Chimeric Endocytic Receptors and Method of Use Thereof

Abstract

The invention discloses chimeric endocytic receptor CER-based constructs for activating and regulating immune response, and method for using the same. The CER-based constructs are based on the structure of FcRI/ chain and incorporate high-affinity binding domain from receptors or antibodies shown to uptake specific antigen and present the antigen to T cells or B cells to initiate the antigen-specific immune response, Such design has the ability to transform native monocytes or T cells to CER-expressing monocytes (CER-M) or CER-expressing T cells (CER-T) in recognizing and uptake the target antigen and activate subsequent immune responses. Such engineered CER-M or CER-T can be used to treat tumor, viral diseases and autoimmune diseases directly. The endocytosis process with involvement of FcR- may enhance and coordinate T cell activation in combination with T cell activation by other types of constructs such as CAR.

Claims

1. An isolated chimeric endocytic antigen receptor (CER) peptide comprising: an engagement element, a hinge, a human Fc receptor transmembrane and cytoplasmic domain, a 2A self-cleaving peptide, and a Fc receptor gamma chain (FcR-).

2. The peptide of claim 1, wherein the engagement element is an antibody fragment with high affinity to a target antigen, or an extracellular domain of a receptor.

3. The peptide of claim 1, wherein the engagement element is an extracellular domain of a ligand, or a self-antigen.

4. The peptide of claim 1, wherein the hinge is chosen from the group consisting of IgG1 hinge (SEQ ID NO:1), IgG2 hinge (SEQ ID NO:2), IgG3 hinge (SEQ ID NO:3), and IgG4 hinge (SEQ ID NO:4).

5. The peptide of claim 1, wherein the Fc receptor is an immunoglobulin Fc receptor selected from FcRI (CD64), FcRIIA (CD32), FcRIIB (CD32), FcRIIIA (CD16a), and FcRIIIB (CD16b).

6. The peptide of claim 5, wherein the Fc receptor transmembrane and cytoplasmic domain comprises FcRI transmembrane domain (SEQ ID NO:5) and FcRI cytoplasmic domain (SEQ ID NO:6).

7. The peptide of claim 1, wherein the 2A self-cleaving peptide is at equimolar levels of multiple genes on the same mRNA, and is chosen from T2A (SEQ ID NO:7), P2A (SEQ ID NO:8), E2A (SEQ ID NO: 9), F2A (SEQ ID NO: 10).

8. The peptide of claim 1, wherein the Fc receptor is FcR-, comprising the amino acid sequence of SEQ ID NO:11.

9. The peptide of claim 1, where the CER peptide further comprises a costimulatory ligand selected from peptide comprising CD80 (SEQ ID NO:12.), CD86 (SEQ ID NO:13.), or CD40L (SEQ ID NO:14).

10. The peptide of claim 2, wherein the target antigen is virus associated antigens (VA) selected from virus associated antigens including HPV associated antigen E6/E7, HBV antigen HBs Ag/HBe Ag, EBV antigens EBNA1/LMP1/LMP2/EBER, CMV antigen pp65/pp150/pp52/, HIV antigen p24, RSV, influenza A and B viruses, parainfluenza viruses, adenoviruses, and coronavirus associated antigen S1/S2/N.

11. The peptide of claim 2, wherein the target antigen is TAA, selected from a group consisting of: (1) Antigens Encoded by Mutated Genes, such as mutated CDK4, CTNNB1, CASP8, P53, KRAS, NRAS, EGFR, EGFRvIII, BRCA1, BRCA2, PALB2, ATM, RAD51D, RECQL, CHEK2, c-MET, (2) Cancer-Germline Genes, such as melanoma-antigen encoding (MAGE), MAGEA/MAGEB/MAGEC, BAGE, GAGE, LAGE/NY-ESO1, SSX genes, (3) Differentiation Genes are derived from proteins that are expressed or overexpressed in a given type of tumor and the corresponding healthy tissue, such as tyrosinase, gp100/pmel117, Melan-A/MART-1, gp75/TRP1, TRP2, CEA, CLL1, CCL19, CCL21, CD1, CD1a, CD2, CD3, CD4, CD5, CD8, CD11A, CD14, CD15, CD16, CD18, CD19, CD20, CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD44, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66ae, CD67, CD70, CD70L, CD74, CD79a, CD79b, CD80, CD83, CD95, CD123, CD126, CD132, CD133, CD138, CD147, CD154, gp100, (4) Overexpressed Antigens contributing to tumor growth or metastasis, such as RAGE-1, PRAME, survivin, ERBB2 (HER2/NEU), protein Wilms tumor 1 (WT1), EpCAM, MUC1(CA15-3), MUC2, MUC3, MUC4, MUC6, MUC16, PMSA, Placental growth factor (PIGF), HIF-1, EGP-1 (TROP-2), EGP-2, surviving, epidermal glycoprotein 1 (EGP-1, TROP2), EGP-2, FLT3, G250, folate receptor, GAGE, gp100, HLA-DR, CD317(HM1.24), HMGB-1, (5) Embryonic antigen or fetal antigen or stem cell marker, such as CEA(CEACAM-5), CEACAM-6, AFP, OCT4, CD133, CD90, CD13, c-MET, CDC27, (6) Tumor metastasis associated chemokine receptor: such as CXCR2, CXCR4, CXCR7, CCR5, CCR7, CCR9, CCR10, CX3CR1 (Lazennec G et al., 2010), and (7) Immune suppressive checkpoint protein of PD-L1, VISTA, and Siglec-15.

12. The peptide of claim 3, wherein the ligand or the self-antigen is chosen from the group consisting of insulin, Glutamic Acid Decarboxylase (GAD), and insulinoma-associated protein 2 (IA2).

13. A method for using the peptide of claim 1, wherein a plasmid DNA, mRNA, lentiviral vector or retroviral vector encoding the CER sequence is used to transduce a human T cell or monocyte or macrophage or B cells or Natural Killer cells to express the CER to treat a cancer, a virus-infected disease or an autoimmune disease.

14. An engineered T cell expressing the peptide of claim 1, wherein the cell is selected for the presence of CD3+, CD8+, or CD4+ T markers.

15. An engineered human monocyte expressing the peptide of claim 1, wherein the cell is derived from a donor or an autologous monocyte.

16. The peptide of claim 1, further comprises a Chimeric Antigen Receptor (CAR).

17. The peptide of claim 16, wherein the chimeric antigen receptor (CAR) further comprises VH and VL portions of a scFv that targets a TAA, and a hinge of a CD8a hinge or IgG4 hinge, and an intracellular effectors consisting of one or more co-stimulatory signaling domains comprising CD28 intracellular domains (endodomain) or 4-1BB intracellular domain.

18. The peptide of claim 13, wherein the virus-infected disease is selected from the group consisting of a Coronavirus, a SARS-CoV, a SARS-CoV-2, a MERS, an Ebola, a Cytomegalovirus (CMV), an Epstein-Barr Virus (EBV), a Human Papilloma Virus (HPV), a Human T-Lymphotropic Virus (HTLV), a Cold virus, an Influenza, a Measles, a Mumps, a Rubella, a Polio, an Echo, a Coxsackie, a Hepatitis A, a Hepatitis B, a Hepatitis C, a Rotavirus, a Herpes 1 and 2, a Rabies, a Yellow fever, or a Dengue fever.

20. The peptide of claim 13, wherein the cancer is selected from the group consisting of a B-lineage acute lymphoblastic leukemia, a B-cell chronic lymphocytic leukemia and a B-cell non-Hodgkin's lymphoma, a lung cancer, a melanoma, a breast cancer, a prostate cancer, a colon cancer, a renal cell carcinoma, a ovarian cancer, a neuroblastoma, a rhabdomyosarcoma, a lymphoma, an acute lymphoblastic leukemia, a small cell lung carcinoma, a Hodgkin's lymphoma, a childhood acute lymphoblastic leukemia, a fibrosarcoma, a myxosarcoma, a liposarcoma, a chondrosarcoma, a osteogenic sarcoma, a chordoma, an angiosarcoma, an endotheliosarcoma, a lymphangiosarcoma, a lymphangioendotheliosarcoma, a synovioma, a mesothelioma, an Ewing's tumor, a leiomyosarcoma, a pancreatic cancer, a squamous cell carcinoma, a basal cell carcinoma, an adenocarcinoma, a sweat gland carcinoma, a sebaceous gland carcinoma, a papillary carcinoma, a papillary adenocarcinomas, a cystadenocarcinoma, a medullary carcinoma, a bronchogenic carcinoma, a hepatoma, a bile duct carcinoma, a choriocarcinoma, a seminoma, an embryonal carcinoma, a Wilms' tumor, a cervical cancer, a testicular tumor, a bladder carcinoma, an epithelial carcinoma, a glioma, an astrocytoma, a medulloblastoma, a craniopharyngioma, an ependymoma, a pinealoma, a hemangioblastoma, an acoustic neuroma, a oligodendroglioma, a meningioma, a retinoblastoma, an acute lymphocytic leukemia, an acute myelocytic leukemia, a chronic leukemia, a polycythemia vera, a lymphoma, a multiple myeloma, a Waldenstrom's macroglobulinemia, and a heavy chain disease.

20. The peptide of claim 13, wherein the autoimmune disease is selected from the group consisting of a type 1 diabetes, a rheumatoid arthritis, a systemic lupus erythematosus or an inflammatory bowel disease.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0042] FIGS. 1A, 1B, 1C, 1D, 1E and 1F are schematic illustrations showing CERs structural domains disposed in cell membranes: (A) a CER containing an antibody fragment (such as scFv), a human FcRI transmembrane and cytoplasmic domain, FcR -chain, (B) a CER containing an extracellular domain of a receptor, the human FcRI transmembrane and cytoplasmic domain, and the FcR -chain, (C) the CER of (A) with a costimulatory ligand, such as CD86 and/or CD40L, (D) the CER of (B) with a costimulatory ligand, such as CD86 and/or CD40L, (E) the CER of (A) with a chimeric antigen receptor (CAR); (F) the CER of (B) with a CAR.

[0043] FIGS. 2A, 2B, 2c, 2D, 2E, and 2F are schematic diagrams showing the structure of the CERs, presented in correspondence to the CERs in FIG. 1. (A) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain; (B) Receptor/ligand ED-Hinge-FcRI TM/ICD-2A-FcR -chain; (C) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-Costimulatory ligand; (D) Receptor/ligand ED-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-Costimulatory ligand; (E) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-TAA scFv-CD28/41BB-Z; (F) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-TAA scFv-CD28/41BB-Z. (TM: transmembrane; ICD: intracellular domain; ED: extracellular domain 2A: 2A self-cleaving peptide).

[0044] FIG. 3 is a series of flow cytometry profiles showing CER-T cells efficiently capture target antigens on the cell surface.

[0045] FIG. 4 is a Western blot showing CER-T cells efficiently uptake the target antigen from media into the cells. Lane (1), the HepG2 supernatant after incubation with Anti-AFP-CER-T cells for 12 h; lane (2), the Anti-AFP-CER-T cells after cultured in HepG2 supernatant for 12 h; lane (3), the HepG2 supernatant after incubation with Anti-AFP-CER-T cells for 24 h; lane (4), the Anti-AFP-CER-T cells after cultured in HepG2 supernatant for 24 h; lane (5), the HepG2 supernatant alone. The result indicated anti-AFP CER-T cells efficiently uptake AFP from the supernatant into the cells and degrade the AFP inside the cells. (AFP: alpha fetoprotein).

[0046] FIGS. 5A, 5B, 5C and 5D are cytotoxicity assays examined under fluorescent and B/W microscopes showing CER does not interfere with a CAR-T system's cytotoxicity against tumor cells. HepG2-anti-GPC3-CD28-Z CAR-T cells (C) or anti-AFP CER/anti-GPC3-CD28-Z CAR-T cells (D) were co-cultured with FFluc-GFP cells at E:T ratio=1:10, after 48 h co-culture, the cells were observed under the fluorescence microscope to examine the T cells cytotoxicity against tumors cells. The nontransduced T cells (control)(A) and anti-AFP-CER-T cells (B) were used as negative control. The result indicated anti-AFP CER/anti-GPC3-CD28-Z CAR-T cells could eradicate the HepG2 cells as efficiently as the anti-GPC3-CD28-Z CAR-T cells. Therefore, inclusion of anti-AFP CER design will not interrupt the cytotoxicity of anti-GPC3 CAR-T cells against the tumor cells.

[0047] FIG. 6 is a series of flow cytometry profiles showing that CER-constructs enhance the activation of CAR-T cells in killing target cells.

DETAILED DESCRIPTION

[0048] Combined with the composition of the test device and the assembly diagram, the working principle and measuring method of the testing device is described in detail in the following. Reference is made to the accompanying drawings in which like references indicates similar elements, and in which is shown by way of illustration, specific embodiments in which the invention may be practiced. These embodiments are described in sufficient detail to enable those skilled in the art to practice the invention. In other instances, well-known circuits, structures, and techniques have not been shown in detail in order not to obscure the understanding of this description. The following detailed description is, therefore, not to be taken in a limiting sense, and the scoop of the invention is defined only by the appended claims.

[0049] In one embodiment, a series of CER constructs were made using recombination DNA techniques. The schematic illustrations of the structure domains of these CER constructs are shown in FIGS. 1A, 1B, 1C, 1D, 1E and 1F. (A) shows a CER containing an antibody fragment (such as scFv), a human FcRI transmembrane and cytoplasmic domain, FcR -chain, (B) shows a CER containing an extracellular domain of a receptor, the human FcRI transmembrane and cytoplasmic domain, and the FcR -chain, (C) shows a CER of (A) with a costimulatory ligand, such as CD86 and/or CD40L, (D) The CER of (B) with a costimulatory ligand, such as CD86 and/or CD40L, (E) The CER of (A) with a chimeric antigen receptor (CAR); and (F) The CER of (B) with a CAR.

[0050] The antibody fragment (such as scFv) has high affinity to target antigen, which in turn allows specific targeting to target molecules in disease intervention. The extracellular domain of a receptor has high affinity to its ligand, which in turn allows specific targeting of target molecules in disease intervention. Although not shown, the CER constructs may contain a ligand domain instead of a receptor domain, thus targeting a specific receptor. The FcR -chain forms a homodimer that further associates with the portions of the endocytic receptor to propagate signaling required for T cell or B cell activation. The CERs constructs may also include costimulatory ligands, such as CD86 and/or CD40L, which provide additional stimulation signaling to T cells or B cells. The CERs may also include a chimeric antigen receptor (CAR), which direct the engineered T cells to tumor sites and display the cytotoxicity against tumor cells.

[0051] The structures of the CER constricts are further illustrated in FIGS. 2A-2F. (A) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain; (B) Receptor/ligand ED-Hinge-FcRI TM/ICD-2A-FcR -chain; (C) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-Costimulatory ligand; (D) Receptor/ligand ED-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-Costimulatory ligand; (E) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-TAA scFv-CD28/41BB-Z; (F) scFv-Hinge-FcRI TM/ICD-2A-FcR -chain-2A-TAA scFv-CD28/41BB-Z. (TM is an abbreviation for transmembrane; ICD is an abbreviation for intracellular domain; ED is an abbreviation for extracellular domain; 2A refers to a 2A self-cleaving peptide that direct cleavage of synthesized peptides. 2A is chosen from the group of T2A (SEQ ID NO: 7), P2A (SEQ ID NO: 8), E2A (SEQ ID NO: 9), and F2A (SEQ ID NO: 10); Hinge is chosen from the group of IgG1 Hinge (SEQ ID NO: 1), IgG2 Hinge (SEQ ID NO: 2), IgG3 Hinge (SEQ ID NO: 3), and IgG4 Hinge (SEQ ID NO: 4); FcRI TM refers to a fusion between FcRI transmembrane domain (SEQ ID NO: 5) and FcRI cytoplasmic domain (SEQ ID NO: 6); FcR- are used interchangeably with FcR common chain, FcR -chain or chain (SEQ ID NO: 11)

[0052] In the CER constructs, a antigen-binding domain from antibodies or a ligand-binding domain from receptors (such as scFv or ligand ED) is used as an engagement element to specifically bind to the antigens or the ligands, allowing specific interaction with target antigens or target ligands. In some embodiments, the engagement element can be an antigen or ligand, and targets for the interaction can be antibodies or receptors. The binding or interaction between the antibody-antigen or between the receptor-ligand has sufficient affinity and selectivity to allow specific binding under normal physiological conditions.

[0053] The hinge refers to (a) an immunoglobulin hinge sequence or a functional fragment or variant thereof, (b) a type II C-lectin interdomain (stalk) region or a functional fragment or variant thereof, or (c) a cluster of differentiation (CD) molecule stalk region or a functional variant thereof. As used herein, a wild type immunoglobulin hinge region refers to amino acid sequences interposed between and connecting the CH1 and CH2 domains (for IgG, IgA, and IgD) or interposed between and connecting the CH1 and CH3 domains (for IgE and IgM) found in the heavy chain of an antibody. In certain embodiments, a hinge region comprises a human IgG hinge region, which can be sequence IgG1 hinge (SEQ ID NO:1), IgG2 hinge (SEQ ID NO:2), IgG3 hinge (SEQ ID NO:3), and IgG4 hinge (SEQ ID NO:4).

[0054] In one embodiment, the ability of CERs to efficiently capture target antigens is demonstrated, as shown in FIG. 3.

[0055] The design of the experiment is as follows: CD19-1ST-CER-T cells were incubated with CD19+ Raji cells for 4 hours, then submitted to flow to detect whether the CER expressed cells could capture the target antigen CD19. The CD19-1ST-CER-T cells alone was used as negative control. The detection of CD19 on the STII (+) CD8+ T cells would indicate that the CER efficiently capture CD19 from Raji cells. An lentiviral construct encoding a chimeric endocytic receptor comprising anti-CD19-scFv (FMC63)-FcRI-2A- was designed, which is composed of Single-Chain Variable Fragment (scFv) derived from the anti-CD 19 specific monoclonal antibody FMC63, the Strep tag II (STII), the FcRI transmembrane and cytoplasmic domain, 2A, and the chain. The DNA encoding the design was cloned into the lentiviral vector (pLenti CMV GFP-puro) and the lentivirus were produced in 293T cells, using the package vectors (psPAX and pMD2G). The selected CD3+ T cells were stimulated by CD3/CD28 microbeads and infected by the lentivirus encoding CD19-scFv (FMC63)-STII-FcRI-2A-, and subsequently expanded in vitro for 12 days. The ability of the CER construct to capture the target antigen CD19 was examined in vitro by coculture with the Raji cells, a CD19+ Burkitt's lymphoma cells line at an effector:target ratio of 1:6. After 4 h of incubation, the cells were submitted to flow cytometry. The CER transduced T cells was quantified by the expression the cell surface marker of strep tag II. Compared to the controls with no Raji cells, CD19 was detected on the STII (+) CD8+ T cells, which indicates CD19 CER-T cells captured CD19 from Raji cells efficiently.

[0056] The target antigen can be a virus associated antigens (VA), which is selected from the any virus associated antigens, the exemplary virus antigen could be HPV associated antigen E6/E7, HBV antigen HBs Ag/HBe Ag, EBV antigens EBNA1/LMP1/LMP2/EBER, CMV antigen pp65/pp150/pp52/, HIV antigen p24, RSV, influenza A and B viruses, parainfluenza viruses, adenoviruses, coronavirus associated antigen S1/S2/N.

[0057] The target antigen can be a TAA, which is selected from the seven groups:

[0058] (1) Antigens Encoded by Mutated Genes, such as mutated CDK4, CTNNB1, CASP8, P53, KRAS, NRAS, EGFR, EGFRvIII, BRCA1, BRCA2, PALB2, ATM, RAD51D, RECQL, CHEK2, c-MET, or

[0059] (2) Cancer-Germline Genes, such as melanoma-antigen encoding (MAGE), MAGEA/MAGEB/MAGEC, BAGE, GAGE, LAGE/NY-ESO1, SSX genes, or

[0060] (3) Differentiation Genes derived from proteins that are expressed or overexpressed in a given type of tumor and the corresponding healthy tissue, such as tyrosinase, gp100/pmel17, Melan-A/MART-1, gp75/TRP1, TRP2, CEA, CLL1, CCL19, CCL21, CD1, CD1a, CD2, CD3, CD4, CD5, CD8, CD11A, CD14, CD15, CD16, CD18, CD19, CD20, CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD44, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66ae, CD67, CD70, CD70L, CD74, CD79a, CD79b, CD80, CD83, CD95, CD123, CD126, CD132, CD133, CD138, CD147, CD154, gp100, or

[0061] (4) Overexpressed Antigens contributing to tumor growth or metastasis, such as RAGE-1, PRAME, survivin, ERBB2 (HER2/NEU), protein Wilms tumor 1 (WT1), EpCAM, MUC1(CA15-3), MUC2, MUC3, MUC4, MUC6, MUC16, PMSA, Placental growth factor (PIGF), HIF-1, EGP-1 (TROP-2), EGP-2, surviving, epidermal glycoprotein 1 (EGP-1, TROP2), EGP-2, FLT3, G250, folate receptor, GAGE, gp100, HLA-DR, CD317(HM1.24), HMGB-1, or

[0062] (5) Embryonic antigen or fetal antigen or stem cell marker, such as CEA(CEACAM-5), CEACAM-6, AFP, OCT4, CD133, CD90, CD13, c-MET, CDC27, or

[0063] (6) Tumor metastasis associated chemokine receptor: such as CXCR2, CXCR4, CXCR7, CCR5, CCR7, CCR9, CCR10, CX3CR1 (Lazennec G et al., 2010), or

[0064] (7) Immune suppressive checkpoint: PD-L1, VISTA, Siglec-15.

[0065] In one embodiment, CER-T cells efficiently uptake a target antigen from the cell media and degrade the target antigen, as shown in FIG. 4.

[0066] An lentiviral construct encoding a chimeric endocytic receptor comprising anti-alpha fetoprotein-scFv-FcRI-2A- was designed, which is composed of Single-Chain Variable Fragment (scFv) derived from the anti-AFP specific monoclonal antibody Immu31 (Qu Z et al., 1999), the FcRI transmembrane and cytoplasmic domain, 2A, and chain. The selected CD3+ T cells were stimulated by CD3/CD28 microbeads and infected by the lentivirus encoding AFP-scFv (Immu31)-STII-FcRI-2A-, and were subsequently expand in vitro for 12 days. Its ability to capture the target alpha fetoprotein was examined in vitro by incubated the AFP CER-T cells with the supernatant derived from the HepG2 cells, which typically secrets AFP into the medium.

[0067] As shown in FIG. 4, Anti-AFP-CER-T cells were incubated with the HepG2 cells supernatant which contains AFP for 12 h and 24 h, the supernatant and the Anti-AFP-CER-T cells were submitted to western blotting to examine the AFP uptake by the CER-T cells. Lane (1), the HepG2 supernatant after incubation with Anti-AFP-CER-T cells for 12 h; lane (2), the Anti-AFP-CER-T cells after cultured in HepG2 supernatant for 12 h; lane (3), the HepG2 supernatant after incubation with Anti-AFP-CER-T cells for 24 h; lane (4), the Anti-AFP-CER-T cells after cultured in HepG2 supernatant for 24 h; lane (5), the HepG2 supernatant alone. Compared to lane 5, the AFP level decreased notably in 12 hours and disappeared in 24 hours in T cells expressing the AFP-specific CER constructs. The result indicated anti-AFP CER-T cells efficiently uptake AFP from the supernatant into the cells and degrade the AFP inside the cells. (AFP: alpha fetoprotein).

[0068] In one embodiment, CER does not interfere with a CAR-T system's cytotoxicity against tumor cells.

[0069] As shown in FIG. 5, a lentiviral construct encoding a chimeric endocytic receptor comprising anti-alpha fetoprotein-scFv-FcRI-T2A- was introduced with anti-GPC3 CAR elements, which includes an anti-GPC3 scFv (Nakano K Y T et al., 2007), IgG4 hinge, CD28 transmembrane and cytoplasmic domain fused CD3 zeta chain. The selected CD3+ T cells were stimulated by CD3/CD28 microbeads and infected by the lentivirus encoding AFP-scFv (Immu31)-STII-FcRI-T2A--T2A-GPC3-CD28Z, and subsequently expand in vitro for 12 days. To test whether inclusion of CER in the CAR-T design will interrupt the CAR-T cells' cytotoxicity against tumor cells, AFP CER/GPC3 CAR-T were co-cultured with the HepG2 cells transduced with EGFP, at E:T ratio=1:10. After 48 h co-culture, the cells were observed under the fluorescence microscope to examine the AFP CER/GPC3 CAR-T T cells cytotoxicity against HepG2-EGFP cells.

[0070] Comparison of (C), (D) versus (A), (B) showed the effective cytotoxic effect of the anti-GPC3 CAR system; comparison of (D) versus (C) showed that introduction of CER did not reduce or interrupt the cytotoxicity of the anti-GPC3 CAR system. Thus, the result indicated anti-AFP CER/anti-GPC3-CD28-Z CAR-T cells could eradicate the HepG2 cells as efficiently as the anti-GPC3-CD28-Z CAR-T cells. Therefore, inclusion of the anti-AFP CER design does not interrupt the cytotoxicity of CAR-T cells against the target cells.

[0071] In one embodiment, inclusion of a CER in a CAR design enhances the activation of CAR-T cells to kill the target cells.

[0072] As shown in FIG. 6, Anti-GPC3-CD28-Z CAR-T cells and anti-AFP CER/anti-GPC3-CD28-Z CAR-T cells were co-cultured with HepG2-FFluc-GFP cells at E:T ratio=1:5. After 48 h co-culture, the cells were submitted to flow cytometry with staining of CD45, CD8, CD4, CD25 and CD137 to examine the T cells activation and cytotoxicity against the tumors cells. The nontransduced T cells (control) were used as negative control. HepG2 cells are CD45 negative and readily distinguished from the CD45+ T cells. Both CD25 and CD137 have been reported to be up-regulated depending on the T-cell stimulus after stimulation, thus can serve indicator of T cell activation (Malek T R et al., 2004; Watts T H. 2005). The result indicated anti-AFP CER/anti-GPC3-CD28-Z CAR-T cells were able to efficiently eradicate HepG2 cells in the co-culture (comparing the three panels in the left column). Moreover, the anti-AFP CER/anti-GPC3-CD28-Z CAR-T cells have notably higher levels of CD25 and CD137 compared to the Anti-GPC3-CD28-Z CAR-T cells (comparing the bottom panel to middle panel in the two right columns in FIG. 6), indicating the inclusion of a CER into a CAR-T system enhances the activation the CAR-T cells. Therefore, inclusion of CER construct enhanced the activation and cytotoxicity of CAR-T cells against the tumor cells.

REFERENCE

[0073] Qu Z, Losman M J, Eliassen K C, Hansen H J, Goldenberg D M, Leung S O. Humanization of Immu31, an alpha-fetoprotein-specific antibody. Clin Cancer Res. 1999 October; 5(10 Suppl):3095s-3100s. [0074] Malek TR1, Bayer A L. Tolerance, not immunity, crucially depends on IL-2. Nat Rev Immunol. 2004 September; 4(9):665-74. [0075] Watts T H. TNF/TNFR family members in costimulation of T cell responses. Annu Rev Immunol. 2005; 23:23-68. Review. [0076] CAMBIER, J., 1995, ANTIGEN AND FC RECEPTOR SIGNALINGTHE AWESOME POWER OF THE IMMUNORECEPTOR TYROSINE-BASED ACTIVATION MOTIF (ITAM): Journal of Immunology, v. 155, p. 3281-3285. [0077] Duchemin, A., and C. Anderson, 1997, Association of non-receptor protein tyrosine kinases with the Fc gamma RI/gamma-chain complex in monocytic cells: Journal of Immunology, v. 158, p. 865-871. [0078] DURDEN, D., H. KIM, B. CALORE, and Y. LIU, 1995, THE FC-GAMMA-RI RECEPTOR SIGNALS THROUGH THE ACTIVATION OF HCK AND MAP KINASE: Journal of Immunology, v. 154, p. 4039-4047. [0079] Edberg, J., A. Yee, D. Rakshit, D. Chang, J. Gokhale, Z. Indik, A. Schreiber, and R. Kimberly, 1999, The cytoplasmic domain of human Fc gamma RIa alters the functional properties of the Fc gamma RI center dot gamma-chain receptor complex: Journal of Biological Chemistry, v. 274, p. 30328-30333. [0080] ERNST, L., A. DUCHEMIN, and C. ANDERSON, 1993, ASSOCIATION OF THE HIGH-AFFINITY RECEPTOR FOR IGG (FC-GAMMA-RI) WITH THE GAMMA-SUBUNIT OF THE IGE RECEPTOR: Proceedings of the National Academy of Sciences of the United States of America, v. 90, p. 6023-6027. [0081] Groh, V., R. Rhinehart, J. Randolph-Habecker, M. Topp, S. Riddell, and T. Spies, 2001, Costimulation of CD8 alpha beta T cells by NKG2D via engagement by MIC induced on virus-infected cells: Nature Immunology, v. 2, p. 255-260. [0082] Hauck, F., B. Blumenthal, S. Fuchs, C. Lenoir, E. Martin, C. Speckmann, T. Vraetz, W. Mannhardt-Laakmann, N. Lambert, M. Gil, S. Borte, M. Audrain, K. Schwarz, A. Lim, W. Schamel, A. Fischer, S. Ehl, A. Rensing-Ehl, C. Picard, and S. Latour, 2015, SYK expression endows human ZAP70-deficient CD8 T cells with residual TCR signaling: Clinical Immunology, v. 161, p. 103-109. [0083] Hulett, M., and P. Hogarth, 1998, The second and third extracellular domains of Fc gamma RI (CD64) confer the unique high affinity binding of IgG2a: Molecular Immunology, v. 35, p. 989-996. [0084] KIENER, P., B. RANKIN, A. BURKHARDT, G. SCHIEVEN, L. GILLILAND, R. ROWLEY, J. BOLEN, and J. LEDBETTER, 1993, CROSS-LINKING OF FC-GAMMA RECEPTOR-I (FC-GAMMA-RI) AND RECEPTOR-II (FC-GAMMA-RII) ON MONOCYTIC CELLS ACTIVATES A SIGNAL-TRANSDUCTION PATHWAY COMMON TO BOTH FC-RECEPTORS THAT INVOLVES THE STIMULATION OF P72 SYK PROTEIN-TYROSINE KINASE: Journal of Biological Chemistry, v. 268, p. 24442-24448. [0085] Nambiar, M., C. Fisher, A. Kumar, C. Tsokos, V. Warke, and G. Tsokos, 2003, Forced expression of the Fc receptor gamma-chain renders human T cells hyperresponsive to TCR/CD3 stimulation: Journal of Immunology, v. 170, p. 2871-2876. [0086] Nimmerjahn, F., and J. Ravetch, 2008, Fc gamma receptors as regulators of immune responses: Nature Reviews Immunology, v. 8, p. 34-47. [0087] Park, R., Y. Liu, and D. Durden, 1996, A role for Shc, Grb2, and Raf-1 in Fc gamma RI signal relay: Journal of Biological Chemistry, v. 271, p. 13342-13348. [0088] Radaev, S., S. Motyka, W. Fridman, C. Sautes-Fridman, and P. Sun, 2001, The structure of a human type III Fc gamma receptor in complex with Fc: Journal of Biological Chemistry, v. 276, p. 16469-16477. [0089] Ramsland, P., W. Farrugia, T. Bradford, C. Sardjono, S. Esparon, H. Trist, M. Powell, P. Tan, A. Cendron, B. Wines, A. Scott, and P. Hogarth, 2011, Structural Basis for Fc gamma RIIa Recognition of Human IgG and Formation of Inflammatory Signaling Complexes: Journal of Immunology, v. 187, p. 3208-3217. [0090] Sondermann, P., R. Huber, V. Oosthuizen, and U. Jacob, 2000, The 3.2-angstrom crystal structure of the human IgG1 Fc fragment-Fc gamma RIII complex: Nature, v. 406, p. 267-273. [0091] TAKAI, T., M. LI, D. SYLVESTRE, R. CLYNES, and J. RAVETCH, 1994, FCR GAMMA-CHAIN DELETION RESULTS IN PLEIOTROPIC EFFECTOR CELL DEFECTS: Cell, v. 76, p. 519-529. [0092] WANG, A., P. SCHOLL, and R. GEHA, 1994, PHYSICAL AND FUNCTIONAL ASSOCIATION OF THE HIGH-AFFINITY IMMUNOGLOBULIN-G RECEPTOR (FC-GAMMA-RI) WITH THE KINASES HCK AND LYN: Journal of Experimental Medicine, v. 180, p. 1165-1170.

TABLE-US-00001 SEQUENCELISTING SEQIDNO:1 IgG1Hinge EPKSCDKTHTCPPCP SEQIDNO:2 IgG2Hinge ERKCCVECPPCP SEQIDNO:3 IgG3Hinge EPKSCDTPPPCPPCP SEQIDNO:4 IgG4Hinge ESKYGPPCPSCP SEQIDNO:5 FcRItransmembranedomain LQVLGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTI SEQIDNO:6 FcRIcytoplasmicdomain RKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQE GVHRKEPQGAT SEQIDNO:7 T2A GSGEGRGSLLTCGDVEENPGP SEQIDNO:8 P2A GSGATNFSLLKQAGDVEENPGP SEQIDNO:9 E2A GSGQCTNYALLKLAGDVESNPGP SEQIDNO:10 F2A GSGVKQTLNFDLLKLAGDVESNPGP SEQIDNO:11 FcR- MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV RKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ SEQIDNO:12 CD80(T-IymphocyteactivationantigenCD80pre- cursor[Homosapiens].NP_005182 MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSC GHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS IVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDF EIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAV SSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAIT LISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQIDNO:13 CD86(T-IymphocyteactivationantigenCD86isoform 1precursor[Homosapiens].NP_787058 MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSL SELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNL QIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITEN VYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVS ISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWIT AVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK IHIPERSDEAQRVFKSSKTSSCDKSDTCF SEQIDNO:14 CD40L(CD40ligand,[Homosapiens].NP_000065 MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRL DKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIML NKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSN NLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGR FERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHG TGFTSFGLLKL