated conjugated anti-CD166 activatable antibodies of the disclosure were evaluated using flow cytometry-based binding assay. The conjugated and unconjugated anti-CD166 activatable antibodies tested included the variable heavy chain sequence of SEQ ID NO: 122, the variable light chain sequence of SEQ ID NO: 123, either a cleavable moiety (CM1, substrate 2001) comprising the amino acid sequence ISSGLLSGRSDNH (SEQ ID NO: 70) or a cleavable moiety (CM2, substrate 3001) comprising the amino acid sequence AVGLLAPPGGLSGRSDNH (SEQ ID NO: 76), and one of the masking moieties shown in Table 10. The full sequences are shown above in Table 11. The conjugated anti-CD166 antibodies and conjugated anti-CD166 activatable antibodies included the maytansinoid DM4 conjugated to the activatable antibody via an SPDB linker. In a typical assay, HCC1806 cells were incubated with the indicated concentrations of anti-CD166 antibody, activatable antibody, conjugated antibody, or activatable antibody in PBS+2% FBS for 1 hr on ice. After washing 2 with PBS+2% FBS, cells were incubated with a goat anti-human IgG secondary antibody, conjugated to AlexaFluor 647 (Jackson ImmunoResearch), for 30-45 min on ice. Cells were then washed 2 with PBS+2% FBS and fixed with 1% formaldehyde. Bound antibody was detected using a Guava EasyCyte cytometer and the median fluorescence intensity (MFI) of the cell population was measured.
[0603] As shown in
Example 9. Binding of Activatable Anti-CD166 and Antibody Drug Conjugates to Human Tissues
[0604] The exemplary studies in this Example show the binding properties of anti-CD166 antibody drug conjugates (ADCs) and activatable anti-CD166 antibody drug conjugates (AADCs) of the present disclosure to human tissues.
[0605] In this study, frozen tissue sections derived from normal human prostate, ovary, breast, pancreas, and right atrium (Cat. Nos. T1234201, T1234086, T1234183, T1234188, and T1234127, respectively; BioChain, Newark, Calif.) were prepared and blocked using standard protocols, and then incubated with 0.4 g/mL with an anti-CD166 ADC of the present disclosure (anti-CD166-spdb-DM4), an anti-CD166 AADC of the present disclosure (anti-CD166-7614.6-3001-spdb-DM4), an activated anti-CD166 AADC of the present disclosure (anti-CD166-7614.6-3001-spdb-DM4 incubated with purified uPA for 16 hours at 37 C.), or an isotype control ADC (chKTI-spdb-DM4, a chimeric human IgG1 anti-soybean trypsin inhibitor antibody, conjugated to spdb-DM4). After incubation with the test articles, sections were treated with 2.5 g/mL mouse anti-DM4 monoclonal antibody (Immunogen). Detection of the DM4 payload was achieved by incubation with an anti-mouse antibody conjugated to an HRP polymer (Envision+ System-HRP Labeled polymer anti-mouse, Dako, K4006) followed by addition of a 3,3-diaminobenzidine substrate (DAB Plus, Dako, K3467). Tissues were counterstained with hematoxylin and images were acquired on an Olympus VS120 Virtual Slide Scanner.
[0606] The exemplary results of this study showed that anti-CD166 AADC of the present disclosure (anti-CD166-7614.6-3001-spdb-DM4) displayed a lack of immunostaining on each of the five human tissue sections consistent with its masked state, and similar to that observed with the isotype control ADC. Activation of the anti-CD166 AADC of the present disclosure by uPA restored binding of the activated anti-CD166 AADC in two of the highest expressing tissues, prostate and breast. The staining intensity and distribution of the uPA-activated anti-CD166 AADC of the present disclosure were similar to that of the parental anti-CD166 antibody drug conjugate (anti-CD166-spdb-DM4).
Example 10. Binding of Anti-CD166 Antibodies to Human Cancers
[0607] This Example shows that CD166 is expressed in a variety of patient-derived tumors by immunohistochemical (IHC) staining using an anti-CD166 antibody.
[0608] In this study, formalin-fixed paraffin-embedded tumor samples (FFPE) in tissue microarrays (US Biomax) were prepared and blocked using standard protocols, and then incubated with 5 g/mL anti-CD166 rabbit monoclonal antibody EPR2759[2] (Abcam, ab109215). Detection of anti-CD166 antibody was performed by incubation with 5 g/mL biotinylated-conjugated donkey anti-rabbit IgG antibody (Jackson Immunoresearch, 711-065-152), followed by addition of the ABC-HRP Elite Standard (Vector Laboratories, PK-6100) to form the avidin-biotin-HRP complex, followed by addition of a 3,3-diaminobenzidine substrate (DAB Plus, Dako, K3467). Tissues were counterstained with hematoxylin and images were acquired on an Olympus VS120 virtual slide scanner.
[0609] Each tissue core was assigned a IHC score of negative (no staining), weak (intensity 1+ in 70% tumor cells or 2+ in 30% tumor cells), moderate (intensity 1+ in >70% of tumor cells or 2+ in >30% to 70% tumor cells or 3+ in 30% tumor cells), or strong (intensity 2+ in >70% of tumor cells or 3+ in >30% tumor cells), and the percent of tested samples showing moderate or strong IHC staining for anti-CD166 are show in Table 4 below.
TABLE-US-00022 TABLE 4 IHC Assay of CD166 Expression In Patient-Derived Cancers % Samples with Tissue Moderate or (Total No. of Samples) Cancer Type Strong IHC Score Prostrate (119) Adenocarcinoma 98.3 Breast (392) Ductal carcinoma 87.5 Lung (213) Non-small cell lung cancer 83.1 Head & Neck (122) Squamous cell carcinoma 81.1 Endometrial (147) Adenocarcinoma 75.5 Ovarian (129) Adenocarcinoma 70.5 Biliary (177) Cholangiocarcinoma 56.5
Example 11. Binding of Anti-CD166 Antibodies to Human and Cynomolgus Cells
[0610] The exemplary studies provided herein were designed to evaluate anti-CD166 activatable antibodies of the disclosure for binding to human and cynomolgus cells in a flow cytometry assay.
[0611]
[0612] The binding of the anti-CD166 antibody (huM9 vk-1/HcC; VH of SEQ ID NO: 122, VL of SEQ ID NO: 123) of the present disclosure to human H292 cells and cynomolgus primary kidney epithelial cells was evaluated using flow cytometry-based binding assay. In a typical assay, H292 cells or cynomolgus primary kidney epithelial cells were incubated with the indicated concentrations of anti-CD166 antibody in PBS+2% FBS for 1 hr on ice. After washing 2 with PBS+2% FBS, cells were incubated with a goat anti-human IgG secondary antibody, conjugated to AlexaFluor 647 (Jackson ImmunoResearch), for 30-45 min on ice. Cells were then washed 2 with PBS+2% FBS and fixed with 1% formaldehyde. Bound antibody was detected using a Guava EasyCyte cytometer and the mean fluorescence intensity (MFI) of the cell population was measured.
[0613] As shown in
Example 12. Inhibition of Cell Binding to CD6 by Anti-CD166 Antibodies
[0614] In this exemplary study, anti-CD166 antibodies of the present disclosure demonstrate the ability to block the adhesion of human lymphoma cells to immobilized CD6, the receptor for which CD166 is the ligand.
[0615]
Example 13. Protease-Dependent Activation of Anti-CD166 Activatable Antibodies
[0616] The exemplary studies provided herein were designed to evaluate the protease-dependent activation of anti-CD166 activatable antibodies and conjugated activatable antibodies of the disclosure.
[0617]
[0618]
TABLE-US-00023 TABLE 14 Binding of Anti-CD166 Antibody Constructs to CD166 and Human Cells HCC1806 Flow H292 Flow CD166 ELISA Cytomtry Cytomtry Antibody Construct Kd (nM) Kd (nM) Kd (nM) CD166-AADC 2.9 >300 >200 CD166-AADC, uPA cleaved 0.18 9.9 5.5 CD166-AADC, 0.17 9.9 5.3 matriptase cleaved CD166-AADC, 0.16 12 6.9 MMP-14 cleaved CD166-ADC 0.15 6.1 3.3 CD166-Pb 3.05 >300 >200
[0619] As shown by the exemplary results in Table 14, the uncleaved CD166-AADC demonstrated an increased apparent Kd as compared to the unmasked CD166-ADC in ELISA and flow cytometry assays. Activation of the CD166-AADC by all three of the proteases appeared to restore the binding affinity of the anti-CD166 activatable antibody drug conjugate to a level comparable to that the unmasked CD166-ADC.
[0620]
TABLE-US-00024 TABLE 15 In vitro Cytotoxicity of Anti-CD166 Antibody Constructs to Human Cells H292 EC50 HC1806 EC50 Antibody Construct (nM) (nM) CD166-AADC 2.2 0.9 CD166-AADC, 0.5 0.3 uPA cleaved CD166-AADC, 0.5 0.2 matriptase cleaved CD166-AADC, 0.5 0.2 MMP-14 cleaved CD166-ADC 0.3 0.1
[0621] These exemplary results of Table 15 and
Example 14. Immunological Risk Assay Of Anti-CD166 Activatable Antibodies
[0622] The exemplary studies provided herein were designed to evaluate the ability of activatable anti-CD166 antibody drug conjugates (CD166-AADC) of the present disclosure to trigger an immunological response in an in vitro assay.
[0623] In these exemplary studies, human peripheral blood mononuclear cells (PBMCs) were tested in in vitro assays for cytokine release and proliferation in response to treatment with activatable anti-CD166 antibody drug conjugate (anti-CD166-7614.6-3001-spdb-DM4, CD166-AADC), an anti-CD166 antibody drug conjugate (anti-CD166 (vk-1/HcC)-spdb-DM4, CD166-ADC), an anti-CD3 positive control (OKT3 antibody), and an isotype control antibody drug conjugate (Isotype) at the following concentrations:
TABLE-US-00025 No. Antibody (nM) No. Antibody (nM) 1 Untreated 10 Isotype (0.67 nM) 2 Anti-CD3 (0.67 nM) 11 Isotype (6.7 nM) 3 Anti-CD3 (6.7 nM) 12 Isotype (67 nM) 4 Anti-CD3 (67 nM) 13 Isotype (670 nM) 5 Anti-CD3 (670 nM) 14 CD166-ADC (0.67 nM) 6 CD166-AADC (0.67 nM) 15 CD166-ADC (6.7 nM) 7 CD166-AADC (6.7 nM) 16 CD166-ADC (67 nM) 8 CD166-AADC (67 nM) 17 CD166-ADC (670 nM) 9 CD166-AADC (670 nM)
[0624] In this exemplary study, five normal, healthy donors in two separate formats, wet coat and soluble test article, were evaluated. A standard panel of Th1 and Th2 cytokines including IL-2, IL-4, IL-6, IL-10, TNF, and IFN were measured at 24 hr post-treatment. As shown in
Example 16. Antibody-Dependent Cell Cytotoxicity of Conjugated Activatable Anti-CD166 Antibodies
[0625] The exemplary studies provided herein were designed to evaluate the in vitro antibody-dependent cell cytotoxicity (ADCC) to human cells of anti-CD166 activatable antibody drug conjugates of the present disclosure.
[0626]
[0627] ADCC activities in this exemplary assay were evaluated using an ADCC reporter bioassay (Promega). In this assay, Jurkat T cells stably transfected with FcRIIIa and an NF-AT-inducible luciferase reporter were incubated with CD166-expressing SKOV3 cells in the presence of CD166-AADC or control antibodies. Luciferase activity is stimulated as a function of antibody binding to target cells, FcRIIIa receptor engagement and downstream signaling in effector cells. In SKOV3 cells, which express high levels of CD166 and EGFR, incubation with CD166-AADC or the CD166-ADC showed similar activity to an IgG1 isotype control ADC, and lower than observed with the positive control anti-EGFR antibody. Dose titration of CD166-AADC or CD166-ADC in the assay. These data suggest that CD166-AADC, as well as CD166-ADC, have limited potential for ADCC.
Example 17. Efficacy of Conjugated Activatable Anti-CD166 Antibodies Against Cell- and Patient-Derived Xenograft Tumor Models
[0628] The exemplary studies provided herein were designed to evaluate the in vivo efficacy of anti-CD166 activatable antibody drug conjugates of the present disclosure against cell- and patient-derived xenografts in a mouse tumor model.
[0629] In these exemplary studies, multiple human cell line-derived and patient-derived xenograft (PDX) models representing various cancer types were tested. Two cell line derived xenograft models (H292 non-small cell lung carcinoma (NSCLC) cells and HCC1806 triple negative breast carcinoma cells), and two patient-derived xenograft (PDX) models for ovarian carcinoma (CTG-0791) and cholangiocarcinoma (CTG-0941). For each model, tumor-bearing mice were randomized into groups and treatment begun with an anti-CD166 activatable antibody drug conjugate of the present disclosure (anti-huCD166 (HcC/vk-1)-7614.6-3001-spdb-DM4, CD166-AADC), an isotype control SPDB-DM4 conjugate, or vehicle control as indicated. Test articles were administered intravenously on study day 0 and 7, at 3 or 5 mg/kg as indicated.
[0630] As depicted in
TABLE-US-00026 TABLE 16 Efficacy of Anti-CD166 Activatable Antibody Drug Conjugates Anti-Tumor Response Tumor Model Cancer Type With CD166-AADC H292 NSCLC Yes H1975 NSCLC Yes CTG-0166 NSCLC (squamous) Yes HCC1806 Triple negative breast cancer Yes CTG-0791 Ovarian Yes CTG-0941 Cholangiocarcinoma Yes
Example 18. In Vitro Cytotoxicity of Conjugated Activatable Anti-CD166 Antibodies Against Endometrial Cancer-Derived Cell Lines
[0631] The exemplary studies provided herein were designed to evaluate the in vitro efficacy of anti-CD166 activatable antibody drug conjugates of the present disclosure against endometrial cancer-derived cell lines.
[0632] As shown in
Example 18. In Vitro Cytotoxicity of Conjugated Anti-CD166 Antibody Drug Conjugates Against Various Cancer-Derived Cell Lines
[0633] The exemplary studies provided herein were designed to evaluate the in vitro efficacy of anti-CD166 antibody drug conjugates of the present disclosure against endometrial cancer-derived cell lines.
[0634] In these exemplary studies, the in vitro cytotoxicity of anti-CD166 antibody drug conjugates (anti-CD166 (vk-1/HcC)-spdb-DM4, CD166-ADC) were tested against multiple human cancer-derived cell lines. In a typical assay, the cells were incubated with concentrations of CD166-ADC for 3 to 5 days at various concentrations (from 0.1 nM to 50 nM). Cell viability was measured using the CellTiter Glo assay. The cytotoxicity of the CD166-ADC was compared to a negative isotype control (chKTI-spdb-DM4. In the case of the PC3 prostate cancer cell line and the SAS head and neck squamous cell carcinoma cell lines, the tested article was anti-CD166-vc-MMAD, and the negative control was an isotypic palivizumab-vc-MMAD. The results of these cytotoxicity assays is summarized below in Table 8.
TABLE-US-00027 TABLE 8 In vitro Cytotoxicity of Anti-CD166 Antibody Drug Conjugate to Human Cancer Cells Cytotoxicity of Cell Type Cancer Type CD166-ADC ? ZR75-1 Human breast ductal carcinoma Yes (estrogen receptor positive) ZR75-30 Human breast ductal carcinoma Yes (estrogen receptor positive) MDA-MB-361 Human breast adenocarcinoma Yes (estrogen receptor positive) HCC1954 Human breast ductal carcinoma Yes (triple-negative) HCC1143 Human breast cancer (triple-negative) Yes PC3 Human prostate adenocarcinoma Yes SAS Human head & neck squamous cell Yes carcinoma
Example 19: In Vivo Imaging of Activatable Anti-CD166 Antibodies in a Mouse Lung Cancer Xenograft Model
[0635] This Example shows that activatable anti-CD166 antibodies of the present disclosure demonstrate tumor-associated protease-dependent in vivo activation and binding to CD166 expressed in a lung cancer (NSCLC) mouse xenograft model by in vivo fluorescent imaging.
[0636]
[0637] The results of this exemplary study showed that fluorescent signals from the unmasked anti-CD166 antibody of the present disclosure and the activatable anti-CD166 antibodies of the present disclosure were able to bind CD166 in the xenograft, thus blocking the subsequent binding of fluorescently-labeled anti-CD166. In contrast, a correspondingly masked anti-CD166 antibody but which lacked a protease cleavage site (CM) did not block subsequent binding of CD166-AF750 to an extent comparable to the isotype control. Without being bound by any particular theory, this exemplary study demonstrated that activatable anti-CD166 antibodies of the present disclosure can be activated in vivo via tumor-associated protease cleavage, thus allowing the activated activatable anti-CD166 antibody to bind CD166 in the xenograft tumor to an extent comparable to the unmasked anti-CD166 antibody of the present disclosure. The masked anti-CD166 antibody lacking a protease cleavage domain (CM) of the present disclosure was not activatable in the same manner, and thus did not appreciably bind to the tumor xenograft.
Example 20. Efficacy of Conjugated Activatable Anti-CD166 Antibodies Against Cell-Derived Xenograft Tumor Models
[0638] The exemplary studies provided herein were designed to evaluate the in vivo efficacy of anti-CD166 activatable antibody drug conjugates (AADCs) of the present disclosure against cell-derived xenografts in a mouse tumor model.
[0639] In these exemplary studies, anti-CD166 activatable antibody drug conjugates of the present disclosure were tested for efficacy against model mouse tumor xenograft model of lung cancer (H292 human non-small cell lung carcinoma (NSCLC) cells). In this study, tumor-bearing mice were treated with an anti-CD166 antibody drug conjugates and anti-CD166 activatable antibody drug conjugate (AADC) of the present disclosure, including anti-CD166-7614-2001-spdb-DM4 (CD166-7614-2001-DM4), anti-CD166-7614.6-2001-spdb-DM4 (CD166-7614.6-2001-DM4), anti-CD166-7614.8-3001-spdb-DM4 (CD166-7614.8-3001-DM4), anti-huCD166-spdb-DM4 (CD166-DM4), and an isotype control (palivizumab-spdb-DM4; Isotype-DM4). 5 mg/kg of test articles were administered intravenously on study days 1 and 8 to each mouse, and the mean tumor volume (MTV) of the H292 xenograft was measured on the indicated days.
[0640] As depicted in
OTHER EMBODIMENTS
[0641] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following.