Targeted shell for use in drug delivery system utilizing carbosilane dendrimer

10772973 ยท 2020-09-15

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention is related to a targeted type shell for drug delivery system. The object of the present invention is to provide the targeted type shell for DDS, which comprises a carbosilane dendrimer containing a silole produced by which is formed by utilizing the reaction between thiol group and alkyl halide, and a targeted protein containing a labeled proteins such as green fluorescent protein with a target recognition site. The shell may incorporate compounds having a variety of molecular weight and biopolymers, and selectively deliver them into targeted cells.

Claims

1. A targeted type shell for drug delivery system comprising an aggregatable molecule shown in formula (I): ##STR00007## wherein, each Y independently represents a bromine atom, a sulfur atom, or a target sequence presented, wherein: at least one Y is the target sequence presented part and is bound through a sulfur atom, the target sequence presented part is composed of a protein or peptide having a target recognition site, and provided that at least one Y is not bromine; wherein the targeted type shell for drug delivery system encloses any molecule selected from the group consisting of a protein having molecular weight of 200,000 or less, a nucleic acid and a hydrophobic molecule.

2. The targeted type shell for drug delivery system according to the claim 1, wherein said peptide specifically binds to any targeted protein selected from the group consisting of a surface antigen, a receptor, a gate, a transporter and a channel to form a conjugate for promoting endocytosis of said conjugate into a cell.

3. The targeted type shell for drug delivery system according to the claim 1, wherein said peptide comprises the amino acid sequence selected from the group consisting of: TABLE-US-00020 DMPGTVLPGG (SequenceNo.1inthesequencelisting); VPTDTDYSGG (SequenceNo.2inthesequencelisting); and DMPGTVLPGGGGGSEGEWQQQQHQWAKQE (SequenceNo.3inthesequencelisting).

4. The targeted type shell for drug delivery system according to the claim 1, wherein said peptide comprises the amino acid sequence selected from the group consisting of: TABLE-US-00021 MASMTGGQQMGRDMPGTVLPGGMSKGEELFTGVVPILVELDG DVNGHKFSVSGEGEGDATYGKLTLKFISTTGKLPVPWPTL VTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF KDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHK LEYNYNSHNVYITADKQRNGIKANFKTRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALLKDPNEKRDHMVL LEFVTAAGSGITDEVDGTELYKGGHHHHHH (SequenceNo.4inthesequencelisting); MASMTGGQQMGRVPTDTDYSGGMSKGEELFTGVVPILVELDG DVNGHKFSVSGEGEGDATYGKLTLKFISTTGKLPVPWPTL VTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF NDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHK LEYNYNSHNVYITADKQRNGIKANFKTRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALLKDPNDKRDHMVL LEFVTAAGSGITDEVDGTELYKGGHHHHHH (SequenceNo.5inthesequencelisting); and MASMTGGQQMGRDMPGTVLPGGGGGSEGEWQQQQHQWAKQE MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG KLTLKFISTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQRNG IKANFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALLKDPNEKRDHMVLLEFVTAAGSGITDEVDGTCELYKGG HHHHHH (SequenceNo.6inthesequencelisting).

5. The targeted type shell for drug delivery system according to claim 1, wherein the target sequence presented part is composed of a protein or peptide having a target recognition site thereby being delivered to a. targeted tissue, wherein said. targeted tissue is any tissue selected from the group consisting of a normal tissue having inflammation, a tissue having undesirable gene expressions, a cell having undesirable gene expressions, and a tissue composed of tumor cells.

6. The targeted type shell for drug delivery system according to claim 1, wherein said aggregatable molecule shown in the formula (I) is selected from the group consisting of the following formula (II) to (V), wherein TSPP in the formula means fluorescent protein with said target recognition site: ##STR00008##

7. The targeted type shell for drug delivery system according to claim 6, wherein said protein is any fluorescent protein selected from the group consisting of a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein and a green fluorescent protein.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1A, FIG. 1B and FIG. 1C are a schematic diagrams showing basic formula of general carbosilane dendrimers.

(2) FIG. 2 is the figure showing synthesis scheme of dimethyl dumbbell (1) 6-Br from dimethylsilane.

(3) FIG. 3A, FIG. 3B and FIG. 3C are graphs showing particle size distribution of prepared micelles.

(4) FIG. 4 is a typical electron micrograph of the prepared micelle observed by using a scanning electron microscope (SEM).

(5) FIG. 5 is the graph showing the emission property of the products obtained by incubating the complex of GFP and silole dendrimer shown in formula (X) (hereinafter, it is referred to as GFP-silole dendrimer complex), GFP only, or silole dendrimer only shown in formula (X).

(6) FIG. 6A, FIG. 6B and FIG. 6C are graphs showing the particle size distribution of the micelle prepared in the presence of the model drug.

(7) FIG. 7A and FIG. 7B are graphs showing the emission property, when the micelle consisting of GFP-silole dendrimer complex and it includes Dil. The micelle was excited at 360 nm.

(8) FIG. 8A and FIG. 8B are graphs showing the emission property, when the micelle consisting of GFP-silole dendrimer complex and it includes WGA labeled with Alexa 594. The micelle was excited at 360 nm.

(9) FIG. 9 is an electrophoresis gel image of inverse PCR product after inverse PCR at different annealing temperatures.

(10) FIG. 10 is the graph showing the measuring result of the fluorescent spectrum of aggregated fluorescent protein driven micelle to which the target peptide sequence is bound.

(11) FIG. 11 is the graph showing the particle size distribution of aggregated fluorescent protein driven micelle to which the target peptide sequence of MCF-7 is bound.

(12) FIG. 12(A), FIG. 12(B) and FIG. 12(C) are electron microscope images to decide whether the formed particle were micelle or vesicles by using a low temperature and low vacuum scanning electron microscope. In the figures, structures shown with a white circle and white arrow are considered as crystals of salts. These shown with a black circle and black arrow are considered as vesicle-like substances.

(13) FIG. 13(A), FIG. 13(B), FIG. 13(C) and FIG. 13(D) are graphs showing the incorporation of a targeted protein and a micelle including the targeted protein. FIG. 13(A) shows those of HepG2 targeted type 1 protein ()() and MCF7 targeted type 1 protein ()(). FIG. 13(B) shows those of HepG2 targeted type 1 protein (+)(+) and MCF7 targeted type 1 protein (+)(+). FIG. 13(C) shows those of HepG2 targeted type 1 micelle ()() and MCF7 targeted type 1 micelle ()(). FIG. 13(D) shows those of HepG2 targeted type 1 protein (+)(+) and MCF7 targeted type 1 protein (+)(+).

(14) FIG. 14(A), FIG. 14(B), FIG. 14(C), FIG. 14(D) and FIG. 14(E) are analyzing results by using FACS showing the difference of the incorporation among the micelles, after 24 hours from the contact of A549 cells and the micelle of the present invention. FIG. 14(A) shows that without the micelle, FIG. 14 (B) and FIG. 14 (C) show these by using non-targeted micelles, and FIG. 14 (D) and FIG. 14 (E) show these by using the targeted micelles.

(15) FIG. 15(A), FIG. 15(B), FIG. 15(C), FIG. 15(D) and FIG. 15(E) are analyzing results by using FACS showing the difference of the incorporation among the micelles, after 24 hours from the contact of MCF7 cells and the micelle of the present invention. FIG. 15(A) shows that without the micelle, FIG. 15 (B) and FIG. 15 (C) show these by using non-targeted micelles, and FIG. 15 (D) and FIG. 15 (E) show these by using the targeted micelles.

(16) FIG. 16(A) and FIG. 16(B) show the graphs for time-dependent change or time-dependent change of the non-targeted micelle. FIG. 16(A) shows the result by using the non-targeted micelle (NSS25), and FIG. 16(B) shows that by using the non-targeted micelle (NSS26), respectively.

(17) FIG. 17 shows the graphs for time-dependent change or time-dependent change of the targeted type 1 micelle.

(18) FIG. 18(A), FIG. 18(B) and FIG. 18(C) show the graphs for time-dependent change of the non-targeted micelle or targeted micelle. FIG. 18 (A) shows the result by using the non-targeted type (NSS25), FIG. 18(B) shows the non-targeted type (NSS26), and FIG. 18 (C) shows the targeted type 1 micelle, respectively.

(19) FIG. 19(A) and FIG. 19(B) are gel-electrophoresis images showing gel-electrophoresed protein which is composed of the shell. FIG. 19(A) is the result before staining, (B) is that stained with Coomassie Brilliant Blue (CBB).

(20) FIG. 20(A) shows fluorescence microscopy images showing the incorporation of the non-targeted type micelle onto the target cells cultured in a collagen coat dish. The upper row is the fluorescence microscopy image after 3 hours from the start of the experiment, and lower row is after 24 hours therefrom.

(21) FIG. 20(B) shows optical microscopic images showing the status when the cells were cultured without micelles either in a poly-d-lysine coat dish or the collagen coat dish.

(22) FIG. 20(C) shows the fluorescence microscopy images showing the incorporation of the targeted type 1 micelle onto the target cells cultured in a collagen coat dish. The upper row is the fluorescence microscopy image after 3 hours from the start of the experiment, and lower row is after 24 hours therefrom.

MODE FOR CARRYING OUT THE INVENTION

(23) The present invention is explained in detail below. The present invention is the target type shell for drug delivery system composed of the aggregatable carrier material for drug delivery system having the aggregatable molecule shown in the following formula (I) and target sequence presenting part. The shell may enclose any one of the molecule selected from the consisting of the protein, the nucleotide, and the hydrophobic molecule having the molecular weight not over than 200,000.

(24) ##STR00003##
In the formula 1, Y represents a bromine atom, sulfur atom, or a target sequence presented part which is bound through sulfur atom. Here, said target sequence presented part is composed of a protein or peptide having a target recognition site thereby being delivered to a targeted tissue, and a conjugate of said targeted protein and said target recognition site accelerates endocytosis said shell. Y does not simultaneously become bromine.

(25) The carbosilane dendrimer used in the present invention (hereinafter, it is sometimes referred to as silole dendrimer.) is further preferably the compound having the following structure, because it allows to comprise both of the aggregatable property and the targeted sequence presenting part described later.

(26) FIGS. 1A to 1C show a general structure of carbosilane dendrimer. A compound shown in FIG. 1 A is referred to as fun (0)3, which has a benzene ring as a core marked with a circle. The compound shown in FIG. 1B is referred to as dumbbell (1)6, which has two fun (0)3 molecules connected with silane having 2 methyl substitute (Me-Si-Me) instead of the core. The compound shown in FIG. 1C is referred to as ball (1)6, wherein the molecule, fun (0)3 without the core is bound instead of Me-Si-Me of the dumbbell to form the ball shape.

(27) Carbosilane dendrimer of the present invention is synthesized by using procedures, the scheme 1, shown in FIG. 2.

(28) The structure of carbosilane dendrimer of the present invention is completely different from those of the conventional carbosilane dendrimers, and one of bromine atom binding to the end of the molecule pertains to form the bond with targeted sequence presented part. Here, the targeted sequence presenting part is preferably the protein having the targeted recognition site, which is shown in the Seq. Nos. 1 to 3 in the sequence listing from the view point that it enables to conduct specific delivery of the drug for DDS composed by the dendrimer.

(29) Also, the protein as the target sequence has solely the reactive thiol group, and it is preferable that the thiol group locates outside of folded protein, namely, the surface of the protein.

(30) Since the thiol groups react with the halogen atoms contained in the dendrimers to play a role to bind the protein and the dendrimer, the thiol groups located in side of the folded protein may not be involved in forming the bond. Here, the protein having thiol groups comprises the protein originally having thiol groups, that having newly introduced thiol groups by using the genetic engineering technique and the like, and that having the thiol groups resulting from the reduction of cysteine in the cysteine including protein.

(31) The positions of the thiol group in the protein are not particularly limited. However, it is sometimes preferable that the thiol groups are positioned in the specific region on the protein. Furthermore, it sometimes enables to control emission properties of the shell. Note that cysteine included in in the protein may be that inserted into the predetermined position by using the gene-engineering technique such as for replacing the existing arbitrary amino acid with cysteine, that for inserting it at the predetermined position and the like. It is easily conducted for the person skilled in the art to introduce cysteine residue at the desirable position in the protein by using the known gene engineering method such as the site-directed mutagenesis and the like.

(32) The protein having the targeted recognition site which composes the targeted sequence presented part is not limited as long as it has mutually association properties (association properties). However, the fluorescent protein emitting colors other than green described in below is preferably used. Those fluorescent proteins emitting fluorescence other than green are sometimes collectively referred to as GFP. Association of such fluorescent proteins to the carbosilane dendrimer emits strong fluorescence, and it leads to easy detection of the association state.

(33) As GFPs used in the present invention, there are mentioned, for example, GFP shown as Seq. No. 7 in the sequence listing, GFP shown as Seq. No. 8, BFP shown as Seq. No. 9 in the sequence listing which is blue fluorescent protein, YFP shown as Seq. No. 10 in the sequence listing and the like, and also CFP, RFP and other variant GFPs provided from Clontech Laboratories, Inc., and the like. Besides these, the fluorescent protein derived from Discosoma shown as Seq. No. 5 in the sequence listing and the like may be used. However, GFP shown as Seq. No. 7 in the sequence listing is preferably used, because it has strong fluorescence intensity, and also it is easy handled. Furthermore, it is assumed that commercially available Azami-Green and other color variants, provided by Medical & Biological laboratories Co. Ltd., are also preferably used, because of their structural properties.

(34) Also, such GFPs may be prepared by using known methods, for example, referring to Biochem. Biophys. Acta 1679 (2004) 222-229; Biochem. Biophys. Res. Commun. 330 (2005) 454-460, and the like. Also, GFPs may be used those produced by outsourcing to the protein manufacturing company.

(35) The aggregatable molecule of the present invention is formed by using the molecules containing functional groups causing AIE effect such as silole and the like as a framework and associative proteins such as fluorescent protein as the targeted sequence presented part. In the micelle formed by using them, aggregated siloles also emit fluorescence. As a result, fluorescence resonance energy transfer (FRET: Fluorescence resonance energy transfer) is occurred between the associated fluorescence proteins and gathered siloles, and it makes the fluorescence strong. When the micelle is collapsed, FRET disappears.

(36) Therefore, when the micelle manufactured by using the present invention is used as the aggregatable molecule for the drug delivery, of which status in vivo may be monitored by using the change of FRET as an index. Moreover, such monitoring enables to trace the location of the carrier and its status possible.

(37) In order to cause FRET between the fluorescent protein and the silole dendrimer, fixed position of the fluorescent protein on the silole dendrimer is important. The person skilled in the art may easily determine the position on the protein onto which binds the dendrimer by a preliminary experiment and the like. When GFP is used as the fluorescent protein, it is preferable to bind a loop region which is contiguous to one region among N-terminal region, C-terminal region, N-terminal region and C-terminal region. It is preferable that the amino acid such as cysteine having thiol group exists in the region.

(38) Here, the binding in the N-terminal region means that the protruding moiety from the core site, such as being composed of about 10 amino acids positioned close to the end of N-terminal, is binding to the silole dendrimer. As the same as that described above, in C-terminal, the protruding moiety from the core site, such as being composed of 10 amino acids positioned close to the end of N-terminal, is binding to the silole dendrimer.

(39) A position of halogen group carried on the silole dendrimer of the present invention is not limited particularly. However, it is preferable to located on the side chain of the silole dendrimer. More preferably, it is located at the side chain terminal, which is the most distant position from the silole group, as the formula (I) shows.

(40) As described above, the silole dendrimer used in the method of the present invention is preferable the compound shown in formula (I). The compound may be synthesized, for example, through silole core 2 (1,1-diaryl-2,3,4,5-tetra phenyl silole) from 1,2-diphenyl acetylene via the known intermediate 18 as shown in the scheme 2 via the known intermediate 18.

(41) Next, the silole core dendrimer 3 is obtained through hydrosilation of 2 with trichlorosilane using H.sub.2PtCl.sub.6-6H.sub.2O as a catalyst, and subsequent Grignard reaction by using aryl magnesium bromide. The silole core dendrimer 3 obtained is treated with dichlorohexyl borane and then subjected to hydrolyzation with hydrogen peroxide in alkaline aqueous solution to obtain hexahydroxy derivative 4. Subsequently, the hexahydroxy derivative is subjected to O-mesylation to replace with bromine anion to obtain the compound 5 (Tetrahedron Lett., 2007 48:4365-4368).

(42) ##STR00004##

(43) The protein having the targeted recognition site which composes the targeted sequence presented part is not limited as long as it has association properties. However, the protein is preferably any one of the fluorescent protein selected from the group consisting of the white fluorescent protein, the red fluorescent protein, the yellow fluorescent protein, the blue fluorescent protein and the green fluorescent protein.

(44) It is because that they are easily purchased, and have high intensity fluorescence so that they generate FRET to give strong fluorescence. Here, the blue fluorescent protein includes any of those emits blue or cyan fluorescence.

(45) The aggregatable molecule utilized in the invention is prepared by mixing the protein having thiol group, which is targeted sequence presented part, and the dendrimer compound having halogen group in the side chain shown in formula (VI), and then the mixture is incubated to react the thiol group of the protein and the halogen group of the dendrimer compound thereby binding the protein to the dendrimer compound. At this time, it is desirable to previously treat the protein with a reducing agent such as DTT to keep SH group in non-oxidized condition. Scheme 2 shows the reaction for incorporating one GFP molecule by using the reaction.

(46) ##STR00005##

(47) For example, the reaction shown in the scheme 2 may be conducted in a proper solvent, for example, an aqueous solvent such as PBS, saline, and the like. The reaction condition in this case is depending on the proteins used. The reaction temperature may be under the denaturation temperature of the protein used, for example, between 0 C. and 50 C., preferably between 30 C. and 45 C., and more preferably about 37 C. When GFP is used, the reactivity may be temperature-dependently improved up to 42 C. Therefore, it is preferable to use GFP for preparing the aggregatable molecules for DDS.

(48) Also, the reaction time varies depending on the reaction temperature. However, for example, it is from 1 to 24 hours, preferably from 10 to 19 hours, and more preferably about from 15 to 18 hours. It is because that the protein having thiol group used is bound to the silole dendrimer to form the micelle during such reaction time, and the liposome or the micelle is formed.

(49) That is, as protein-dendrimer complex is formed, the micelle of which outside is composed of the protein, which is the hydrophilic moiety, and of which inside is composed of the core part of dendrimer, which is the hydrophobic moiety. That is, it is considered that the liposome or the micelle is formed by the driving force generated from the association of the protein in the binding of the associative protein to the side chain of the dendrimer.

(50) Here, at least one or more proteins are replaced with the halogen atom at the end of side chain to bind to the silole dendrimer described above. Therefore, the targeted shell for the drug delivery system obtained through the reaction is a mixture of the conjugates shown in the chemical formulae (II) to (V).

(51) When the protein having thiol group is the fluorescent protein, the mixing ratio of such protein and dendrimer (molar ratio) may be, for example, that the dendrimer is from 1 to 20, when the protein is 1; preferably from 1:5 to 15, and more preferably about from 1:10.

(52) Also, when the reaction is conducted, it is preferable to incorporate an amino acid sequence, which becomes the targeted recognition site, into the protein as the targeted sequence presented part, because it enables to realize the effective delivery in the DDS described later. Such incorporations of the targeted recognition site may be conveniently conducted by using Inverse PCR. The plasmid coding thus prepared variant is incorporated into E. coli to express thereof, and then, it enables to obtain the variant protein easily for the aggregatable molecule for DDS.

(53) The incorporation of the targeted recognition site enables specific delivery of the micelle being composed of the aggregatable molecule for drug delivery system of the present invention to the normal tissue having inflammation, the tissue having undesirable gene expressions, the tissue composed of tumor cells and the like.

(54) The shell having the structure as described above for drug delivery system is produced and it encapsulates desirable agents. Thereby, these agents are specifically delivered to the targeted tissues, maintaining their efficiency.

Examples

(55) The following examples are merely illustrative and do not limit the scope of the invention.

(Example 1) Preparation of the Aggregatable Molecules and Micelles for DDS

(56) In the example, the following GFP was used as the protein for preparing the target presenting part and the silole dendrimer was used as a dendrimer.

(57) (1) Preparation of the Aggregatable Molecule for DDS

(58) In the example, the compound having the following chemical formula (X) (hereinafter, it is sometimes referred to as dimethyl dumbbell (1) 6-Br) as the dendrimer having halogen group, and GFP (green fluorescent protein) (Seq. No. 7) was used as the protein having thiol group.

(59) ##STR00006##

(60) The GFP (sequence No. 7 in the sequence listing) used here was prepared according to the method that had already been reported by the inventor et al. (see Biochim Biophys. Acta 1679 (2004) 222-229; Biochem. Biophys. Res. Commun. 330 (2005) 454-460). The amino acid sequence of GFP shown in the sequence No. 7 has replaced the amino acid at the position 251 in the C terminal region with cysteine, and originally presented cysteines at the positions 48 and 70 were replaced with serine and valine respectively.

(61) At first, DTT was added to GFP solution of 20 M concentration (in PBS) at 1 mM as a final concentration, and the GFP solution was treated for 10 minutes at room temperature to reduce cysteines on the surface of GFP. Ten L of 200 M of silole dendrimer shown the formula (VI) solution (in DMSO solution) was added to 400 to 450 L of 20 M GFP solution (in PBS) to have the final concentration of 10-fold molar equivalent, and then mixed with vortex mixer.

(62) After vortex, the solution was stood at 37 C. for overnight incubation to bind GFP and the silole dendrimer, and subsequently to form the micelles. The incubation time for this experiment was about 16 to 18 hours. The properties of the micelle particles in the solution were measured by using dynamic light scattering method (DLS; Dynamic light scattering). The result was shown in Table 1.

(63) TABLE-US-00003 TABLE 1 Average particle diameters of raw materials and products in PBS measured 5 times at 25 C. [nm] Particle diameter Particle Zeta peak by scattering diameter peak Average intensity by number 20 M GFP only 860.7 838.8 4.682 50 M Silole only 894.5 664.6 649.3 20 M GFP-Silole only 210.3 256.8 147.7

(64) Also, the particle size in the reaction mixture was measured at 25 C. by using ZETASIZER NANO-S (manufactured by Malvern Instrument Ltd.) with a laser beam wavelength of 532 nm. The result was shown in FIG. 3. FIG. 3(A) shows the result that GFP only was incubated and the particle sizes of the obtained products were measured. FIG. 3(B) shows the result that only the silole dendrimer was incubated and the particle size of the obtained product was measured. FIG. 3(C) shows the result that GFP and the silole dendrimer shown in formula (VI) were mixed and incubated, and the particle sizes of the obtained products were measured. The horizontal axis shows the particle sizes of the obtained products, and the vertical axis shows the percentage of the whole products with the sizes shown on the horizontal axis.

(65) When GFP and the silole dendrimer were incubated (in Table 1, it is shown as GFP-Silole only), the particle size of the micelle obtained was about 150 nm. In contrast, the particle size observed when GFP only was incubated was about 4 nm, and the particle size observed when silole dendrimer only was incubated was about 650 nm. It was considered that the reason why the large size particles were observed is caused by the aggregation among the silole dendrimers in the incubation of silole dendrimer only to form large aggregates.

(66) Next, according to the observation of the obtained micelle particles by using scanning electron microscope (SEM; Scanning Electron Microscope), a large number of particles having the particle size of about from 100 to 500 nm and a small number of those of about 500 nm were confirmed (see FIG. 4).

(67) From these results, it was clearly demonstrated that the micelle formed by using the aggregatable molecules for DDS of the present invention has the particle size distribution range between about 100 and 500 nm, and there were many particles having the particle size range between about 100 and 200 nm. Also, the electron micrograph by using SEM demonstrated that these particles have spherical micelle structures.

(68) (2) Confirmation of Fluorescence Resonance Energy Transfer

(69) The silole dendrimers used in the example have the emission property that aggregated hydrophobic core parts of the silole gave AIE effects. Therefore, it was confirmed that the dendrimers emit, when they form the micelle structures. Therefore, we examined whether fluorescence resonance energy transfer (FRET: Fluorescence resonance energy transfer) between the silole and GFP occurs or not in the micelles composed of GFP-silole dendrimers to which GFP binds to the silole dendrimer.

(70) Unreacted fluorescent proteins and dendrimers, free molecules, were removed from the reaction mixture; we conducted the emission property experiment (see FIG. 5). In order to examine the emission properties, the incubated products containing the silole dendrimer only was excited at a wavelength of 360 nm (white square), these containing GFP only was excited at the wavelength of 488 nm (white triangle), these containing both of GFP and the silole dendrimer (the micelle of the present invention) was excited at the wavelength of 370 nm (black circle). The micelle being composed of silole-GFP conjugates, which is the products obtained by incubating GFP and silole dendrimer in formula (X), showed the emission caused by FRET to GFP around 510 nm.

(71) As shown in FIG. 5, the silole dendrimer showed the emission peak around 480 nm. Also, the conjugate of GFP and silole dendrimer did not show a sharp emission peak, but it has the highest value around 510 nm. In contrast, GFP showed the sharp emission peak around 510 nm, and it was considered to be due to FRET from the silole dendrimer to GFP. When the micelles were collapsed, the emission from GFP considered to be caused by FRET, was also disappeared.

(72) That is, when the micelles were prepared by using the molecules, which are composed of the dendrimer having AIE effect and the associative protein such as fluorescent protein, the GFP-silole conjugates, they give FRET between the dendrimers and GFP, and collapsed micelle lost FRET.

(73) From the above, it was shown that the use of the micelle of the present invention as the aggregatable carrier for DDS enables to confirm the tissues or organs, to which the micelle was delivered. Also, the fluorescence from the fluorescent protein may be traced even after the micelle delivered to the targeted tissue or organ collapses. Thereby, the intracellular environment and the like may be detected by using the delivered fluorescent protein into the cell.

(74) (3) Experiment for Inclusion of Drugs and the Like into the Micelle Composed of GFP-Silole Dendrimer Complex

(75) Next, it was confirmed whether the micelle of the present invention is used for drug inclusion. In the experiment, DiI (1,1-dioctadecyl-3,3,3,3-tetramethyl indocarbocyanine perchlorate, Promokine PK-CA707-60010, manufactured by PromoCell GmbH), Oil orange SS (manufactured by Tokyo Chemical Industry, product No:T0553), goat anti mouse IgG (manufactured by Abcam plc, product No. ab6708)Alexa 610 (manufactured by Molecular Probes, product No.: A30050) and WGA (Wheat Germ Agglutinin: wheat germ agglutinin, manufactured by Molecular Probes) (WGA-Alexa Fluoro (registered trade mark) 594 conjugate, product No.: W11262) were used as model drugs.

(76) Ten L of 200 M of the silole dendrimer (in DMSO solvent) shown in the formula (X) was added to 20 M of GFP, of which cysteine was reduced, to have final concentration of 10-fold molar equivalent, and any one of followings was added and mixed with vortex mixer, and incubated overnight at 37 C. (about 16 to 18 hours): DiI (final concentration; 1 M, fluorescent dye), Oil orange SS (final concentration; 20 M, fluorescent dye), goat anti mouse IgG-Alexa 610 (final concentration; 0.1 M) and WGA (final concentration; 2 M).

(77) It was measured whether the micelles including each drug are formed in the sample to which each model drug is added; and if the micelles including the drug are formed, their particle size were measured by using the dynamic light scattering method. The results were shown in Table 2. Here, DiI, Oil orange SS, and goat anti mouse IgG-Alexa 610 were used as drug models.

(78) FIG. 6 A to C show the particle size distributions, when the model drugs were used. FIG. 6 A shows the distributions in the presence of DiI; FIG. 6 B shows these in the presence of Oil orange SS; and FIG. 6C shows these in the presence of goat anti mouse IgG-Alexa 610 respectively, when the micelles were prepared with these model drugs. The horizontal axis shows the particle size of the micelle, and the vertical axis shows the percentage of the micelles having each size shown on the horizontal axis against the whole micelle numbers. When DiI was added, the micelle size was about 95 nm; also when Oil orange SS was added, it is about 95 nm; and when IgG-Alexa 610 was added, it was about 180 nm.

(79) TABLE-US-00004 TABLE 2 Average particle diameter of raw material and product in PBS measured 5 times at 25 C. (nm) Particle diameter Particle Zeta peak by scattering diameter peak Average intensity by number 20 M GFP-Silole only 210.3 256.8 147.7 20 M GFP-Silole + Oil 137.3 159.6 95.27 20 M GFP-Silole + Oil 147.6 177.2 94.77 orange SS 20 M GFP-Silole + 277.7 324.3 179.7 Antibody-Alexa 610

(80) FIG. 7 shows the examination result for the emission properties of the micelles including DiI, the fluorescent dye. FIG. 7 B shows enlarged drawing of the spectrum in FIG. 7A, around 500 nm. The horizontal axis shows wavelength (nm), and the vertical axis shows relative fluorescent intensity (a.u.). At first, the micelles including DiI were prepared, and following test samples were prepared for measuring their fluorescence: the micelles washed 3 times with PBS; the filtered reaction mixture through a filter having a pore size of 0.45 m to remove free dye; and the filtered reaction mixture through the filter having the pore size of 0.22 m instead of the filter having the pore size of 0.45 to remove free dye.

(81) As shown in both FIGS. 7A and 7B, shoulder peaks were observed around the wavelength of 480 nm, when the samples were excited at the wavelength of 370 nm. It was considered that these peaks appeared the emission from the silole. It was considered that the peak around 510 nm appeared FRET from the silole to GFP; and the peak around 570 nm appeared FRET from the silole to DiI. From these results, it was confirmed that Dil was included in the micelle.

(82) Next, the emission properties of the micelles including WGA labeled with Alexa 584 was examined (see FIGS. 8 A and B). FIG. 8 A shows the measurement results of the reaction mixture in situ, when Alexa 594 labeled WGA was added. Also, FIG. 8 B shows the measurement results after removal of the unincorporated stuffs into the micelles such as the unreacted proteins, Alexa labeled WGA, the silole dendrimer, or GFP by using the ultrafiltration spin column (manufactured by Millipore). In FIG. 8, the solid line shows the emission property of the products obtained by mixing treatment of GFP-silole dendrimer complex and WGA; and the broken line shows that of the products obtained by mixing treatment of GFP and WGA.

(83) In the figure, the solid line shows the measurement result for the micelle composed of GFP-silole dendrimer complex including Alexa 594 labeled WGA; and the broken line show the measurement result for that including the mixture of GFP and Alexa 594 labeled WGA respectively (Excitation wavelength is 370 nm in each case).

(84) FIG. 8A shows the measurement result for the reaction mixture without the ultrafiltration spin column treatment in situ. In FIG. 8 A, the emission from the silole dendrimer, GFP and WGA were detected around 480 nm, 510 nm and 610 nm respectively. In contrast, as shown in FIG. 8 B, the sample with the ultrafiltration spin column treatment did not show the emission from the free silole dendrimer, GFP and WGA, because they were removed (the broken line). From the above, it was confirmed that Alexa 594 labeled WGA was included the prepared micelle.

(Example 2) Preparation of the Fluorescent Protein which Binds the Target Peptide Sequence

(85) The target peptide sequence binding fluorescent protein was prepared as follows. The protein bound to the micelle of the present invention at the C terminal, and it bound to the target peptide, which binds the receptor expressed on the surface of a cancer cell, at N terminal.

(86) (1) Inverse PCR

(87) (1-1) Selection of the Peptide Sequence

(88) The peptide sequence of the selected target peptide was shown in the following Table 3. MCF-7 is a human breast adenocarcinoma-derived cell, having the sequence listed in the following Table 3, and it is sometimes referred to as target type 1. MCF7-2 is the variant of MCF7-1 having the sequence listed in the following Table 3, and it is sometimes referred to as target type 2. Also, MCF7-1+ stand is another variant having the structure that the short peptide with -helix, which is sometimes referred to as -stand, was connected to MCF7-1 as shown in the following Table 3, and it is sometimes referred to as type 1 enhanced.

(89) TABLE-US-00005 TABLE3 Seq. CellSpecies PeptideSequence No. MCF7-1 DMPGTVLP 1 MCF7-2 VPTDTDYSGG 2 MCF7-1+ DMPGTVLPGGGGGSEGEWQQQQHQWAKQE 3 stand
(1-2) Preparation of Primers

(90) Primers for conducting inverse PCR of the peptide sequence shown in Table 3 were written in the following Table 4. Among these primers, Seq. No. 1 and 3 in the sequence listing were designed so as that elongation reaction initiates between DM and PGTVLP of the peptide sequence. Seq. No. 2 was designed so as that the reaction initiates between VP and DTDYSGG of the peptide sequence. They were designed for conducting optimal inverse PCR.

(91) TABLE-US-00006 TABLE4 Introduced Peptide Seq. Sequence primer No. DMPGTVLP F: 12 CCTGGTACTGTTCTTCCTGGTGGTATGAGTA AAGGAGAAGAACTT R:CATATCGCGACCCATTTGCTGTCCACC 13 VPTDTDYSGG F: 14 ACTGATACTGATTATAGTGGAGGAATGAGT AAAGGAGAAGAACTT R:AGGAACGCGACCCATTTGCTGTCCACC 15 DMPGTVLPGG F: 16 GGGSEGEWQQQQ CAACAACAACAACATCAATGGGCAAAACA HQWAKQE AGAAATGAGTAAAGGAGAAGAA R:CCATTCACCTTCACTACCACCACC 17 ACCACCAGGAAGAACAGT
(1-3) Preparation of the Template Plasmid for Inverse PCR

(92) A template plasmid for inverse PCR was prepared by the method described in the following paper.

(93) Protease-sensitive signaling by chemically engineered intramolecular fluorescent resonance energy transfer mutants of green fluorescent protein.Miho Suzuki, et al. Biochimica et Biophysica Acta (BBA)Gene Structure and Expression Volume 1679, Issue 3, 17 Sep. 2004, Pages 222-229
(1-3-1) Plasmid Construction for GFPuv5 Mutant

(94) GFPuv5 was prepared from the pGFPgcn4 as follows. Firstly, the inverse PCR products, which has a synonymous mutation for gene manipulation was generated by using inverse PCR with I167T mutation and forward primer, 5CATTGAAGATGGCTCCGTTCAA (Sequence No. 18) and reverse primer, 5CATTGAAGATGGCTCCGTTCAA (Sequence No. 19), were obtained. Subsequently, cyclization treatment of the products was conducted for obtaining GFPuv5. The construct obtained in this way was named pGFPgcn5.

(95) After that, cDNA of GFPuv5 was cloned into pET21a (manufactured by Novaben Inc.) to express the protein, and then the protein was purified and named GFPuv5tag. The code region was amplified using the primers 5CTCGACCAT[ATGGCTAGCATGACTGGTGGACAGCAAATGGGT]CGCATGA GTAAAGGAGAAGAACTTTTCA (Sequence No. 20) and 5 TGACGTGAATTCATTA[GTGATGGTGATGGTGATG]TTTGTAGAGCTCATCC ATGC (sequence No. 21). In Sequence No. 20, an adhesive tag adhering to the epitope tag composed of 11 amino acids from the terminal for 10 proteins of T7 gene toward N terminal of GFPuv5 series was marked as [ ]. The Sequence No. 21 provides His tag to C terminal of GFPuv5 series, and His tag in the sequence was shown as [ ].

(96) The DNAs having the nucleotide sequences shown in the Seq. Nos. 1 to 3 were inserted into pET21a, and then it was digested with both of NdeI and EcoRI. The pGFPgcn plasmid was used for gene manipulation and the pET21a plasmid was used for protein expression under the control of the T7 promoter. The nucleotide sequences of the gene of GFPuv5 and the mutants thereof were confirmed by DNA sequencing (ABI PRISM 3100, manufactured by Genetic Analyzer). Three more synonymous mutations were found during the experiment. Those have the following mutations: agt to agc at Ser at 30, cat to cac at His 78, and caa to cag at Gln 183.

(97) The experiment was continued including these mutations, because these mutations were not harmful for the fluorescent proteins. The fluorescent intensity of the purified GFPuv5tag was about 1.9 times higher than that of GFPuv4tag. After that, either of the cysteine residues at position 48 or position 70 was replaced with randomized amino acid by inverse PCR using pGFPgcn5.

(98) Both oligonucleotides 5 CTTAAATTTATTNNKACTGGAAAAC (Seq. No. 22) and 5 GGTAAGTTTTCCGTATGTTG (Seq. No. 23) were used for mutation of cysteine 48. Both of 5 GTGTTCAANNKTTTTCCCGTTATCCG (Seq. No. 24) and 5 CATACGTCAGAGTAGTGACAAG (Se. No. 25) were used for the mutation of cysteine 70. Culture of E. coli BL21 (DE3) was transformed with the obtained plasmids and screened by using daylight excitation for those having strong fluorescence, and selected on an agar medium. Several mutants emitting strong florescence were obtained at position 48 (replaced with one of Ala, Asp, Glu, Gly, Ile, Leu, Asn, Pro, Ser, Thr, Val, and Tyr). However, the C70V cysteine mutant gave only proper fluorescence at position 70.

(99) In order to produce double cysteine mutations GFPuv5 having strong fluorescent intensity, the plasmid having the single mutation was digested with both of NcoI and EcoRI and ligated to each region again. Selection was conducted by using the single mutants. The UV5CO tag (C48S/C70V) showed the highest fluorescence intensity among all the recombinants.

(100) Next, cysteines were introduced at both positions 6 and 229 by inverse PCR, respectively. The plasmid having C48S mutation and a set of the following primers were used for introducing respective mutation.

(101) TABLE-US-00007 ForGlureplacement: (Seq.No.26) 5TGTCTTTTCACTGGAGTTGTCCC and (Seq.No.27) 5TTCTCCTTTACTCATTTTTTC ForIlereplacement: (Seq.No.28) 5TGCACACATGGCATGGATGAGCTC and (Seq.No.29) 5CCCAGCAGCAGTTACAAACTC

(102) Three protease tags having trypsin target sequence (Glu-Gly-Arg) have various spacer sequence, which were no spacer, Thr spacer or Gly-Thy spacer, and necessary cysteine was replaced between His-231 and Asp-231. These constructs were obtained by using puvC48Stag, the obtained plasmid (a template), and the primers shown in the following Table 5.

(103) TABLE-US-00008 TABLE5 Seq. PlasmidName Primers No. pUV5trypS0tag F: 30 (withoutspacer) 5CAGCGCCGTTGTGAGCTCTACAAA TAATGAATT R:5TGTAATCCCAGCAGCAGTTAC 31 pUV5-trypS1tag F:5ACATGTGAGCTCTACAAATAA 32 (withThrspacer) R:5ACGGCCCTGTGTAATCCC 33 pUV5trypS2tag F:5GGAACATGTGAGCTCTACAAA 34 (withGly-Thr R:5ACGGCCCTGTGTAATCCC 33 spacer)
(1-3-2) Purification of GFPuv5tag Mutant

(104) E. coli BL 21 (DE3) was transfected by using all of the plasmids. 12 mL of E. coli at the stationary phase after overnight culture was seeded in 38 ml of LB medium supplemented with 50 g/ml ampicillin and 0.5 mM IPTG, and incubated at 37 C. for 8 hours. The cells were collected by centrifugation at 2,500g for 20 minutes and resuspended in 10 mL of PBS. The pellet of the cells was lysed in 10 ml of lysis buffer (pH 8.0) containing 50 mM Tris and 8M urea at room temperature for 15 minutes, and then vortexed. The lysed cells were centrifuged at 1,200g for 15 minutes, and the supernatant was taken to mix with Ni.sup.2+-NTA resins (manufactured by Qiagen Co. Ltd.) which were suspended in PBS. After sequentially washing the resins with PBS and 20 mM imidazole, the bound GFPuv5tag mutant was eluted with 250 mM imidazole solution.

(105) In order to exchange the buffer, the eluate was applied to PD-10 gel electrophoresis filtration column (manufactured by Amersham Bioscience Co. Ltd.), which was equilibrated with 10-fold diluted PBS. The eluted GFPuv5tag mutant protein was collected, and the concentrations thereof were determined by using Coomassie protein assay reagent (manufactured by Pierce Co.). Purified GFPuv tag mutants were analyzed by 15% SDS-PAGE.

(106) Nucleic acid sequence of the template plasmid for inverse PCR was shown as Sequence No. 26.

(107) (1-4) Conditions for PCR

(108) A reaction mixture shown in the following Table 6 was prepared, and the inverse PCR was conducted under the condition shown in the following Table 7.

(109) TABLE-US-00009 TABLE 6 Components Amount (L) Template(plasmid>pET21a (+) NSS25 5 KOD Dash Buffer (Toyobo Co. Ltd.) 5 2 mM dNTP (Toyobo Co. Ltd.) 5 F primer (2.5 pmol) 10 R primer (2.5 pmol) 10 KOD Dash (2.5 U/l) (Toyobo Co. Ltd.) 0.5 Sterile distilled water 14.5 Total 50

(110) TABLE-US-00010 TABLE 7 Temp. ( C.) Reaction period (min.) Cycles 95 3 98 0.1 5 65 2 70 4 98 0.1 74 2 25 70 4 70 7 4 4
(1-5) Confirmation by Gel Electrophoresis

(111) A portion of the PCR solution was taken, and subjected to gel electrophoresis with 0.8% PAGE at voltage 100 V for 30 minutes of applied voltage time to confirm the amplified peptides in each sample. The result of the electrophoresis was shown in FIG. 9

(112) (2) Removal of Independent a Sequence and Purification of PCR Products

(113) The reaction mixture shown in the following Table 8 was prepared and reacted at 120 C. for 30 minutes to remove the independent A sequence which was produced by the PCR. After that, the PCR products were purified by using QIAquick (a registered trademark), PCR Purification Kit (manufactured by QIAGEN) according to the instruction attached to the kit.

(114) TABLE-US-00011 TABLE 8 Composition Amount (L) inverse PCR product 50 10 NE Buffer 2.1 (New England Biolabs Inc. (NEB)) 1 10 mg/ml BSA (NEB) 2 2 mM dNTP 8.3 T4 DNA polymerase (3,000 unit/l)(NEB) 0.5 Total 60
(3) Ligation Reaction

(115) Subsequently, the reaction mixture shown in the following Table 9 was prepared and reacted at 16 C. for more than 3 hours to prepare a circular plasmid for transformation of E. coli DH5 described later. Depending on the variants, the temperature, 25 C., 37 C., and the like were used.

(116) TABLE-US-00012 TABLE 9 Composition Amount (L) PCR product 8 10 T4ligase B (NEB) 1 T4 DNA polynucleotide kinase (40,0000 unit/l) (NEB) 0.5 T4 DNA ligase (10,000 unit/l) (NEB) 0.5 Total 10
(4) Transformation of E. coli DH5

(117) 10 L of competent cells of E. coli DH5 (manufactured by BioDynamics Laboratory) was thawed on ice immediately before use, and prepared a competent cell solution. One L of the ligation reaction solution was added to the competent cell solution, and left on ice for 30 minutes. After that, the solution was incubated at 42 C. for 30 seconds and then cooled on ice for 2 minutes. 90 L of SOC medium (manufactured by TOYOBO Co., LTD.) was added to the solution, and reacted on a shaker at 37 C. for 1 hour. Thereafter, it was seeded on LB selection medium supplemented with ampicillin (manufactured by TOYOBO Co., LTD.), and incubated for overnight at 37 C.

(118) (5) Colony PCR

(119) Colonies obtained from the transformation were subjected to Colony PCR to confirm the predicted inserts.

(120) (5-1) Preparation of the Reaction Mixture for PCR

(121) The reaction mixture for colony PCR shown in the following Table 9 was prepared.

(122) TABLE-US-00013 TABLE 10 Composition Amount added (L) KOD Dash Buffer (Toyobo Co. Ltd.) 2 2 mM dNTP 2 Double His primer (2.5 pmol) 4 pET primer 4 KOD Dash (2.5 U/L) (Toyobo Co. Ltd.) 0.2 Sterilized distilled water 7.8 Total 20

(123) The reaction mixture for colony PCR was poured into a PCR tube. E. coli grown on the LB medium supplemented with ampicillin was collected and added to the tube. PCR was conducted according to the program shown in the following Table 11.

(124) TABLE-US-00014 TABLE 11 Temp. ( C.) Reaction time (min.) Cycles 95 3 98 0.5 5 50 0.5 70 0.5 98 0.1 72 0.5 25 70 0.5 70 7 4
(5-2) Electrophoresis

(125) Electrophoresis of the PCR reaction mixture was conducted with 1.2% PAGE at applied voltage of 100 V for 30 minutes. The colonies of which amplification were confirmed were inoculated into the culture bottle containing LB liquid medium (manufactured by TOYOBO Co., LTD.) and incubated at 37 C.

(126) (6) Purification of Plasmid

(127) The plasmid in E. coli cultured in the LB liquid medium was purified by using Wizard Plus SV Minipreps. DNA Purification System (manufactured by Promega Co.) according the instruction attached thereto. After that, the sequences of the purified plasmid were sent to Eurofin Genomics Co., Ltd. for their analysis.

(128) (7) Transformation of E. coli BL21 (DE3)

(129) Ten L of E. coli BL21 (DE3) competent cells (manufactured by BioDynamics Laboratory) were thawed on ice immediately before use, and prepared the competent cell solution. One l of the plasmid solution, which was confirmed to contain the target sequence by the sequencing, was added to the competent cell solution, and left to stand on ice for 30 minutes.

(130) After that, the solution was incubated at 42 C. for 30 seconds and then cooled on ice for 2 minutes. 90 L of SOC medium (manufactured by TOYOBO Co., LTD.) was added to the solution, and reacted on a shaker at 37 C. for 1 hour. Thereafter, it was seeded on LB selection medium supplemented with ampicillin, and left to stand overnight at 37 C. Next day, transformed colonies emitting green fluorescence were collected, and inoculated into culture bottles containing 1 ml of LB liquid medium supplemented with ampicillin. Then, they were left to stand overnight at 37 C. for pre-culture.

(131) (8) Purification of the Fluorescent Protein Binding to the Target Peptide Sequence

(132) (8-1) Colony Cultivation

(133) For samples, 4 tubes in 50 mL size to which both of 4 ml of the LB liquid medium supplemented with ampicillin and 290 L of the pre-cultured solutions were added were prepared, and cultured on the shaker at 28 C. for 4 hours. After that, 43 L of 100 mM IPTG (isopropyl--thiogalactopyranoside) was added to them, and they were cultured overnight at 28 C. on the shaker.

(134) (8-2) Recovery of the Protein

(135) Next day, the cultures in the four tubes were collected into one tube. Three tubes of which contents were transferred were washed with 1 ml PBS () buffer (manufactured by Wako Pure Chemical Industry, Ltd.), and the washed solutions were also added to the collected tube to which the cultures were collected. The tube containing the collected cultures was centrifuged at room temperature for 5 minutes at 5,000 rpm (the name of centrifuge: KUBOTA3740, the rotor number: KUBOTA AF2018, manufactured by KUBOTA Co.)

(136) After that, (i) the supernatant was removed, and 3 ml of PBS () buffer was added to the precipitation pellet (ii) to vortex well, and then the tube was centrifuged at 5,000 rpm for 5 minutes. The steps (i) and (ii) were repeated twice. Four ml of B-PER Lysis Buffer (manufactured by Reagent) was added to the precipitation pellet, and it was capped and stirred overnight at room temperature on the shaker.

(137) (8-3) Purification by His-Tag

(138) Two ml of Ni-NTA Agarose (manufactured by QIAGEN) was put in 15 ml tube, (i) the tube was centrifuged at 1,000 rpm for 1 minute, (ii) the supernatant was discarded, and 1PBS buffer was added to the tube and vortexed well. The steps (i) and (ii) were repeated three times for preparing Ni-NTA resin.

(139) The tube containing B-PER Lysis buffer solution was centrifuged at 12,000 rpm for 10 minutes at room temperature, and then the supernatant was transferred to a 15 ml Falcon tube. 400 L of well stirred Ni-NTA resin was added to the tube, and then the tube was placed on the rotary shaker and shook at room temperature for 10 minutes. After that, the tube was centrifuged at 1,000 rpm for 1 minute at room temperature, and the supernatant was discarded. (iii) 4 mL of 1PBS buffer was added to the tube and vortexed well, (iv) the tube was centrifuged at 1,000 rpm for 1 minute at room temperature, and the supernatant was discarded. The steps (iii) and (iv) were repeated twice.

(140) After that, (v) 4 ml of 20 mM imidazole (manufactured by Wako Pure Chemical Industry, Ltd.) was added to the tube and vortexed well, (vi) the tube was centrifuged at 1,000 rpm for 1 minute at room temperature, and the supernatant was removed. The steps (v) and (vi) were repeated twice. 500 l of 250 mM imidazole was added to the tube, and was stirred at room temperature for 10 minutes with the rotary shaker. Thereafter, the tube was centrifuged at 1,000 rpm for 1 minute, and the supernatant emitting green fluorescence was transferred to a new 15 ml Falcon tube to prepare the protein purified solution for the gel filtration in next stage.

(141) (8-4) Purification by Gel Filtration

(142) Imidazole in the protein purified solution was exchanged with PBS and the solution was purified to obtain the target peptide sequence binding fluorescent protein of interest. In the procedures described above, Nap 5 column manufactured by GE Heath Care Japan KK. was used to conduct the purification according to the instruction attached thereto.

(143) (9) Selection of the Target Peptide Sequence Binding Fluorescent Protein

(144) The concentration of the target peptide sequence binding fluorescent protein obtained from the purification procedure was measures by using absorbance, 280 nm, and the chromophore concentration (chromophore forming ability) was measured by using absorbance, 488 nm, according to the conventional method. The proteins of which ratio of A488/A280 exceeded 1.5 were selected as the target peptide sequence binding fluorescent protein of the interest. The result was shown in Table 12.

(145) TABLE-US-00015 TABLE 12 Wave length (nm) Ratio Type Absorbance 280 488 488/280 Target type 1 sample 1 0.2459 0.5246 2.1335 sample 2 0.2487 0.5295 2.1289 sample 3 0.2494 0.5307 2.1280 Target type 2 sample 1 0.4280 0.8236 1.9241 sample 2 sample 3 Target type 1 sample 1 0.6300 0.9039 14348 enhanced sample 2 0.7695 1.1427 14850 sample 3 Non-target type sample 1 0.6689 13 189 1.9717 sample 2 0.4544 0.9915 2.1821 sample 3 1.0079 20110 1.9952

(Example 3) Preparation of the Target Peptide Sequence-Binding Shell (Associated Fluorescent Protein Driving Type Micelle)

(146) Instead of GFP, the target peptide sequence binding fluorescent protein prepared in the example 2 was used to form the micelles to which target peptide sequences were bound, an associated fluorescent protein driving micelle, as the same as those employed in the example 1.

(147) (1) Emission Properties

(148) The emission properties of the associated fluorescent protein driving micelle with target peptide sequence binding fluorescent protein prepared as described above were measured in the same way as in the example 1 (see FIG. 10). In the legend of FIG. 10, the reactant shows the conjugate of the silole dendrimer and the target peptide sequence binding fluorescent protein, the unreacted material shows those without them, and each number shows the wavelength of excitation light (nm). An emission peak was also observed around 510 nm in the target peptide sequence-binding micelle as the same as that in the example 1.

(149) (2) Particle Properties

(150) The particle properties of the target peptide sequence-binding micelle were measured by a dynamic light scattering method as the same as used in the example 1 (see FIG. 11). In FIG. 11, the horizontal axis shows the particle size of the obtained micelle, and the vertical axis shows the percentage of in the micelle size in whole micelle size shown in horizontal axis. As a result, the particles having the particle size of about 100 nm to 200 nm were confirmed as the same as those in the example 1.

(151) From the above, it was demonstrated that the fluorescent protein-binding micelles having the target peptide sequence formed the equivalent size micelle to those without the target sequence. Furthermore, it was estimated that both of the micelles obtained in the example 1 and the present example were associated fluorescent protein driving type micelle.

(Example 4) DDS Micelle/Liposome (Vesicle) Form Discrimination Experiment

(152) (1) Preparation of Basic Liposome or Micelle

(153) The liposome or micelle was prepared as described below. Firstly, GFP containing solution was concentrated by using 10 K Amicon filter (Amicon) at 14,000g for 15 minutes, and then it was messed up to 99 L with 1PBS. In order to prepare 50 M/50 L of the micelle by using 20 M GFP containing solution, 137.5 L of GFP was concentrated.

(154) Next, 1 L of 100 mM DTT was added to the solution, and then incubated at room temperature for 10 minutes. Entire amount of the incubated solution was applied onto NICK column (GE Healthcare Japan), and 365 L of 1PBS was added. Further, 380 L of 1PBS was added, and then almost all of amount of the solution was recovered.

(155) Next, 3.53 L of 7.78 mM TPS (2, 3, 4, 5-tetra phenyl-1, 1-dimethyl silole) was added at 1:10 of molar ratio against GFP contained in the recovered solution. Then, the molecules in the solution was aggregated overnight at 37 C.

(156) Next, entire amount of the solution, about 380 L, which was aggregated overnight into 100 K Amicon filter, and then centrifuged at 14,000g for 10 minutes to concentrate it. Then, about 30 L was taken as a column upper fluid. 100 L of 1PBS was added to here, and then, it was centrifuged at 14,000g for 10 minutes to wash the column. Washing operation was repeated 3 times and about 300 L was collected.

(157) After the centrifugation by using the desktop centrifuge at 14,000g for 10 minutes, the column was inverted, and then the upper fluid on the column was collected. Proper quantity of 1PBS was added to the emptied column, and diluted to 1.2 volume of the amount of interest with 1PBS. The solution was equilibrated at 4 C. for 1 day, and diluted 20-fold to measure the particle size. Also, 80-fold dilution of the sample was measured by using Simadzu RF5300-PC at excitation wavelength of 370 nm, and measurement wavelength 488 nm (the range 35).

(158) About 350 L of the solution was taken from the solution, which was placed in 100 K Amicon filter and then centrifuged at 14,000g for 10 minutes, as the lower fluid of the column. It was added to the washed solution as described above so as to the total amount, 650 L. Then, it was diluted 20-fold for measuring the particle size. Also, 25-fold dilution of the sample was measured at excitation wavelength of 370 nm, and measurement wavelength 488 nm (the range 35). Obtained non-targeted type liposome or micelle was named as NSS25 or NSS26 respectively.

(159) (2) Decided Results by Using the Electron Microscope

(160) The particles were decided by using Low temperature and low vacuum scanning electron microscope (Hitachi High-technologies, Cat. No. S-3400N) whether it was the liposome or micelle. Observed particles were generally liposomes (vesicles). Segments were observed under the liquid nitrogen atmosphere.

(161) In the electron microscope, backscattered electron image of the incident electron beam was obtained as a BSE image, and secondary electron image was obtained as a SE image. Also, elemental analysis with X-ray was simultaneously conducted. BSE images were shown in FIGS. 12 (A) to (C). In low resolution images of SEM, the vesicle-like molecules were mainly observed. When the elemental analysis was conducted by using a portion of the sample, Si was detected in some particles (See, FIG. 12).

(Example 5) Dose-Dependent Stability Test of the Liposome (Vesicle) or the Micelle

(162) (1) Preparation of the Sample Micelle (the Micelle Having the Target Binding Site)

(163) 50 M50 L of the sample micelle was prepared as described below. As the basic micelle, non-targeted type micelles (NSS25 and NSS26) prepared in Example (X1) were respectively used at 16.1 M and 3 16 M. As the recognition site, 11.3 M of the targeted type of the micelle (Seq. Nos. 12 and 13 of the sequence listing) including the sequence of the MCF7 was used.

(164) The micelle solutions including respective liposomes or micelles were respectively placed in Amicon 10 K filters, and centrifuged at 14,000g for 15 minutes to separately collect the supernatants. Each of the micelle solution was diluted to 99 L of 1PBS, 1 M of 1 mM DTT was added and then stood at ambient for 10 minutes.

(165) Next, each of the liposome or micelle solution was treated with NICK column, and 3.21 L of TPS was added to the obtained treated solutions. Then, they were stood at 37 C. for overnight.

(166) (2) Confirmation of the Dose Dependency of the Liposome (Vesicle) or Micelle

(167) 380 L of the each solution obtained as described in (1) was placed in Amicon 100 K filter, and centrifuged at 14,000g for 10 minutes. Since about 350 L was dropped through the filter, it was used as the lower fluid, and about 30 L of the solution remained on the filter was used as the upper fluid.

(168) The upper fluid was kept as is, and then 100 L of 1PBS was added and then centrifuged at 14,000g for 10 minutes to recover about 100 L of the solution pass-through the filter. The operation was repeated for 3 times, and obtained solution was combined with the lower fluid. The combined solution was diluted 20-fold for measuring DLS (particle size distribution) as the same as that of the basic micelle.

(169) The filter containing the upper fluid was centrifuged by using the desk top centrifuge (Kubota corporation) for a couple of minutes to recover the upper fluid. Then, proper amount of 1PBS was added to the emptied filter and stood for 10 minutes. After that, the filter was inverted and centrifuged for a couple of minutes to recover the solution inside the filter. Then, the recovered solution was diluted with 1PBS to 60 L to set as a stock (1 x) of 50 M/50 L.

(170) The stock was diluted with 1PBS to 5-fold, 10-fold, and 50-fold, and stood 1 day at ambient for equilibration. After that, as the same as that of the basic micelle, the particle size and fluorescence were measured. It was shown that there is the possibility for stable existence of the micelle prepared not less than critical micelle concentration 1 month later.

(Example 6) Physical Property Evaluation of Structural Protein for the DDS Micelle

(171) (1) Purification of the Peptide

(172) In order to evaluate structural protein for the DDS micelle, the structural protein was purified according to the following procedures by using Ni NTA Super flow (Qiagen).

(173) (1-1) Elution of the Peptide from the Aggregatable Molecules

(174) Firstly, 50 L of the basic micelle (50 M/50 L) was taken and placed in a 50 mL Falcon tube (Falcon). The basic micelle was washed with 20 mM imidazole, and then 250 mM imidazole was added. They were reacted overnight in the rotary shaker for the elution of the peptide. The Falcon tube was set in the centrifuge (Kubota corporation), and centrifuges at 12,000 rpm for 10 minutes. The obtained supernatant was transferred to 15 mL Falcon tube.

(175) (1-2) Preparation of Ni NTA Resin Slurry

(176) During the centrifugation of the Falcon tube described above, Ni NTA resin (contained in Ni NTA Super flow) was prepared. Firstly, 2.5 mL of Ni NTA agarose was taken, and an antiseptic was removed. Next, the solution containing Ni NTA agarose gel was shaken well to mix homogenously, and then moved into a 15 mL Falcon tube.

(177) After that, the solution was centrifuged at 1,000 rpm by using the desktop centrifuge to precipitate the gel, and the supernatant was removed by using a pipette. Then, 1 mL of 1PBS was added, and then the tube was shaken and vortexed. The procedure was repeated 3 times, and after the third centrifugation, the supernatant was removed by using the pipette to prepare the slurry. It was stored except an amount to be used at 4 C.

(178) (1-3) Purification of Each Peptide

(179) 400 L of the slurry was dropped to the structure protein solution in the 15 mL Falcon tube, paying attention not so as to touch inside wall thereof. After that, the tube was set to the rotary shaker of which dial was set to maximal and shaken for 10 minutes for reacting.

(180) Next, the tube was taken out from the shaker, and centrifuged at 1,000 rom for 1 minute by using a centrifuge for animal cells (Taitec) to discard the supernatant. 4 mL of 1PBS was added to the pellet in the tube bottom, and then vortexed. The tube was centrifuged at 1,000 rpm for 1 minute. The procedure was repeated twice.

(181) 4 mL of 20 mM imidazole was added to the obtained pellet, and centrifuged at 1,000 rpm for 1 minute by using the centrifuge. The procedure was repeated twice. Next, 500 L of 250 mM imidazole was added to the obtained pellet, the tube was set to the rotary shaker of which dial was set to maximal and shaken for 10 minutes for reacting. Next, the tube was taken out from the shaker, and centrifuged at 1,000 rom for 1 minute by using a centrifuge for animal cells. Then, the supernatant was transferred to a fresh 15 mL Falcon tube.

(182) 250 mM of imidazole was again added to the pellet in the old tube, which was set to the rotary shaker of which dial was set to maximal and shaken for 5 minutes for reacting. Next, the tube was taken out from the shaker, and centrifuged at 1,000 rom for 1 minute by using a centrifuge for the animal cells. The supernatant was combined that already taken. The procedure was repeated 5 times.

(183) (1-4) Gel Electrophoresis

(184) Each peptide thus purified described above (GFP) was subjected to gel electrophoresis as follows.

(185) Firstly, about 10 L of the solutions containing 5 M of each peptide were prepared and placed in each tube with a lid. As the molecular weight marker, ladder, 10 L of Precision Protein Standards Prestained Broad Range (BioRad) was also added in to the 15 mL tube. Running gel (12%) having the composition shown in the following Table 13 and stacking gel (4%) having the composition shown in the following Table 14 were prepared.

(186) TABLE-US-00016 TABLE 13 Composition Amount 4 Running buffer 2.5 mL 40% acrylamide gel solution (containing 19:1 3.12 mL bis-acrylamide-acrylamide gel) 10% APS 50 L TEMED (Tetra methyl ethylen diamine) 50 L Distilled water balance Total 10 mL

(187) TABLE-US-00017 TABLE 14 Compositions Amount 4 Stacking buffer 1.25 mL 40% acrylamide gel solution (containing 19:1 0.5 mL bis-acrylamide-acrylamide gel) 10% APS 25 L TEMED (Tetra methyl ethylen diamine) 6 L Distilled water Remains Total amount 5 mL

(188) Each purified protein solution and the molecular weight marker were applied to the gel, and electrophoresed for 60 minutes at 200 V and 20 mA, and then further electrophoresed for 75 minutes. The phoresis buffer having the composition shown in the following Table 15 was used.

(189) TABLE-US-00018 TABLE 15 Compositions Amount 2.5 mM tris (2-amino-3-hydroxymethyl-13 propane diol) 3.03 g 192 mM glycine 14.4 g 01% SDS 1 g Distilled water balance Total Amount 1,000 mL

(190) Results were shown in the FIG. 19. From the results of the gel electrophoresis, it was shown that the targeted type 2 (MCF7-2) has a tight cage-like structure composed of the dendrimer so that it has high fluorescent intensity but low targeted property. It was also shown that the type 1 enhanced (MCF7-1+a stand) has loose cage-like structure so that it has high targeted property but low fluorescent intensity. As described above, it was shown that both of the tightness of the cage-like structure and the structure of the recognition site are important.

(Example 7) Inclusion Experiment of the Drug into the Liposome or Micelle for DDS

(191) As the drug included, Orange OT was employed. The solution containing 80 M GFP was used, and the micelle solution was prepared as the same procedure for the basic micelle preparation except 10.28 L of 7.78 mM TPS was added. Then, one L of Orange OT (8 mM Orange OT stock solution) was added so as to become 1:1 at molar ratio (final conc.) against GFP. Next, DiI 282 (400 M DiI 282 stock solution) was added so as to become 20:1 at molar ratio (final conc.) against GFP for overnight incorporation thereof at 37 C.

(192) Next, the upper fluid of the column was diluted with 1PBS to 1.2-fold of the volume interested, and then it was passed through PVDF filter (pore size was 0.45 m or 0.22 m). Other that these, the upper fluid was recovered by using the same procedure as those employed for the preparation of the basic micelle, and then it was subjected to the measurements for the particle size and fluorescent intensity.

(193) The upper fluid was treated as the same procedure employed for the preparation of the basic liposome or micelle, and then it was subjected to the measurements for the particle size and fluorescent intensity. It was considered that either of the drug, hydrophobic or hydrophilic, but optimization for the micelle formation conditions for respective cases was necessary.

(Example 8) Evaluation for Incorporating the Liposome or Micelle for DDS

(194) (1) Experimental Procedure

(195) Confluent MCF7 cells were peeled off by using 0.25% trypsin solution to prepare cell suspension (110.sup.9 cells/mL). Three mL of the cell suspension was plated into 5 collagen coat dishes (MatTek) or poly-d-lysine dish(MatTek).

(196) After the cells were attached onto the bottom surface of the well, the medium was removed by using the pipet. Proper amount of DMEM (+) was added to the wells, and washed 3 times not so as to release the attached cells.

(197) 450 L of DMEM (+) was added into each well of the collagen coat dishes for observation at 3 hours or 24 hours. Next, 50 L of 1PBS was added into the negative control wells. 50 of the sample 1 composed of 7.3 L of enhanced type 1 of the stock solution and 42.7 L of 1PBS was added into each well of 2 dishes. The sample 2 composed of 8.4 L of non-targeted type stock solution and 41.6 L of 1PBS was added into each wells of other 2 dishes.

(198) In the negative control wells of the poly-d-lysine dish, 50 L of 1PBS was added. Also, the sample 2 composed of 8.1 L of the non-targeted type (NSS26) stock solution and 41.9 L of 1PBS was added into one dish for the observation at 24 hours. Immediately after that, the plate was photographed, and then incubated at 37 C. in the presence of 5% CO.sub.2 for 3 hours or 24 hours. After terminating the incubation, 1 mL of DMEM (+) was added into the wells to wash the cells. The washing was repeated 3 times.

(199) (2) Observation Results by Using Confocal Microscope FV-100 (Olympus, FV 1000 D)

(200) DAPI was excited with a laser beam having 405 nm and observed the emission light of 460 nm to observe the dendrimer parts. Also, GFP parts were observed by using the emission light having 515 to 520 nm. Observation results were shown in FIGS. 20A to 20C. Compared to the results at 3 hours (FIG. 20C upper column) and these of 24 hours (FIG. 20C lower column), it seemed that the targeted micelles were properly incorporated into the targeted cells even in 24 hours (see, FIGS. 16 to 18).

(201) (3) Analysis Method

(202) As the analysis software, Image J was used. Fluorescent intensities in each area were expressed in numerical forms, and the fluorescent intensity ratio of the micelle and the protein was obtained. On the basis of the ratio, degradation of the micelle and remained fluorescent protein were confirmed.

(203) For the analysis software for FACS measurement, FlowJo was used. For the analysis, sole cell data was used and cell population having auto fluorescence was chosen. Also, the cell population having auto fluorescence was subtracted from all of the data. Results were shown in FIGS. 13 to 15. In the Figure, the numerical is the cell number after subtraction of that having auto fluorescence from that of the all of the cells measured/total cell number measured. The following Table 16 shows the determination results of five cell population having the auto fluorescence, and means thereof.

(204) TABLE-US-00019 TABLE 16 Incorporation into 151224 FACS data Mean of 5 times MCF7 Cell background 19.58 % % Hep G2 target type I 14.62 MCF7 target type I 15.21 Protein ()() Protein ()() Hep G2 target type I 12.69 MCF7 target type I 8.88 Protein (+)(+) Protein (+)(+) Hep G2 target type I 1132 MCF7 target type I 15.13 micelle ()() micelle ()() Hep G2 target type I 12.85 MCF7 target type I 13.41 micelle (+)(+) micelle (+)(+)

(205) As described above, it was shown that the targeted was occurred under the good cell condition, and long term contact of the micelle to the cell makes general endocytosis even for the non-targeted micelle and they were incorporated large amount. However, there is the possibility that the incorporation of the targeted micelle is rapidly incorporated in to the cells than the non-targeted ones. Also, the incorporated micelle may be destructed in the cells.

INDUSTRIAL APPLICABILITY

(206) The present invention is useful in the field of the pharmaceutical preparations, particularly in the field of drug delivery.

FREE TEXT FOR SEQUENCE LISTING

(207) Seq. No. 1: Target recognition sequence peptide (MCF7-1) incorporated into GFP

(208) Seq. No. 2: Target recognition sequence peptide (MCF7-2) incorporated into GFP

(209) Seq. No. 3: Target recognition sequence peptide (MCF7-1+ stand) incorporated into GFP

(210) Seq. No. 4: GFP incorporating MCF7-1

(211) Seq. No. 5: GFP incorporating MCF7-2

(212) Seq. No. 6: GFP incorporating MCF7-1+ stand

(213) Seq. No 7: amino acid sequence of GFP

(214) Seq. No 8: amino acid sequence of GFP

(215) Seq. No 9: amino acid sequence of BFP

(216) Seq. No. 10: amino acid sequence of YFP

(217) Seq. No. 11: amino acid sequence of the fluorescent protein derived from Discosoma

(218) Seq. No. 12: forward primer for MCF7-1 amplification

(219) Seq. No. 13: reverse primer for MCF7-1 amplification

(220) Seq. No. 14: forward primer for MCF7-2 amplification

(221) Seq. No. 15: reverse primer for MCF7-2 amplification

(222) Seq. No. 16: forward primer for MCF7-1+ stand amplification

(223) Seq. No. 17: reverse primer for MCF7-1+ stand amplification

(224) Seq. No. 18: forward primer for inverse PCR

(225) Seq. No. 19: reverse primer for inverse PCR

(226) Seq. No. 20: forward primer for inverse PCRcustom character

(227) Seq. No. 21: reverse primer for inverse PCRcustom character

(228) Seq. No. 22: oligonucleotide

(229) Seq. No. 23: oligonucleotide

(230) Seq. No. 24: oligonucleotide

(231) Seq. No. 25: oligonucleotide

(232) Seq. No. 26: forward primer for inverse PCR

(233) Seq. No. 27: reverse primer for inverse PCR

(234) Seq. No. 28: forward primer for inverse PCR

(235) Seq. No. 29: reverse primer for inverse PCR

(236) Seq. No. 30: forward primer for inverse PCR

(237) Seq. No. 31: reverse primer for inverse PCR

(238) Seq. No. 32: forward primer for inverse PCR

(239) Seq. No. 33: reverse primer for inverse PCR

(240) Seq. No. 34: forward primer for inverse PCR

(241) [Sequence listing]