Method of screening compounds
10767212 ยท 2020-09-08
Assignee
Inventors
- Richard Cerione (Ithaca, NY)
- Jon W Erickson (Freeville, NY, US)
- Clint A Stalnecker (Chapel Hill, NC, US)
Cpc classification
G01N2500/04
PHYSICS
C12N9/80
CHEMISTRY; METALLURGY
International classification
C12N11/02
CHEMISTRY; METALLURGY
Abstract
The present technology relates to kidney-type glutaminase (GLS) proteins that have a phenylalanine to tryptophan substitution at the position corresponding to residue 322 of human glutaminase C (GAC), and methods of using such proteins to screen for compounds that bind to the activation loop of GLS and/or modulate glutaminase activity of GLS.
Claims
1. A method of screening for compounds that bind to the activation loop of kidney-type glutaminase (GLS) protein, said method comprising: contacting GLS protein, wherein the GLS protein comprises an activation loop and comprises a phenylalanine to tryptophan substitution at the residue corresponding to position 322 of SEQ ID NO: 2, with a test compound, wherein the test compound is a compound that potentially binds to the activation loop, to permit binding between the activation loop and the test compound; detecting fluorescence of the substituted tryptophan in the presence of the test compound; comparing the detected fluorescence to fluorescence of a control; and identifying, based on said comparing, that the test compound is a compound that binds to the activation loop of GLS, wherein a change in fluorescence relative to the control indicates that the test compound binds to the activation loop.
2. The method according to claim 1, wherein said contacting is carried out in vitro.
3. The method according to claim 1, wherein said contacting comprises incubating the protein with the test compound for ten to thirty minutes.
4. The method according to claim 1, wherein the test compound is selected from the group consisting of bis-thiadiazoles, small inorganic anions, and negatively-charged metabolites.
5. The method according to claim 1, wherein said comparing comprises: (a) calculating the binding affinity between the test compound and the protein from the detected fluorescence and (b) comparing the calculated binding affinity to that of the control.
6. The method according to claim 1, wherein the fluorescence of the control is the fluorescence of the substituted tryptophan in the absence of the test compound.
7. The method according to claim 1, wherein the control is a second kidney-type glutaminase (GLS) protein comprising a phenylalanine to tryptophan substitution at the residue corresponding to position 322 of SEQ ID NO: 2 and the fluorescence of the control is the fluorescence of the substituted tryptophan of the second GLS protein detected in the absence of the test compound.
8. The method according to claim 1 further comprising: contacting kidney-type glutaminase (GLS) protein with glutamine in the presence of the test compound under conditions effective for the protein, if active, to convert glutamine to glutamate; measuring production of glutamate, if any, following said contacting with glutamine; comparing the measured glutamate production to glutamate production of a second control; and further identifying, based on said comparing glutamate production, that the test compound is a modulator of glutaminase activity of GLS, wherein a change in glutamate production relative to the second control indicates that the test compound modulates glutaminase activity of GLS.
9. The method according to claim 1 further comprising identifying a compound that also modulates glutaminase activity of kidney-type glutaminase (GLS) protein, said further method comprising: selecting a test compound identified as being a compound that binds to the activation loop according to said identifying step; contacting GLS protein with glutamine in the presence of the selected test compound under conditions effective for the protein, if active, to convert glutamine to glutamate; measuring production of glutamate, if any, following said contacting with glutamine; comparing the measured glutamate production to glutamate production of a second control; and further identifying, based on said comparing glutamate production, that the selected test compound is also a modulator of glutaminase activity of GLS, wherein a change in glutamate production relative to the second control indicates that the selected test compound also modulates glutaminase activity of GLS.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
DETAILED DESCRIPTION OF THE INVENTION
(13) The present technology relates to mutant GLS proteins. In addition, the present invention relates to methods of using these proteins in methods of screening for compounds that bind to the activation loop of GLS and methods of identifying compounds that potentially modulate glutaminase activity of GLS. The present invention further relates to a screening kit for compounds that bind to the GLS activation loop and/or potentially modulate glutaminase activity of GLS.
(14) The first step in glutamine catabolism is catalysis by the mitochondrial enzyme glutaminase, with a specific isoform, glutaminase C (GAC), being highly expressed in cancer cells. GAC activation requires the formation of homotetramers, promoted by anionic allosteric activators such as inorganic phosphate. This leads to the proper orientation of a flexible loop proximal to the dimer-dimer interface that is essential for catalysis (i.e., the activation loop). A major class of allosteric inhibitors of GAC, with the prototype being bis-2-(5-phenylacetamido-1,2,4-thiadiazol-2-yl)ethyl sulfide (BPTES) and the related molecule CB-839, binds to the activation loop and induces the formation of an inactive tetramer (two inhibitors bound per active tetramer). Described herein is a direct readout for monitoring the dynamics of the activation loop of GAC in response to these allosteric inhibitors using mutant mouse GLS protein having a substitution of phenylalanine with tryptophan at position 327 (F327W), which corresponds to residue 322 of human GAC. The tryptophan fluorescence of the GAC.sub.F327W mutant undergoes a marked quenching upon the binding of BPTES or CB-839, yielding titration profiles that make it possible to measure the binding affinities of these inhibitors for the enzyme. Allosteric activators like phosphate induce the opposite effect (i.e., fluorescence enhancement). These results describe direct readouts for the binding of the BPTES class of allosteric inhibitors as well as for inorganic phosphate and related activators of GAC (and other GLS enzymes), which should facilitate screening for additional modulators of this important metabolic enzyme. Further, because the activation loop is conserved in GAC and KGA (and across taxa), it is expected that GAC can be subsituted with other GLS enzymes in these assays (e.g., substituting GAC with KGA, substituting mouse protein with human or rat protein, etc.). It is similarly expected that a compound's effect on GAC in these assays is predictive of the effect that compound would have on KGA, and vice versa.
(15) According to a first aspect, the present technology relates to a mutant GLS protein comprising a phenylalanine to tryptophan substitution at the residue corresponding to position 322 of human GAC.
(16) According to this and all aspects of the present technology, mutant GLS proteins include both GLS isoforms GAC and KGA. In at least one embodiment, the protein is from a human, mouse, or rat. The GLS isoforms GAC and KGA are splice variants of each other. Specifically, their C-terminal regions are unique (i.e., residues 550-603 of mouse GAC and residues 550-674 of mouse KGA). Likewise, human GAC and KGA proteins each have unique C-terminal regions (i.e., residues 545-598 of human GAC and residues 545-669 of human KGA). In each of the human, mouse, and rat GAC and KGA proteins, the activation loop (i.e., residues 311-322 of human GAC and human KGA, residues 316-327 of mouse GAC and KGA, and residues 316-327 of rat GAC and KGA) is conserved.
(17) The wild-type human GAC protein is set forth in GenBank Accession No. NP_001243239.1, which is hereby incorporated by reference in its entirety, and has the amino acid sequence of SEQ ID NO:2, as follows (the activation loop is underlined).
(18) TABLE-US-00001 MetMetArgLeuArgGlySerGlyMetLeuArgAspLeuLeuLeuArg 151015 SerProAlaGlyValSerAlaThrLeuArgArgAlaGlnProLeuVal 202530 ThrLeuCysArgArgProArgGlyGlyGlyArgProAlaAlaGlyPro 354045 AlaAlaAlaAlaArgLeuHisProTrpTrpGlyGlyGlyGlyTrpPro 505560 AlaGluProLeuAlaArgGlyLeuSerSerSerProSerGluIleLeu 65707580 GlnGluLeuGlyLysGlySerThrHisProGlnProGlyValSerPro 859095 ProAlaAlaProAlaAlaProGlyProLysAspGlyProGlyGluThr 100105110 AspAlaPheGlyAsnSerGluGlyLysGluLeuValAlaSerGlyGlu 115120125 AsnLysIleLysGlnGlyLeuLeuProSerLeuGluAspLeuLeuPhe 130135140 TyrThrIleAlaGluGlyGlnGluLysIleProValHisLysPheIle 145150155160 ThrAlaLeuLysSerThrGlyLeuArgThrSerAspProArgLeuLys 165170175 GluCysMetAspMetLeuArgLeuThrLeuGlnThrThrSerAspGly 180185190 ValMetLeuAspLysAspLeuPheLysLysCysValGlnSerAsnIle 195200205 ValLeuLeuThrGlnAlaPheArgArgLysPheValIleProAspPhe 210215220 MetSerPheThrSerHisIleAspGluLeuTyrGluSerAlaLysLys 225230235240 GlnSerGlyGlyLysValAlaAspTyrIleProGlnLeuAlaLysPhe 245250255 SerProAspLeuTrpGlyValSerValCysThrValAspGlyGlnArg 260265270 HisSerThrGlyAspThrLysValProPheCysLeuGlnSerCysVal 275280285 LysProLeuLysTyrAlaIleAlaValAsnAspLeuGlyThrGluTyr 290295300 ValHisArgTyrValGlyLysGluProSerGlyLeuArqPheAsnLys 305310315320 LeuPheLeuAsnGluAspAspLysProHisAsnProMetValAsnAla 325330335 GlyAlaIleValValThrSerLeuIleLysGlnGlyValAsnAsnAla 340345350 GluLysPheAspTyrValMetGlnPheLeuAsnLysMetAlaGlyAsn 355360365 GluTyrValGlyPheSerAsnAlaThrPheGlnSerGluArgGluSer 370375380 GlyAspArgAsnPheAlaIleGlyTyrTyrLeuLysGluLysLysCys 385390395400 PheProGluGlyThrAspMetValGlyIleLeuAspPheTyrPheGln 405410415 LeuCysSerIleGluValThrCysGluSerAlaSerValMetAlaAla 420425430 ThrLeuAlaAsnGlyGlyPheCysProIleThrGlyGluArgValLeu 435440445 SerProGluAlaValArgAsnThrLeuSerLeuMetHisSerCysGly 450455460 MetTyrAspPheSerGlyGlnPheAlaPheHisValGlyLeuProAla 465470475480 LysSerGlyValAlaGlyGlyIleLeuLeuValValProAsnValMet 485490495 GlyMetMetCysTrpSerProProLeuAspLysMetGlyAsnSerVal 500505510 LysGlyIleHisPheCysHisAspLeuValSerLeuCysAsnPheHis 515520525 AsnTyrAspAsnLeuArgHisPheAlaLysLysLeuAspProArgArg 530535540 GluGlyGlyAspGlnArgHisSerPheGlyProLeuAspTyrGluSer 545550555560 LeuGlnGlnGluLeuAlaLeuLysGluThrValTrpLysLysValSer 565570575 ProGluSerAsnGluAspIleSerThrThrValValTyrArgMetGlu 580585590 SerLeuGlyGluLysSer 595
(19) The cDNA sequence encoding the above wild-type human GAC protein is set forth in GenBank Accession No. NM_014905.4, which is hereby incorporated by reference in its entirety.
(20) The wild-type mouse GAC protein is set forth in GenBank Accession No. NP_001106854.1, which is hereby incorporated by reference in its entirety, and has the amino acid sequence of SEQ ID NO:3, as follows (the activation loop is underlined).
(21) TABLE-US-00002 MetMetArgLeuArgGlySerAlaMetLeuArgGluLeuLeuLeuArg 151015 ProProAlaAlaValGlyAlaValLeuArgArgAlaGlnProLeuGly 202530 ThrLeuCysArgArgProArgGlyGlySerArgProThrAlaGlyLeu 354045 ValAlaAlaAlaArgLeuHisProTrpTrpGlyGlyGlyGlyArgAla 505560 LysGlyProGlyAlaGlyGlyLeuSerSerSerProSerGluIleLeu 65707580 GlnGluLeuGlyLysGlyGlyThrProProGlnGlnGlnGlnGlnGln 859095 GlnGlnGlnProGlyAlaSerProProAlaAlaProGlyProLysAsp 100105110 SerProGlyGluThrAspAlaPheGlyAsnSerGluGlyLysGluMet 115120125 ValAlaAlaGlyAspAsnLysIleLysGlnGlyLeuLeuProSerLeu 130135140 GluAspLeuLeuPheTyrThrIleAlaGluGlyGlnGluLysIlePro 145150155160 ValHisLysPheIleThrAlaLeuLysSerThrGlyLeuArgThrSer 165170175 AspProArgLeuLysGluCysMetAspMetLeuArgLeuThrLeuGln 180185190 ThrThrSerAspGlyValMetLeuAspLysAspLeuPheLysLysCys 195200205 ValGlnSerAsnIleValLeuLeuThrGlnAlaPheArgArgLysPhe 210215220 ValIleProAspPheMetSerPheThrSerHisIleAspGluLeuTyr 225230235240 GluSerAlaLysLysGlnSerGlyGlyLysValAlaAspTyrIlePro 245250255 GlnLeuAlaLysPheSerProAspLeuTrpGlyValSerValCysThr 260265270 ValAspGlyGlnArgHisSerIleGlyAspThrLysValProPheCys 275280285 LeuGlnSerCysValLysProLeuLysTyrAlaIleAlaValAsnAsp 290295300 LeuGlyThrGluTyrValHisArgTyrValGlyLysGluProSerGly 305310315320 LeuArgPheAsnLysLeuPheLeuAsnGluAspAspLysProHisAsn 325330335 ProMetValAsnAlaGlyAlaIleValValThrSerLeuIleLysGln 340345350 GlyValAsnAsnAlaGluLysPheAspTyrValMetGlnPheLeuAsn 355360365 LysMetAlaGlyAsnGluTyrValGlyPheSerAsnAlaThrPheGln 370375380 SerGluArgGluSerGlyAspArgAsnPheAlaIleGlyTyrTyrLeu 385390395400 LysGluLysLysCysPheProGluGlyThrAspMetValGlyIleLeu 405410415 AspPheTyrPheGlnLeuCysSerIleGluValThrCysGluSerAla 420425430 SerValMetAlaAlaThrLeuAlaAsnGlyGlyPheCysProIleThr 435440445 GlyGluArgValLeuSerProGluAlaValArgAsnThrLeuSerLeu 450455460 MetHisSerCysGlyMetTyrAspPheSerGlyGlnPheAlaPheHis 465470475480 ValGlyLeuProAlaLysSerGlyValAlaGlyGlyIleLeuLeuVal 485490495 ValProAsnValMetGlyMetMetCysTrpSerProProLeuAspLys 500505510 MetGlyAsnSerValLysGlyIleHisPheCysHisAspLeuValSer 515520525 LeuCysAsnPheHisAsnTyrAspAsnLeuArgHisPheAlaLysLys 530535540 LeuAspProArgArgGluGlyGlyAspGlnArgHisSerPheGlyPro 545550555560 LeuAspTyrGluSerLeuGlnGlnGluLeuAlaLeuLysAspThrVal 565570575 TrpLysLysValSerProGluSerSerAspAspThrSerThrThrVal 580585590 ValTyrArgMetGluSerLeuGlyGluArgSer 595600
(22) The cDNA sequence encoding the above wild-type mouse GAC protein is set forth in GenBank Accession No. NM_001113383.1, which is hereby incorporated by reference in its entirety.
(23) The wild-type rat GAC protein is set forth in GenBank Accession No. NP_001103438.1, which is hereby incorporated by reference in its entirety, and has the amino acid sequence of SEQ ID NO:4, as follows (the activation loop is underlined).
(24) TABLE-US-00003 MetMetArgLeuArgGlySerAlaMetLeuArgGluLeuLeuLeuArg 151015 ProProAlaAlaValGlyGlyValLeuArgArgAlaGlnProLeuGly 202530 ThrLeuCysArgArgProArgGlyGlySerArgProAlaAlaGlyLeu 354045 ValAlaAlaAlaArgLeuHisProTrpTrpGlyGlyGlyGlyArgAla 505560 LysGlyProGlySerGlyGlyLeuSerSerSerProSerGluIleLeu 65707580 GlnGluLeuGlyLysGlyGlyThrProProGlnGlnGlnGlnGlnGln 859095 GlnGlnGlnProGlyAlaSerProProAlaAlaProGlyProLysAsp 100105110 SerProGlyGluThrAspAlaPheGlyAsnSerGluGlyLysGluMet 115120125 ValAlaAlaGlyAspAsnLysValLysGlnGlyLeuLeuProSerLeu 130135140 GluAspLeuLeuPheTyrThrIleAlaGluGlyGlnGluLysIlePro 145150155160 ValHisLysPheIleThrAlaLeuLysSerThrGlyLeuArgThrSer 165170175 AspProArgLeuLysGluCysMetAspMetLeuArgLeuThrLeuGln 180185190 ThrThrSerAspGlyValMetLeuAspLysAspLeuPheLysLysCys 195200205 ValGlnSerAsnIleValLeuLeuThrGlnAlaPheArgArgLysPhe 210215220 ValIleProAspPheMetSerPheThrSerHisIleAspGluLeuTyr 225230235240 GluSerAlaLysLysGlnSerGlyGlyLysValAlaAspTyrIlePro 245250255 GlnLeuAlaLysPheSerProAspLeuTrpGlyValSerValCysThr 260265270 ValAspGlyGlnArgHisSerIleGlyAspThrLysValProPheCys 275280285 LeuGlnSerCysValLysProLeuLysTyrAlaIleAlaValAsnAsp 290295300 LeuGlyThrGluTyrValHisArgTyrValGlyLysGluProSerGly 305310315320 LeuArgPheAsnLysLeuPheLeuAsnGluAspAspLysProHisAsn 325330335 ProMetValAsnAlaGlyAlaIleValValThrSerLeuIleLysGln 340345350 GlyValAsnAsnAlaGluLysPheAspTyrValMetGlnPheLeuAsn 355360365 LysMetAlaGlyAsnGluTyrValGlyPheSerAsnAlaThrPheGln 370375380 SerGluArgGluSerGlyAspArgAsnPheAlaIleGlyTyrTyrLeu 385390395400 LysGluLysLysCysPheProGluGlyThrAspMetValGlyIleLeu 405410415 AspPheTyrPheGlnLeuCysSerIleGluValThrCysGluSerAla 420425430 SerValMetAlaAlaThrLeuAlaAsnGlyGlyPheCysProIleThr 435440445 GlyGluArgValLeuSerProGluAlaValArgAsnThrLeuSerLeu 450455460 MetHisSerCysGlyMetTyrAspPheSerGlyGlnPheAlaPheHis 465470475480 ValGlyLeuProAlaLysSerGlyValAlaGlyGlyIleLeuLeuVal 485490495 ValProAsnValMetGlyMetMetCysTrpSerProProLeuAspLys 500505510 MetGlyAsnSerValLysGlyIleHisPheCysHisAspLeuValSer 515520525 LeuCysAsnPheHisAsnTyrAspAsnLeuArgHisPheAlaLysLys 530535540 LeuAspProArgArgGluGlyGlyAspGlnArgHisSerPheGlyPro 545550555560 LeuAspTyrGluSerLeuGlnGlnGluLeuAlaLeuLysAspThrVal 565570575 TrpLysLysValSerProGluSerSerAspAspThrSerThrThrIle 580585590 ValTyrArgMetGluSerLeuGlyGluArgSer 595600
(25) The cDNA sequence encoding the above wild-type rat GAC protein is set forth in GenBank Accession No. NM_001109968.1, which is hereby incorporated by reference in its entirety.
(26) The wild-type human KGA protein is set forth in GenBank Accession No. NP_055720.3, which is hereby incorporated by reference in its entirety, and has the amino acid sequence of SEQ ID NO:5, as follows (the activation loop is underlined).
(27) TABLE-US-00004 MetMetArgLeuArgGlySerGlyMetLeuArgAspLeuLeuLeuArg 151015 SerProAlaGlyValSerAlaThrLeuArgArgAlaGlnProLeuVal 202530 ThrLeuCysArgArgProArgGlyGlyGlyArgProAlaAlaGlyPro 354045 AlaAlaAlaAlaArgLeuHisProTrpTrpGlyGlyGlyGlyTrpPro 505560 AlaGluProLeuAlaArgGlyLeuSerSerSerProSerGluIleLeu 65707580 GlnGluLeuGlyLysGlySerThrHisProGlnProGlyValSerPro 859095 ProAlaAlaProAlaAlaProGlyProLysAspGlyProGlyGluThr 100105110 AspAlaPheGlyAsnSerGluGlyLysGluLeuValAlaSerGlyGlu 115120125 AsnLysIleLysGlnGlyLeuLeuProSerLeuGluAspLeuLeuPhe 130135140 TyrThrIleAlaGluGlyGlnGluLysIleProValHisLysPheIle 145150155160 ThrAlaLeuLysSerThrGlyLeuArgThrSerAspProArgLeuLys 165170175 GluCysMetAspMetLeuArgLeuThrLeuGlnThrThrSerAspGly 180185190 ValMetLeuAspLysAspLeuPheLysLysCysValGlnSerAsnIle 195200205 ValLeuLeuThrGlnAlaPheArgArgLysPheValIleProAspPhe 210215220 MetSerPheThrSerHisIleAspGluLeuTyrGluSerAlaLysLys 225230235240 GlnSerGlyGlyLysValAlaAspTyrIleProGlnLeuAlaLysPhe 245250255 SerProAspLeuTrpGlyValSerValCysThrValAspGlyGlnArg 260265270 HisSerThrGlyAspThrLysValProPheCysLeuGlnSerCysVal 275280285 LysProLeuLysTyrAlaIleAlaValAsnAspLeuGlyThrGluTyr 290295300 ValHisArgTyrValGlyLysGluProSerGlyLeuArgPheAsnLys 305310315320 LeuPheLeuAsnGluAspAspLysProHisAsnProMetValAsnAla 325330335 GlyAlaIleValValThrSerLeuIleLysGlnGlyValAsnAsnAla 340345350 GluLysPheAspTyrValMetGlnPheLeuAsnLysMetAlaGlyAsn 355360365 GluTyrValGlyPheSerAsnAlaThrPheGlnSerGluArgGluSer 370375380 GlyAspArgAsnPheAlaIleGlyTyrTyrLeuLysGluLysLysCys 385390395400 PheProGluGlyThrAspMetValGlyIleLeuAspPheTyrPheGln 405410415 LeuCysSerIleGluValThrCysGluSerAlaSerValMetAlaAla 420425430 ThrLeuAlaAsnGlyGlyPheCysProIleThrGlyGluArgValLeu 435440445 SerProGluAlaValArgAsnThrLeuSerLeuMetHisSerCysGly 450455460 MetTyrAspPheSerGlyGlnPheAlaPheHisValGlyLeuProAla 465470475480 LysSerGlyValAlaGlyGlyIleLeuLeuValValProAsnValMet 485490495 GlyMetMetCysTrpSerProProLeuAspLysMetGlyAsnSerVal 500505510 LysGlyIleHisPheCysHisAspLeuValSerLeuCysAsnPheHis 515520525 AsnTyrAspAsnLeuArgHisPheAlaLysLysLeuAspProArgArg 530535540 GluGlyGlyAspGlnArgValLysSerValIleAsnLeuLeuPheAla 545550555560 AlaTyrThrGlyAspValSerAlaLeuArgArgPheAlaLeuSerAla 565570575 MetAspMetGluGlnArgAspTyrAspSerArgThrAlaLeuHisVal 580585590 AlaAlaAlaGluGlyHisValGluValValLysPheLeuLeuGluAla 595600605 CysLysValAsnProPheProLysAspArgTrpAsnAsnThrProMet 610615620 AspGluAlaLeuHisPheGlyHisHisAspValPheLysIleLeuGln 625630635640 GluTyrGlnValGlnTyrThrProGlnGlyAspSerAspAsnGlyLys 645650655 GluAsnGlnThrValHisLysAsnLeuAspGlyLeuLeu 660665
(28) The cDNA sequence encoding the above wild-type human KGA protein is set forth in GenBank Accession No. NM_001256310.1, which is hereby incorporated by reference in its entirety.
(29) The wild-type mouse KGA protein is set forth in GenBank Accession No. NP_001074550.1, which is hereby incorporated by reference in its entirety, and has the amino acid sequence of SEQ ID NO:6, as follows (the activation loop is underlined).
(30) TABLE-US-00005 MetMetArgLeuArgGlySerAlaMetLeuArgGluLeuLeuLeuArg 151015 ProProAlaAlaValGlyAlaValLeuArgArgAlaGlnProLeuGly 202530 ThrLeuCysArgArgProArgGlyGlySerArgProThrAlaGlyLeu 354045 ValAlaAlaAlaArgLeuHisProTrpTrpGlyGlyGlyGlyArgAla 505560 LysGlyProGlyAlaGlyGlyLeuSerSerSerProSerGluIleLeu 65707580 GlnGluLeuGlyLysGlyGlyThrProProGlnGlnGlnGlnGlnGln 859095 GlnGlnGlnProGlyAlaSerProProAlaAlaProGlyProLysAsp 100105110 SerProGlyGluThrAspAlaPheGlyAsnSerGluGlyLysGluMet 115120125 ValAlaAlaGlyAspAsnLysIleLysGlnGlyLeuLeuProSerLeu 130135140 GluAspLeuLeuPheTyrThrIleAlaGluGlyGlnGluLysIlePro 145150155160 ValHisLysPheIleThrAlaLeuLysSerThrGlyLeuArgThrSer 165170175 AspProArgLeuLysGluCysMetAspMetLeuArgLeuThrLeuGln 180185190 ThrThrSerAspGlyValMetLeuAspLysAspLeuPheLysLysCys 195200205 ValGlnSerAsnIleValLeuLeuThrGlnAlaPheArgArgLysPhe 210215220 ValIleProAspPheMetSerPheThrSerHisIleAspGluLeuTyr 225230235240 GluSerAlaLysLysGlnSerGlyGlyLysValAlaAspTyrIlePro 245250255 GlnLeuAlaLysPheSerProAspLeuTrpGlyValSerValCysThr 260265270 ValAspGlyGlnArgHisSerIleGlyAspThrLysValProPheCys 275280285 LeuGlnSerCysValLysProLeuLysTyrAlaIleAlaValAsnAsp 290295300 LeuGlyThrGluTyrValHisArgTyrValGlyLysGluProSerGly 305310315320 LeuArgPheAsnLysLeuPheLeuAsnGluAspAspLysProHisAsn 325330335 ProMetValAsnAlaGlyAlaIleValValThrSerLeuIleLysGln 340345350 GlyValAsnAsnAlaGluLysPheAspTyrValMetGlnPheLeuAsn 355360365 LysMetAlaGlyAsnGluTyrValGlyPheSerAsnAlaThrPheGln 370375380 SerGluArgGluSerGlyAspArgAsnPheAlaIleGlyTyrTyrLeu 385390395400 LysGluLysLysCysPheProGluGlyThrAspMetValGlyIleLeu 405410415 AspPheTyrPheGlnLeuCysSerIleGluValThrCysGluSerAla 420425430 SerValMetAlaAlaThrLeuAlaAsnGlyGlyPheCysProIleThr 435440445 GlyGluArgValLeuSerProGluAlaValArgAsnThrLeuSerLeu 450455460 MetHisSerCysGlyMetTyrAspPheSerGlyGlnPheAlaPheHis 465470475480 ValGlyLeuProAlaLysSerGlyValAlaGlyGlyIleLeuLeuVal 485490495 ValProAsnValMetGlyMetMetCysTrpSerProProLeuAspLys 500505510 MetGlyAsnSerValLysGlyIleHisPheCysHisAspLeuValSer 515520525 LeuCysAsnPheHisAsnTyrAspAsnLeuArgHisPheAlaLysLys 530535540 LeuAspProArgArgGluGlyGlyAspGlnArgValLysSerValIle 545550555560 AsnLeuLeuPheAlaAlaTyrThrGlyAspValSerAlaLeuArgArg 565570575 PheAlaLeuSerAlaMetAspMetGluGlnArgAspTyrAspSerArg 580585590 ThrAlaLeuHisValAlaAlaAlaGluGlyHisValGluValValLys 595600605 PheLeuLeuGluAlaCysLysValAsnProPheProLysAspArgTrp 610615620 AsnAsnThrProMetAspGluAlaLeuHisPheGlyHisHisAspVal 625630635640 PheLysIleLeuGlnGluTyrGlnValGlnTyrThrProGlnGlyAsp 645650655 SerAspAspGlyLysGlyAsnGlnThrValHisLysAsnLeuAspGly 660665670 LeuLeu
(31) The cDNA sequence encoding the above wild-type mouse KGA protein is set forth in GenBank Accession No. NM_001081081.2, which is hereby incorporated by reference in its entirety.
(32) The wild-type rat KGA protein is set forth in GenBank Accession No. NP_036701.2, which is hereby incorporated by reference in its entirety, and has the amino acid sequence of SEQ ID NO:7, as follows (the activation loop is underlined).
(33) TABLE-US-00006 MetMetArgLeuArgGlySerAlaMetLeuArgGluLeuLeuLeuArg 151015 ProProAlaAlaValGlyGlyValLeuArgArgAlaGlnProLeuGly 202530 ThrLeuCysArgArgProArgGlyGlySerArgProAlaAlaGlyLeu 354045 ValAlaAlaAlaArgLeuHisProTrpTrpGlyGlyGlyGlyArgAla 505560 LysGlyProGlySerGlyGlyLeuSerSerSerProSerGluIleLeu 65707580 GlnGluLeuGlyLysGlyGlyThrProProGlnGlnGlnGlnGlnGln 859095 GlnGlnGlnProGlyAlaSerProProAlaAlaProGlyProLysAsp 100105110 SerProGlyGluThrAspAlaPheGlyAsnSerGluGlyLysGluMet 115120125 ValAlaAlaGlyAspAsnLysValLysGlnGlyLeuLeuProSerLeu 130135140 GluAspLeuLeuPheTyrThrIleAlaGluGlyGlnGluLysIlePro 145150155160 ValHisLysPheIleThrAlaLeuLysSerThrGlyLeuArgThrSer 165170175 AspProArgLeuLysGluCysMetAspMetLeuArgLeuThrLeuGln 180185190 ThrThrSerAspGlyValMetLeuAspLysAspLeuPheLysLysCys 195200205 ValGlnSerAsnIleValLeuLeuThrGlnAlaPheArgArgLysPhe 210215220 ValIleProAspPheMetSerPheThrSerHisIleAspGluLeuTyr 225230235240 GluSerAlaLysLysGlnSerGlyGlyLysVAlalaAspTyrIlePro 245250255 GlnLeuAlaLysPheSerProAspLeuTrpGlyValSerValCysThr 260265270 ValAspGlyGlnArgHisSerIleGlyAspThrLysValProPheCys 275280285 LeuGlnSerCysValLysProLeuLysTyrAlaIleAlaValAsnAsp 290295300 LeuGlyThrGluTyrValHisArgTyrValGlyLysGluProSerGly 305310315320 LeuArgPheAsnLysLeuPheLeuAsnGluAspAspLysProHisAsn 325330335 ProMetValAsnAlaGlyAlaIleValValThrSerLeuIleLysGln 340345350 GlyValAsnAsnAlaGluLysPheAspTyrValMetGlnPheLeuAsn 355360365 LysMetAlaGlyAsnGluTyrValGlyPheSerAsnAlaThrPheGln 370375380 SerGluArgGluSerGlyAspArgAsnPheAlaIleGlyTyrTyrLeu 385390395400 LysGluLysLysCysPheProGluGlyThrAspMetValGlyIleLeu 405410415 AspPheTyrPheGlnLeuCysSerIleGluValThrCysGluSerAla 420425430 SerValMetAlaAlaThrLeuAlaAsnGlyGlyPheCysProIleThr 435440445 GlyGluArgValLeuSerProGluAlaValArgAsnThrLeuSerLeu 450455460 MetHisSerCysGlyMetTyrAspPheSerGlyGlnPheAlaPheHis 465470475480 ValGlyLeuProAlaLysSerGlyVAlalaGlyGlyIleLeuLeuVal 485490495 ValProAsnValMetGlyMetMetCysTrpSerProProLeuAspLys 500505510 MetGlyAsnSerValLysGlyIleHisPheCysHisAspLeuValSer 515520525 LeuCysAsnPheHisAsnTyrAspAsnLeuArgHisPheAlaLysLys 530535540 LeuAspProArgArgGluGlyGlyAspGlnArgValLysSerValIle 545550555560 AsnLeuLeuPheAlaAlaTyrThrGlyAspValSerAlaLeuArgArg 565570575 PheAlaLeuSerAlaMetAspMetGluGlnArgAspTyrAspSerArg 580585590 ThrAlaLeuHisValAlaAlaAlaGluGlyHisValGluValValLys 595600605 PheLeuLeuGluAlaCysLysValAsnProPheProLysAspArgTrp 610615620 AsnAsnThrProMetAspGluAlaLeuHisPheGlyHisHisAspVal 625630635640 PheLysIleLeuGlnGluTyrGlnValGlnTyrThrProGlnGlyAsp 645650655 SerAspAspGlyLysGluAsnGlnThrValHisLysAsnLeuAspGly 660665670 LeuLeu
(34) The cDNA sequence encoding the above wild-type rat KGA protein is set forth in GenBank Accession No. NM_012569.2, which is hereby incorporated by reference in its entirety.
(35) Mutant 0GLS proteins according to the present technology have a phenylaline to tryptophan substitution at the position corresponding to residue 322 of human GAC. This includes, for example, human GAC proteins containing a phenylalanine to tryptophan substitution at position 322 (F322W), mouse GAC proteins containing a phenylalanine to tryptophan substitution at position 327 (F327W), rat GAC proteins containing a phenylalanine to tryptophan substitution at position 327 (F327W), human KGA proteins containing a phenylalanine to tryptophan substitution at position 322 (F322W), mouse KGA proteins containing a phenylalanine to tryptophan substitution at position 327 (F327W), and rat KGA proteins containing a phenylalanine to tryptophan substitution at position 327 (F327W), each of which is shown in Table 1 below. Other suitable GLS proteins include GLS proteins from other organisms, as long as they contain the corresponding phenylalanine to tryptophan substitution in their activation loop.
(36) TABLE-US-00007 TABLE1 Full-LengthMutantGLSProteins SEQ AminoAcidSequence IDNO: (theactivationloopisinbold) Description 8 MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRP HumanGAC AAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGST F322W HPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIK QGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLK ECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFV IPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVS VCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRY VGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQGVNNA EKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLK EKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFC PITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGV AGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFH NYDNLRHFAKKLDPRREGGDQRHSFGPLDYESLQQELALKETVW KKVSPESNEDISTTVVYRMESLGEKS 9 MMRLRGSAMLRELLLRPPAAVGAVLRRAQPLGTLCRRPRGGSRP MouseGAC TAGLVAAARLHPWWGGGGRAKGPGAGGLSSSPSEILQELGKGGT F327W PPQQQQQQQQQPGASPPAAPGPKDSPGETDAFGNSEGKEMVAAG DNKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTS DPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAF RRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPD LWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTE YVHRYVGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQ GVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAI GYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLA NGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLP AKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVS LCNFHNYDNLRHFAKKLDPRREGGDQRHSFGPLDYESLQQELAL KDTVWKKVSPESSDDTSTTVVYRMESLGERS 10 MMRLRGSAMLRELLLRPPAAVGGVLRRAQPLGTLCRRPRGGSRP RatGAC AAGLVAAARLHPWWGGGGRAKGPGSGGLSSSPSEILQELGKGGT F327W PPQQQQQQQQQPGASPPAAPGPKDSPGETDAFGNSEGKEMVAAG DNKVKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTS DPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAF RRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPD LWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTE WHRYVGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQG VNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIG YYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLAN GGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSL CNFHNYDNLRHFAKKLDPRREGGDQRHSFGPLDYESLQQELALK DTVWKKVSPESSDDTSTTIVYRMESLGERS 11 MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRP HumanKGA AAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGST F322W HPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIK QGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLK ECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFV IPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVS VCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRY VGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQGVNNA EKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLK EKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFC PITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGV AGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFH NYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRF ALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPK DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT VHKNLDGLL 12 MMRLRGSAMLRELLLRPPAAVGAVLRRAQPLGTLCRRPRGGSRP MouseKGA TAGLVAAARLHPWWGGGGRAKGPGAGGLSSSPSEILQELGKGGT F327W PPQQQQQQQQQPGASPPAAPGPKDSPGETDAFGNSEGKEMVAAG DNKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTS DPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAF RRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPD LWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTE YVHRYVGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQ GVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAI GYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLA NGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLP AKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVS LCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVS ALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKV NPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDDG KGNQTVHKNLDGLL 13 MMRLRGSAMLRELLLRPPAAVGGVLRRAQPLGTLCRRPRGGSRP RatKGA AAGLVAAARLHPWWGGGGRAKGPGSGGLSSSPSEILQELGKGGT F327W PPQQQQQQQQQPGASPPAAPGPKDSPGETDAFGNSEGKEMVAAG DNKVKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTS DPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAF RRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPD LWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTE YVHRYVGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQ GVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAI GYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLA NGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLP AKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVS LCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVS ALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKV NPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDDG KENQTVHKNLDGLL
(37) The central pfam04960 domain in GLS proteins (i.e., residues 244-530 of human GAC/KGA; residues 249-535 of mouse and rat GAC/KGA) is responsible for their glutaminase activity and this domain can function without the N-terminus and/or C-terminus (Thangavelu et al., Structural Basis for the Active Site Inhibition Mechanism of Human Kidney-Type Glutaminase (KGA), Sci. Rep. 4:3827 (2014), which is hereby incorporated by reference in its entirety). Thus, suitable GLS proteins according to the present technology also include GLS proteins that are less than full-length. In at least one embodiment, the GLS protein comprises a functional pfam04960 domain. The consensus sequence of the wild-type pfam04960 domain has the amino acid sequence of SEQ ID NO:14 (where X at position 32 is Ile or Thr), as follows (the activation loop is underlined).
(38) TABLE-US-00008 GKVADYIPQLAKFSPDLWGVSVCTVDGQRHSXGDTKVPFCLQSCVKPLKYAIAVNDLGTE 60 YVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLN 120 KMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVT 180 CESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSG 240 VAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNY 287
(39) In at least one embodiment, the mutant GLS protein according to the present technology comprises a mutant pfam04960 domain (i.e., the pfam04960 domain having a phenylalanine to tryptophan substitution at the residue corresponding to position 322 of human GAC). The consensus sequence of the mutant pfam04960 domain has the amino acid sequence of SEQ ID NO:15 (where X at position 32 is Ile or Thr), as follows (the activation loop is underlined).
(40) TABLE-US-00009 GKVADYIPQLAKFSPDLWGVSVCTVDGQRHSXGDTKVPFCLQSCVKPLKYAIAVNDLGTE 60 YVHRYVGKEPSGLRFNKLWLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLN 120 KMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVT 180 CESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSG 240 VAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNY 287
(41) In at least one embodiment of this aspect of the present technology, the mutant GLS protein comprises the amino acid sequence of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, or SEQ ID NO:15.
(42) In at least one embodiment of this aspect of the present technology, the mutant GLS protein comprises the amino acid sequence of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, or SEQ ID NO:15. In at least one embodiment of this aspect of the present technology, the GLS protein comprises an amino acid sequence that is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, or SEQ ID NO:15; preferably, the activation loop region has the amino acid sequence KEPSGLRFNKLW (SEQ ID NO:16). In at least one embodiment of this aspect of the present technology, the GLS protein comprises a functional pfam04960 domain.
(43) Percent identity as used herein refers to the comparison of one amino acid (or nucleic acid) sequence to another, as scored by matching amino acids (or nucleic acids). Percent identity is determined by comparing a statistically significant number of the amino acids (or nucleic acids) from two sequences and scoring a match when the same two amino acids (or nucleic acids) are present at a position. The percent identity can be calculated by any of a variety of alignment algorithms known and used by persons of ordinary skill in the art.
(44) In a preferred embodiment (particularly suitable for use in the methods described infra), the mutant GLS protein is any GLS protein that contains a phenylalanine to tryptophan substitution at the residue corresponding to position 322 of human GAC and that has glutaminase activity. In at least one embodiment, having glutaminase activity means that the mutant GLS protein would be capable of producing a detectable level of glutamate in a method substantially similar to the glutaminase assay described in Example 1, infra.
(45) GLS proteins of the present technology may be produced recombinantly, e.g., from a GLS-encoding nucleic acid molecule, using techniques that are known in the art. Wild-type GLS proteins may be isolated from a sample or tissue by methods commonly used by persons of ordinary skill in the art, or produced recombinantly.
(46) Expression of a GLS protein can be carried out by introducing a nucleic acid molecule encoding the GLS protein into an expression system of choice using conventional recombinant technology. Generally, this involves inserting the nucleic acid molecule into an expression system to which the molecule is heterologous (i.e., not normally present). The introduction of a particular foreign or native gene into a host is facilitated by first introducing the gene sequence into a suitable nucleic acid vector. Vector is used herein to mean any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which is capable of transferring gene sequences between cells. Thus, the term includes cloning and expression vectors, as well as viral vectors. The heterologous nucleic acid molecule is inserted into the expression system or vector in proper sense (5.fwdarw.3) orientation and correct reading frame. The vector contains the necessary elements for the transcription and translation of the inserted GLS protein coding sequence.
(47) U.S. Pat. No. 4,237,224 to Cohen and Boyer, which is hereby incorporated by reference in its entirety, describes the production of expression systems in the form of recombinant plasmids using restriction enzyme cleavage and ligation with DNA ligase. These recombinant plasmids are then introduced by means of transformation and replicated in unicellular cultures including prokaryotic organisms and eukaryotic cells grown in tissue culture.
(48) Recombinant genes may also be introduced into viruses, including vaccinia virus, adenovirus, and retroviruses, including lentivirus. Recombinant viruses can be generated by transfection of plasmids into cells infected with virus.
(49) Suitable vectors include, but are not limited to, viral vectors such as lambda vector system gt11, gt WES.tB, and Charon 4, and plasmid vectors such as pBR322, pBR325, pACYC177, pACYC184, pUC8, pUC9, pUC18, pUC19, pLG339, pR290, pKC37, pKC101, SV 40, and pBluescript II SK+/ or KS+/ (see Stratagene Cloning Systems Catalog (1993) from Stratagene, La Jolla, Calif., which is hereby incorporated by reference in its entirety), pQE, pIH821, pGEX, pFastBac series (Invitrogen), pET series (see Studier et. al., Use of T7 RNA Polymerase to Direct Expression of Cloned Genes, Methods Enzymol. 185:60-89 (1990), which is hereby incorporated by reference in its entirety), and any derivatives thereof. Recombinant molecules can be introduced into cells via transformation, particularly transduction, conjugation, mobilization, or electroporation. The DNA sequences are cloned into the vector using standard cloning procedures in the art, such as those described in M
(50) A variety of host-vector systems may be utilized to express the GLS protein-encoding sequence in a cell. Primarily, the vector system must be compatible with the host cell used. Host-vector systems include but are not limited to the following: bacteria transformed with bacteriophage DNA, plasmid DNA, or cosmid DNA; microorganisms such as yeast containing yeast vectors; mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); and plant cells infected by bacteria. The expression elements of these vectors vary in their strength and specificities. Depending upon the host-vector system utilized, any one of a number of suitable transcription and translation elements can be used.
(51) Different genetic signals and processing events control many levels of gene expression (e.g., DNA transcription and messenger RNA (mRNA) translation).
(52) Transcription of DNA is dependent upon the presence of a promoter which is a DNA sequence that directs the binding of RNA polymerase and thereby promotes mRNA synthesis. The DNA sequences of eukaryotic promoters differ from those of prokaryotic promoters. Furthermore, eukaryotic promoters and accompanying genetic signals may not be recognized in or may not function in a prokaryotic system, and, further, prokaryotic promoters are not recognized and do not function in eukaryotic cells.
(53) Similarly, translation of mRNA in prokaryotes depends upon the presence of the proper prokaryotic signals which differ from those of eukaryotes. Efficient translation of mRNA in prokaryotes requires a ribosome binding site called the Shine-Dalgarno (SD) sequence on the mRNA. This sequence is a short nucleotide sequence of mRNA that is located before the start codon, usually AUG, which encodes the amino-terminal methionine of the protein. The SD sequences are complementary to the 3-end of the 16S rRNA (ribosomal RNA) and probably promote binding of mRNA to ribosomes by duplexing with the rRNA to allow correct positioning of the ribosome.
(54) Promoters vary in their strength (i.e., their ability to promote transcription). For the purposes of expressing a cloned gene, it is desirable to use strong promoters in order to obtain a high level of transcription and, hence, expression of the gene. Depending upon the host cell system utilized, any one of a number of suitable promoters may be used. For instance, when cloning in E. coli, its bacteriophages, or plasmids, promoters such as the PH promoter, T7 phage promoter, lac promoter, trp promoter, rec A promoter, ribosomal RNA promoter, the P.sub.R and P.sub.L promoters of coliphage lambda and others including, but not limited to, lacUV5, ompF, bla, lpp, and the like, may be used to direct high levels of transcription of adjacent DNA segments. Additionally, a hybrid trp-lacUV5 (tac) promoter or other E. coli promoters produced by recombinant DNA or other synthetic DNA techniques may be used to provide for transcription of the inserted gene.
(55) Bacterial host cell strains and expression vectors may be chosen which inhibit the action of the promoter unless specifically induced. In certain operons, the addition of specific inducers is necessary for efficient transcription of the inserted DNA. For example, the lac operon is induced by the addition of lactose or IPTG (isopropylthio-beta-D-galactoside). A variety of other operons, such as trp, pro, etc., are under different controls.
(56) Specific initiation signals are also required for efficient gene transcription and translation in prokaryotic cells. These transcription and translation initiation signals may vary in strength as measured by the quantity of gene specific messenger RNA and protein synthesized, respectively. The DNA expression vector, which contains a promoter, may also contain any combination of various strong transcription and/or translation initiation signals. For instance, efficient translation in E. coli requires a Shine-Dalgarno sequence about 7-9 bases 5 to the initiation codon (ATG) to provide a ribosome binding site. Thus, any SD-ATG combination that can be utilized by host cell ribosomes may be employed. Such combinations include but are not limited to the SD-ATG combination from the cro gene or the N gene of coliphage lambda, or from the E. coli tryptophan E, D, C, B, or A genes. Additionally, any SD-ATG combination produced by recombinant DNA or other techniques involving incorporation of synthetic nucleotides may be used.
(57) Depending on the vector system and host utilized, any number of suitable transcription and/or translation elements, including constitutive, inducible, and repressible promoters, as well as minimal 5 promoter elements may be used.
(58) The GLS protein-encoding nucleic acid, a promoter molecule of choice, a suitable 3 regulatory region, and if desired, a reporter gene, are incorporated into a vector-expression system of choice to prepare a nucleic acid construct using standard cloning procedures known in the art, such as described in M
(59) The nucleic acid molecule encoding a GLS protein is inserted into a vector in the sense (i.e., 5.fwdarw.3) direction, such that the open reading frame is properly oriented for the expression of the encoded GLS protein under the control of a promoter of choice. Single or multiple nucleic acids may be ligated into an appropriate vector in this way, under the control of a suitable promoter, to prepare a nucleic acid construct.
(60) Once the isolated nucleic acid molecule encoding the GLS protein has been inserted into an expression vector, it is ready to be incorporated into a host cell. Recombinant molecules can be introduced into cells via transformation, particularly transduction, conjugation, lipofection, protoplast fusion, mobilization, particle bombardment, or electroporation. The DNA sequences are incorporated into the host cell using standard cloning procedures known in the art, as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Springs Laboratory, Cold Springs Harbor, N.Y. (1989), which is hereby incorporated by reference in its entirety. Suitable hosts include, but are not limited to, bacteria, virus, yeast, fungi, mammalian cells, insect cells, plant cells, and the like.
(61) Typically, an antibiotic or other compound useful for selective growth of the transformed cells only is added as a supplement to the media. The compound to be used will be dictated by the selectable marker element present in the plasmid with which the host cell was transformed. Suitable genes are those which confer resistance to gentamycin, G418, hygromycin, puromycin, streptomycin, spectinomycin, tetracycline, chloramphenicol, and the like. Similarly, reporter genes which encode enzymes providing for production of an identifiable compound, or other markers which indicate relevant information regarding the outcome of gene delivery, are suitable. For example, various luminescent or phosphorescent reporter genes are also appropriate, such that the presence of the heterologous gene may be ascertained visually.
(62) A second aspect of the present technology relates to a method of screening for compounds that bind to the activation loop of GLS. This method involves contacting mutant GLS protein according to the first aspect of the technology with a test compound. The mutant GLS protein includes an activation loop (containing the phenylalanine to tryptophan substitution) and contacting is carried out under conditions effective to permit binding between the activation loop and the test compound. Fluorescence of the substituted tryptophan is detected in the presence of the test compound and the detected fluorescence is compared to fluorescence of a control. A test compound is then identified as being a compound that binds to the activation loop of GLS based on the compared fluorescence, where a change in fluorescence relative to the control indicates that the test compound binds to the activation loop of GLS.
(63) In carrying out the screening methods of the present technology (including both the second aspect and the third aspect described infra), GLS protein can be provided as described supra. It is also contemplated that mutant and wild-type GLS proteins might now be, or might in future become, commercially available. In such cases, GLS protein could also be provided by purchasing the GLS protein. GLS protein could also be provided by obtaining the protein from a non-commercial source.
(64) Mutant GLS protein suitable for use in this aspect of the present technology includes any mutant GLS protein described supra. In a preferred embodiment, the mutant GLS protein would be capable of emitting a detectable change in tryptophan fluorescence in the presence of BPTES in a method substantially similar to a tryptophan fluorescence assay described in Example 1 infra.
(65) Contacting GLS proteins with test compounds according to the screening methods of the present technology (including both the second aspect and the third aspect described infra) may be carried out using standard methods that will be apparent to the skilled artisan. Typically, the mutant GLS protein will be incubated with the test compound(s) for a time sufficient to allow any reaction (e.g., binding) between the GLS protein and the test compound to reach equilibrium. In at least one embodiment, the protein is incubated with the test compound for a duration of 5 minutes, 10 minutes, 15 minutes, 20 minutes, 30 minutes, or 35 minutes. In a preferred embodiment, the duration is from five to thirty-five minutes or from ten to thirty minutes (e.g., 5-10, 5-15, 5-20, 5-25, 5-30, 5-35, 10-15, 10-20, 10-25, 10-30, 10-35, 15-20, 15-25, 15-30, 15-35, 20-25, 20-30, 20-35, 25-30, 25-35, or 30-35 minutes).
(66) The screening methods of the present technology (including both the second aspect and the third aspect described infra) are typically carried out in vitro.
(67) Suitable test compounds according to the screening methods of the present technology (including both the second aspect and the third aspect described infra) include any compound that potentially binds to the activation loop of GLS protein. In at least one preferred embodiment, the test compound is a bisthiadiazole. In at least one preferred embodiment, the test compound is selected from the group consisting of small inorganic anions and negatively-charged metabolites. As will be apparent to the skilled artisan, all screening methods of the present technology can be carried out using a single test compound or a library of two or more test compounds. If a library of test compounds is used, they can be screened sequentially or simultaneously. If a library of test compounds is used, screening is typically carried out using one type of test compound per well; however, assays in which different test compounds are tested in the same well are also contemplated. In at least one embodiment, a high-throughput screen is carried out using a very large library of test compounds.
(68) As will be understood by the skilled artisan, tryptophan contains a fluorophore. As shown herein, the fluorescence of the substituted tryptophan residue in mutant GLS protein of the present technology emits a fluorescence at a first level (e.g., a particular wavelength or intensity) in the absence of any compounds that bind to the activation loop of the GLS protein. In the screening methods of the present technology (including both the second aspect and the third aspect described infra), candidate compounds can be screened for their ability to cause a detectable change in fluorescence of the substituted tryptophan (e.g., to emit a fluorescence at a level above or below the first level, cause a shift in the fluorescence wavelength or intensity, or cause a change in fluorescence lifetime). In at least one embodiment, candidates are screened for their ability to emit a fluorescence at a level above or below the first level. Detecting a change in fluorescence may be carried out by visual observation. Alternatively, detecting a change in fluorescence may be carried out with a spectrophotometer, or a microscope or macroscope system coupled to a camera or photomultiplier tube. Coupled with proper instrumentation, the optical readout can be followed in real time to obtain spatio-temporal information.
(69) In the screening methods of the present technology (including both the second aspect and the third aspect described infra), the fluorescence of the substituted tryptophan in the presence of the test compound can be compared to a control using any suitable method known in the art. For example, the fluorescence values/intensities themselves can be compared. Alternatively or additionally, the fluorescence values can be used to calculate the binding affinity of the test compound, which can then be compared to that of a control.
(70) In the screening methods of the present technology (including both the second aspect and the third aspect described infra), the control is typically a negative control. To obtain a negative control, the fluorescence of the substituted tryptophan can be determined before and after the test compound is added. Alternatively or additionally, a negative control can be obtained by using another mutant GLS protein that is evaluated in the absence of the test compound but under otherwise substantially identical conditions. In these embodiments, the mutant GLS protein used as the control is typically identical to the protein that is contacted with the test compound (e.g., if human GAC is contacted with the test compound, human GAC is used as the control). In the screening assay according to the second aspect of the present technology, any change in fluorescence (positive or negative) relative to the negative control indicates that the test compound binds to the activation loop of GLS.
(71) Compounds can also be tested for their ability to modulate glutaminase activity of GLS using a glutaminase activity assay. In these assays, GLS protein is contacted with glutamine in the presence of the test compound under conditions effective for the GLS protein, if active, to convert glutamine to glutamate. Production of glutamate, if any, is measured following contacting the GLS protein with glutamine, and the measured glutamate production is compared to glutamate production of a control. A test compound is identified, based on the compared glutamate production, as being a modulator of glutaminase activity of GLS, where a change in glutamate production relative to the control indicates that the test compound modulates glutaminase activity of GLS. Glutamine and the test compound can be added sequentially, in either order, or simultaneously.
(72) As will be apparent to the skilled artisan, by combining the binding assay according to the second aspect of the technology with a glutaminase activity assay, compounds that both bind to the activation loop and are capable of modulating glutaminase activity of GLS can be identified. As will also be apparent to the skilled artisan, the binding assay and the glutaminase activity assay could be performed sequentially, in either order, or simultaneously.
(73) In at least one embodiment, the binding assay is performed before the glutaminase activity assay. In this embodiment, the second aspect of the present technology further includes identifying a compound that also modulates glutaminase activity of GLS. In this embodiment, a compound identified as being a compound that binds to the activation loop is selected. GLS protein is contacted with glutamine in the presence of the selected test compound under conditions effective for the GLS protein, if active, to convert glutamine to glutamate. Production of glutamate, if any, is measured following contacting the GLS protein with glutamine in the presence of the selected test compound, and the measured glutamate production is compared to glutamate production of a control. A selected test compound is further identified to also be a modulator of glutaminase activity of GLS based on the compared glutamate production, where a change in glutamate production relative to the control indicates that the selected test compound also modulates glutaminase activity of GLS.
(74) Contacting in the glutaminase activity assays described herein may be carried out as described above.
(75) In the glutaminase activity assays described herein, GLS protein is used to screen for the test compound's effect on activity. As will be apparent to the skilled artisan, because a glutaminase activity assay does not rely on the fluorescence of a substituted tryptophan, any GLS protein that is capable of converting glutamine to glutamate is suitable for use in the glutaminase activity assays described herein. Thus, the GLS protein used in the glutaminase activity assay can be mutant GLS protein of the present technology or GLS protein that does not have a phenylalanine to trytophan substitution.
(76) As will be apparent to the skilled artisan, any suitable method known in the art for measuring the production of glutamate can be used in the glutaminase activity assays described herein. Active glutaminase converts glutamine to glutamate and ammonia. Glutaminase activity can be monitored by measuring production of either of the products of the reaction, glutamate or ammonia. Because glutamate is not spectroscopic, glutamate production is typically measured using a coupled enzymatic reaction in which GLS catalyzes a first reaction to produce glutamate and ammonia, and a second enzyme catalyzes a second reaction using the glutamate or ammonia produced in the first reaction to reflect the activity of the first reaction (i.e., the glutaminase activity). Coupled enzymatic reactions are well known in the art and include, but are not limited to, those using glutamate dehydrogenase, which catalyzes the reversible reaction of glutamate and NAD(+) into -ketoglutarate, NADH, and ammonia. Kits for performing suitable coupled enzymatic assays are widely available and include, for example, the Glutaminase (GLS) Assay Kit (Biomedical Research Service and Clinical Application), the Glutamate Assay Kit (Abcam), the Ammonia Assay Kit (Abcam), the NADH fluorescence assay described in Example 1 below, and the fluorescence-based assay described in Mihali et al., High-Throughput Screening of Glutaminase Inhibitors For the Pharmacotherapy of Schizophrenia: Implementation of a Fluorescence-Based Assay, Columbia Undergraduate Science Journal 4 (2009), which is hereby incorporated by reference in its entirety.
(77) As will also be apparent to the skilled artisan, glutaminase activity assays typically use a negative control. To obtain a negative control, glutamate production can be determined before and after the test compound is added. Alternatively or additionally, a negative control can be obtained in a separate reaction using GLS protein that is evaluated in the absence of the test compound but under otherwise substantially identical conditions. In these embodiments, the GLS protein used as the control is typically identical to the protein that is contacted with the test compound (e.g., if wild-type human GAC is contacted with the test compound, wild-type human GAC is used as the control). An increase in glutamate production relative to the negative control indicates that the test compound is an activator of GLS activity, while a decrease in glutamate production relative to the negative control indicates that the test compound is an inhibitor of GLS activity.
(78) A third aspect of the present technology relates to a method of screening for compounds that potentially modulate glutaminase activity of GLS. This method involves contacting mutant GLS protein according to the first aspect of the technology with a test compound. The mutant GLS protein includes an activation loop (containing the phenylalanine to tryptophan substitution) and contacting is carried out under conditions effective to permit binding between the activation loop and the test compound. Fluorescence of the substituted tryptophan is detected in the presence of the test compound and the detected fluorescence is compared to fluorescence of a control. A test compound is then identified as being a potential modulator of glutaminase activity of GLS based on the compared fluorescence, where a change in fluorescence relative to the control indicates that the test compound potentially modulates glutaminase activity of GLS.
(79) In carrying out this any all other methods of the present technology, GLS protein can be provided as described supra.
(80) Mutant GLS protein suitable for use in this aspect of the present technology includes any mutant GLS protein described supra. In a preferred embodiment, the mutant GLS protein would be capable of emitting a detectable change in tryptophan fluorescence in the presence of BPTES in a method substantially similar to a tryptophan fluorescence assay described in Example 1 infra.
(81) Contacting may be carried out as described above.
(82) Suitable test compounds are as described above.
(83) As described above, candidate compounds can be screened for their ability to cause a detectable change in fluorescence of the substituted tryptophan and compared to a control. This can be carried out as described above, except that in the screening assay according to this aspect of the present technology, a change in fluorescence (positive or negative) relative to the control indicates that the test compound potentially modulates (inhibits or activates) glutaminase activity of GLS. An increase in fluorescence relative to a negative control indicates that the test compound is a potential activator of GLS activity, while a decrease in fluorescence relative to a negative control indicates that the test compound is a potential inhibitor of GLS activity.
(84) As will be apparent to the skilled artisan, the screening assay according to the third aspect of the present technology can also be combined with a glutaminase activity assay, as described supra. The glutaminase activity assay according to this embodiment may be carried out as described above. As will be apparent to the skilled artisan, by combining the screening assay according to the third aspect of the technology with a glutaminase activity assay, compounds that are capable of modulating glutaminase activity of GLS can be identified. As will also be apparent to the skilled artisan, the screening assay and the glutaminase activity assay could be performed sequentially or simultaneously.
(85) In at least one embodiment, the screening assay according to the third aspect of the technology is performed before the glutaminase activity assay. In this embodiment, the third aspect of the present technology further includes verifying whether a test compound modulates glutaminase activity of GLS. In this embodiment, a compound identified as being a potential modulator of glutaminase activity of GLS is selected. GLS protein is contacted with glutamine in the presence of the selected test compound under conditions effective for the GLS protein, if active, to convert glutamine to glutamate. Production of glutamate, if any, is measured following the contacting with glutamine in the presence of the selected test compound, and the measured glutamate production is compared to glutamate production of a control. A selected test compound is further verified to be a modulator of glutaminase activity of GLS based on the compared glutamate production, where a change in glutamate production relative to the control indicates that the selected test compound modulates glutaminase activity of GLS.
(86) A fourth aspect of the present technology relates to a kit for identifying a compound that binds to the activation loop of GLS and/or potentially modulates glutaminase activity of GLS. The kit includes any mutant GLS protein described supra. In a preferred embodiment, the mutant GLS protein would be capable of emitting a detectable change in tryptophan fluorescence in the presence of BPTES in a method substantially similar to a tryptophan fluorescence assay described in Example 1 infra.
(87) In at least one embodiment of this aspect of the present technology, the the mutant GLS protein comprises the amino acid sequence of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, or SEQ ID NO:15. In at least one embodiment of this aspect of the present technology, the GLS protein comprises an amino acid sequence that is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, or SEQ ID NO:15; preferably, the activation loop region has the amino acid sequence KEPSGLRFNKLW (SEQ ID NO:16). In at least one embodiment of this aspect of the present technology, the GLS protein comprises a functional pfam04960 domain.
(88) In at least one embodiment, the kit also includes one or more test compounds. Suitable test compounds include those described above.
(89) The present technology may be further illustrated by reference to the following examples.
EXAMPLES
Example 1Materials and Methods
Abbreviations
(90) Abbreviations used herein include: GLS, kidney-type mitochondrial enzyme glutaminase; GDH, glutamate dehydrogenase; GOT, glutamic-oxaloacetic transaminase; GPT, glutamic-pyruvic transaminase; mTOR, mechanistic target of rapamycin; KGA, kidney-type glutaminase; DON, diazo-O-norleucine; BPTES, (bis-2-(5-phenylacetamido-1,2,4-thiadiazol-2-yl)ethyl; SEC, size exclusion chromatography; MALS, multiangle light scattering; GAC, glutaminase C.
(91) Preparation of Recombinant GAC
(92) GAC was expressed and purified as described previously (Stalnecker et al., Mechanism by Which a Recently Discovered Allosteric Inhibitor Blocks Glutamine Metabolism in Transformed Cells, Proc. Natl. Acad. Sci. U.S.A. 112:394-99 (2015), which is hereby incorporated by reference in its entirety). Briefly, a plasmid encoding the mouse kidney-type glutaminase isoform 2 (GAC, NP_001106854.1 (which is hereby incorporated by reference in its entirety), residues 73-603) was cloned into a pET28a vector containing an N-terminal histidine (His) tag and thrombin cleavage site. The expressed protein was purified using Co.sup.2 affinity beads (Clontech), followed by anion exchange (GE Healthcare) and gel filtration chromatography. Purified GAC was stored in a high salt-containing buffer (20 mM Tris-HCl (pH 8.5), 500 mM NaCl, and 1 mM NaN.sub.3) at 80 C. following snap-freezing in liquid N.sub.2 for long-term use.
(93) The GAC.sub.F327W mutant was obtained using site-directed mutagenesis. Purification of the protein was performed as described for WT GAC above.
(94) Protein Labeling with FRET Pairs
(95) Labeling recombinant GAC with small molecule probes was performed by methods described previously (Stalnecker et al., Mechanism by Which a Recently Discovered Allosteric Inhibitor Blocks Glutamine Metabolism in Transformed Cells, Proc. Natl. Acad. Sci. U.S.A. 112:394-99 (2015), which is hereby incorporated by reference in its entirety). Briefly, 1.5 mg of GAC was first exchanged into 50 mM HEPES (pH 7.2) and 100 mM NaCl (labeling buffer) using a PD10 desalting column (GE Healthcare). The protein was then incubated with either 50 M (5-fold excess over enzyme) Alexa Fluor 488 succinimidyl ester or QSY9 succinimidyl ester (Molecular Probes) for 1 hour at 4 C. The labeling reaction was quenched with 150 mM Tris-HCl (pH 8.5), and unreacted probe was separated from labeled enzyme using a PD10 desalting column, eluting labeled GAC into the high salt-containing buffer.
(96) MALS Analysis
(97) Purified GAC and GAC mutants were subjected to MALS as described previously (Mller et al., Small Angle X-Ray Scattering Studies of Mitochondrial Glutaminase C Reveal Extended Flexible Regions, and Link Oligomeric State with Enzyme Activity, PLoS ONE 8:e74783 (2013), which is hereby incorporated by reference in its entirety). Briefly, 50-l samples of 5 mg/ml GAC with or without 30-min preincubation with 100 M BPTES were injected onto a BioSep-SEC-S4000 size exclusion column (Wyatt Technology) coupled to a static 18-angle light scattering detector (DAWN HELEOS-II) and a refractive index detector (OptiLab T-rEX, Wyatt Technology) at 23 C. The size exclusion column was equilibrated with 20 mM Tris-HCl (pH 8.5) and 200 mM NaCl and, when appropriate, 50 mM K.sub.2HPO.sub.4 or K.sub.2SO.sub.4. The flow rate was kept at 1 ml/min. Root mean square radius and mass distribution (poly-dispersity) were analyzed using ASTRA software, with monomeric BSA (Sigma) serving to normalize the light-scattering signal.
(98) Glutaminase Assays
(99) Activity assays used to evaluate the activity of GAC mutants and inhibition by BPTES and CB-839 followed a two-step protocol adapted from Robinson et al. (Robinson et al., Novel Mechanism of Inhibition of Rat Kidney-Type Glutaminase by Bis-2-(5-Phenylacetamido-1,2,4-Thiadiazol-2-yl)Ethyl Sulfide (BPTES), Biochem. J. 406:407-14 (2007), which is hereby incorporated by reference in its entirety). For example, when assaying phosphate- or sulfate-stimulated activity, 20 l of 20 mM glutamine, 50 mM Tris acetate (pH 8.5), and 0.1 mM EDTA, containing the indicated concentrations of K.sub.2HPO.sub.4 or K.sub.2SO.sub.4, were added to a UV-transparent Costar 96-well plate (Corning). For inhibition assays, drugs dissolved in DMSO were added to 20 l of 20 mM glutamine, 50 mM Tris acetate (pH 8.5), 0.1 mM EDTA, and 50 mM K.sub.2HPO.sub.4. To initiate the reaction, 5 l of a solution of GAC prepared in 20 mM Tris-HCl (pH 8.5), 100 mM NaCl, and 1 mM NaN.sub.3, to give a final enzyme concentration of 50 nM in the assay, or a GAC concentration of 100 nM for inhibition assays, was added to the glutamine solution and incubated at 23 C. for 2 min before the reaction was quenched using 2.5 l of 3 M HCl. The second step was initiated by addition of 200 l of 12 units/pi GDH, 2 mM NAD, 100 mM hydrazine (Sigma), and 100 mM Tris-HCl (pH 9.2) on top of the first quenched reaction and incubated for 45 min at 23 C. before reading NADH absorbance. Glutamate produced by the first reaction was determined from the amount of NADH generated in the second reaction by using the extinction coefficient for NADH (6220 M.sup.1 cm.sup.1).
(100) Fluorescence Measurements
(101) Fluorescence experiments were performed with a Varian Cary Eclipse fluorimeter in counting mode, using 1 ml samples with continuous stirring at 20 C. in 50 mM Tris acetate (pH 8.5) and 0.1 mM EDTA. For FRET assays, 75 nM QSY9-labeled GAC was added to 25 nM 488-labeled GAC while monitoring fluorescence emission at 520 nm with excitation at 490 nm. After equilibration for 10 min, 100 mM K.sub.2HPO.sub.4 or K.sub.2SO.sub.4, or either 500 nM BPTES or CB-839, was added and equilibrated for 5 min. Finally, 1 M unlabeled WT GAC was added to the assay incubation. For tryptophan emission scans, the excitation and emission wavelengths were 285 and 310-390 nm, respectively. For kinetic experiments, the excitation and emission wavelengths were 285 and 340 nm, respectively. For drug titrations, BPTES and CB-839 at the indicated concentrations were added to 100 nM GAC.sub.F327W to give less than 0.5% (v/v) DMSO. Points for the dose-dependent quenching by inhibitors were taken from the equilibrated binding curves and fit to a bimolecular ligand binding equation after correcting for fractional saturation using the relation of free and unbound enzyme/drug complex (i.e., f.sub.bound f.sub.free=1, where f.sub.bound=F/F.sub.max). Similarly, 1 M BPTES was added to 100 nM GAC.sub.F327W,D391K. For allosteric activator titrations, the indicated concentrations of K.sub.2HPO.sub.4 or K.sub.2SO.sub.4 were added to 500 nM GAC.sub.F327W.
Example 2Comparison of the Effects of Allosteric Activators and BPTES Class Inhibitors on GAC
(102) Previous studies have demonstrated the requirement for both KGA and GAC to form homo-tetramers to become activated (Stalnecker et al., Mechanism by Which a Recently Discovered Allosteric Inhibitor Blocks Glutamine Metabolism in Transformed Cells, Proc. Natl. Acad. Sci. U.S.A. 112:394-99 (2015); Mller et al., Small Angle X-Ray Scattering Studies of Mitochondrial Glutaminase C Reveal Extended Flexible Regions, and Link Oligomeric State with Enzyme Activity, PLoS ONE 8:e74783 (2013); Curthoys et al., Regulation of Renal Ammoniagenesis: Purification and Characterization of Phosphate-Dependent Glutaminase from Rat Kidney, Arch. Biochem. Biophys. 174:82-89 (1976); McGivan et al., Rat Liver Glutaminase, Eur. J. Biochem. 148:323-27 (1985), each of which is hereby incorporated by reference in its entirety). Using a FRET assay, the effects that allosteric activators and inhibitors (
(103) The ability of BPTES and CB-839 to inhibit recombinant GAC activity was compared by monitoring the NADH fluorescence generated as an outcome of the coupled reactions used to assay the enzyme (Stalnecker et al., Mechanism by Which a Recently Discovered Allosteric Inhibitor Blocks Glutamine Metabolism in Transformed Cells, Proc. Natl. Acad. Sci. U.S.A. 112:394-99 (2015), which is hereby incorporated by reference in its entirety).
(104) Given the inhibitory properties of the BPTES class of molecules toward GAC and the established link between the degree of cellular glutaminase activity and glutamine dependence in cancer cell lines (Lukey et al., The Oncogenic Transcription Factor c-Jun Regulates Glutaminase Expression and Sensitizes Cells to Glutaminase-Targeted Therapy, Nat. Commun. 7:11321 (2016), which is hereby incorporated by reference in its entirety), there was interest in establishing an assay to probe the direct binding of these inhibitors to the enzyme and the underlying mechanisms by which they influence catalytic activity. Of particular interest was to better understand how they interact with the activation loop within the dimer-dimer interface of GAC, where BPTES has been shown to bind based on X-ray crystallographic studies, and how such interactions inhibit the enzyme. Thus, a fluorescence reporter group within the flexible activation loop was engineered to monitor its real-time movements in response to allosteric inhibitors and to compare such effects to those elicited by allosteric activators.
Example 3Examination of the BPTES Binding Site Based on X-Ray Crystal Structures
(105) With respect to their ability to drive GAC tetramer formation, both inhibitors and activators result in similar FRET increases and yet elicit opposite outcomes regarding their effects on enzyme activity. To examine this at a structural level, the available X-ray crystal structures for GAC and KGA were compared. Currently, there are 16 high-resolution X-ray crystal structures for these GLS isoforms. It is important to note that KGA and GAC differ only in their C-terminal sequences, which are unresolved in all X-ray crystal structures. Upon careful analysis, only six of these structures provide sufficient electron density to resolve unambiguously the atomic positions of some of the residues within the activation loop (i.e., residues .sup.320GLRFNKL.sup.326 (SEQ ID NO:17)) (Thangavelu et al., Structural Basis for the Allosteric Inhibitory Mechanism of Human Kidney-Type Glutaminase (KGA) and Its Regulation by Raf-Mek-Erk Signaling in Cancer Cell Metabolism, Proc. Natl. Acad. Sci. U.S.A. 109:7705-10 (2012); DeLaBarre et al., Full-Length Human Glutaminase in Complex with an Allosteric Inhibitor, Biochemistry 50:10764-70 (2011); Cassago et al., Mitochondrial Localization and Structure-Based Phosphate Activation Mechanism of Glutaminase C with Implications for Cancer Metabolism, Proc. Natl. Acad. Sci. U.S.A. 109:1092-97 (2012), each of which is hereby incorporated by reference in its entirety). Of those structures with a resolved activation loop, four are co-crystal structures with BPTES (PDB codes 3VOZ, 3VP1, 3UO9, and 4JKT), one is a co-crystal structure with the active site inhibitor DON (PDB code 4O7D), and the other is without either BPTES or DON but includes two inorganic anions of sulfate per KGA monomer (PDB code 3VOY). Interestingly, in this KGA structure (PDB code 3VOY), one sulfate is bound proximal to the activation loop through interactions formed directly with tyrosine 399 and lysine 403 and represents the likely binding site for allosteric activators, although this has not been directly demonstrated.
(106) Significant differences were noted when comparing the two KGA/GAC structures that lack bound BPTES but have a sufficiently resolved activation loop (PDB codes 4O7D and 3VOY) with all BPTES-bound structures. To illustrate this,
Example 4the F327W Mutation is Sensitive to Inhibitor Binding
(107) Upon individual substitution of these three residues to tryptophan, their fluorescence properties (excitation, 285 nm; emission, 310-390 nm) were initially analyzed before and after the addition of BPTES. It was found that BPTES induced a marked quenching in the tryptophan fluorescence of the GAC.sub.F327W mutant (
(108) Based on the available crystallographic data, the ability of the F327W mutation to read out BPTES binding is likely due to the interactions of the inhibitor with the peptide backbone of the substituted tryptophan and not the outcome of direct contact with the indole side chain (
Example 5Changes in F327W Fluorescence Provide a Direct Binding Readout for BPTES and CB-839
(109) Derivatives of BPTES have proven to be effective inhibitors in vivo, with compound CB-839 being the most potent to date with a reported IC.sub.50 value of 30 nM (Gross et al., Antitumor Activity of the Glutaminase Inhibitor CB-839 in Triple-Negative Breast Cancer, Mol. Cancer Ther. 13:890-901 (2014), which is hereby incorporated by reference in its entirety). However, unlike BPTES, CB-839 achieved its maximal potency only when pre-incubated with GAC prior to assaying enzyme activity, suggesting that it has a slower rate of association with the enzyme (i.e., a slower on rate (Gross et al., Antitumor Activity of the Glutaminase Inhibitor CB-839 in Triple-Negative Breast Cancer, Mol. Cancer Ther. 13:890-901 (2014), which is hereby incorporated by reference in its entirety)). Similarly, CB-839 appeared to dissociate more slowly from GAC compared with BPTES (i.e., a slower off rate (Gross et al., Antitumor Activity of the Glutaminase Inhibitor CB-839 in Triple-Negative Breast Cancer, Mol. Cancer Ther. 13:890-901 (2014), which is hereby incorporated by reference in its entirety)). By monitoring the tryptophan fluorescence of the F327W mutant, the kinetics and binding efficiencies of these two inhibitors were able to be directly compared. As shown in
Example 6BPTES Requires Tetramer Formation to Bind to GAC
(110) To demonstrate the requirement of BPTES to bind to the tetrameric form of GAC, D391K, a mutation along the dimer-dimer interface that was shown previously to block the ability of GAC to form tetramers (Stalnecker et al., Mechanism by Which a Recently Discovered Allosteric Inhibitor Blocks Glutamine Metabolism in Transformed Cells, Proc. Natl. Acad. Sci. U.S.A. 112:394-99 (2015), which is hereby incorporated by reference in its entirety), was taken advantage of. Aspartate 391 is critical for GAC tetramer formation, where it forms a salt bridge with Lys-401 (both residues reside at the interface between two GAC dimers). Because of the twofold axis of symmetry of the GAC tetramer, the single change of aspartate 391 to lysine, and hence the introduction of a charge-charge repulsion, results in the disruption of four salt bridges per GAC tetramer that is sufficient to prohibit tetramer formation (Stalnecker et al., Mechanism by Which a Recently Discovered Allosteric Inhibitor Blocks Glutamine Metabolism in Transformed Cells, Proc. Natl. Acad. Sci. U.S.A. 112:394-99 (2015), which is hereby incorporated by reference in its entirety). To investigate whether BPTES binds to the activation loop of an inactive GAC dimer, the D391K mutation was introduced into the GAC.sub.F327W background, and it was found that this single substitution completely ablated the ability of BPTES to induce a change in tryptophan fluorescence (
Example 7Allosteric Activators Enhance GAC.SUB.F327W .Fluorescence
(111) Previous studies of the activation of the KGA/GAC enzymes revealed that their enzymatic activity was markedly increased upon addition of various inorganic anionic ions (Robinson et al., Novel Mechanism of Inhibition of Rat Kidney-Type Glutaminase by Bis-2-(5-Phenylacetamido-1,2,4-Thiadiazol-2-yl)Ethyl Sulfide (BPTES), Biochem. J. 406:407-14 (2007); Mller et al., Small Angle X-Ray Scattering Studies of Mitochondrial Glutaminase C Reveal Extended Flexible Regions, and Link Oligomeric State with Enzyme Activity, PLoS ONE 8:e74783 (2013); Curthoys et al., Regulation of Renal Ammoniagenesis: Purification and Characterization of Phosphate-Dependent Glutaminase from Rat Kidney, Arch. Biochem. Biophys. 174:82-89 (1976); Huang & Knox, A Comparative Study of Glytaminase Isozymes in Rat Tissues, Enzyme 21:408-26 (1975), each of which is hereby incorporated by reference in its entirety). The most potent of these activators, inorganic phosphate, has been the most studied, having been shown to affect the oligomeric state of both the KGA and GAC isoforms. Additionally, recent high-resolution X-ray crystal structures have revealed potential binding sites for these anions (
(112) Here the effects of these anionic activators on the tryptophan fluorescence of the GAC.sub.F327W mutant were examined. Anions that have been reported to activate glutaminase enzymes were first tested; namely, inorganic phosphate and sulfate. Unlike the changes observed for BPTES and CB-839, addition of these anions to GAC.sub.F327W resulted in marked enhancement of tryptophan fluorescence (
(113) The effects of these ions on the molecular size distribution of GAC were next investigated as read out by SEC-MALS. Previous studies have described the formation of polytetrameric complexes that result from phosphate binding to high concentrations of enzyme (i.e., >1 mg/ml), where GAC tetramers bind end-on-end to form polymers. This led to the suggestion that these polytetrameric complexes might be necessary for stimulating enzyme activity (Ferreira et al., Active Glutaminase C Self-Assembles into a Supratetrameric Oligomer That Can Be Disrupted by an Allosteric Inhibitor, J. Biol. Chem. 288:28009-20 (2013); Mller et al., Small Angle X-Ray Scattering Studies of Mitochondrial Glutaminase C Reveal Extended Flexible Regions, and Link Oligomeric State with Enzyme Activity, PLoS ONE 8:e74783 (2013), which is hereby incorporated by reference in its entirety). Interestingly, it was found that sulfate, which has not been described previously to have an effect on the formation of GAC oligomers, stimulated the formation of a mixture of 16-mers and 8-mers but not the larger oligomers that are induced by phosphate (
Example 8Inorganic Phosphate Binds to the Tetrameric State of GAC
(114) The mechanism by which inorganic phosphate activates GAC activity is still unclear. In fact, it has been suggested that phosphate binds within the active site following catalysis, where it creates an electrostatic repulsion with the product to increase its off rate, thereby effectively increasing catalytic turnover (Cassago et al., Mitochondrial Localization and Structure-Based Phosphate Activation Mechanism of Glutaminase C with Implications for Cancer Metabolism, Proc. Natl. Acad. Sci. U.S.A. 109:1092-97 (2012), which is hereby incorporated by reference in its entirety). The second proposed mechanism is that phosphate interacts with the activation loop at the dimer-dimer interface, much like allosteric inhibitors such as BPTES, and enables the loop to access an active conformation to stimulate catalysis (Thangavelu et al., Structural Basis for the Allosteric Inhibitory Mechanism of Human Kidney-Type Glutaminase (KGA) and Its Regulation by Raf-Mek-Erk Signaling in Cancer Cell Metabolism, Proc. Natl. Acad. Sci. U.S.A. 109:7705-10 (2012), which is hereby incorporated by reference in its entirety). The enhancement of the tryptophan fluorescence of the F327W mutant observed here is consistent with the latter mechanism. Furthermore, it was found that the fluorescence enhancement induced by phosphate addition was dependent on GAC concentration and, therefore, the proportion of tetramers in solution. When this enhancement was plotted with respect to the concentration of GAC, it was in good agreement with FRET measurements that reflect the binding isotherm representing the transition of GAC dimers to tetramers and the concentration-dependent activation of the WT enzyme (
Discussion of Examples 1-8
(115) Prior studies of the structure-function relationships of glutaminases have revealed their essential role in glutamine metabolism within mammalian cells, where their activity is governed by their self-association to form tetramers (McGivan et al., Rat Liver Glutaminase, Eur. J. Biochem. 148:323-27 (1985); Huang & Knox, A Comparative Study of Glytaminase Isozymes in Rat Tissues, Enzyme 21:408-26 (1975); Darmaun et al., Glutamine and Glutamate Kinetics in Humans, Am. J. Physiol. 251:E117-E126 (1986); Patel & McGivan, Partial Purification and Properties of Rat Liver Glutaminase, Biochem. J. 220:583-90 (1984); Laake et al., Postembedding Immunogold Labelling Reveals Subcellular Localization and Pathway-Specific Enrichment of Phosphate Activated Glutaminase in Rat Cerebellum, Neuroscience 88:1137-51 (1999), which are hereby incorporated by reference in their entirety). However, the mechanism by which tetramer formation stimulates enzymatic activity is not fully understood, presenting a significant challenge for rational drug design targeting this family of enzymes. The fact that a class of small molecule inhibitors, namely the bisthiadiazole derivatives, appeared to stabilize an inactive, tetrameric state of the KGA/GAC enzymes was an important discovery and further highlights the interest in understanding the mechanisms regulating glutaminase activity. Therefore, a spectroscopic readout for the flexible activation loop of GAC was developed, where BPTES binds, with the aim of obtaining mechanistic insights into how allosteric activators and inhibitors impact the loop and thereby exert their regulatory functions.
(116) Recently, there has been a concerted effort to find small molecule inhibitors of the glutaminase enzymes using medicinal chemistry approaches (Gross et al., Antitumor Activity of the Glutaminase Inhibitor CB-839 in Triple-Negative Breast Cancer, Mol. Cancer Ther. 13:890-901 (2014); Shukla et al., Design, Synthesis, and Pharmacological Evaluation of Bis-2-(5-Phenylacetamido-1,2,4-Thiadiazol-2-yl)Ethyl Sulfide 3 (BPTES) Analogs as Glutaminase Inhibitors, J. Med. Chem. 55:10551-63 (2012); Zimmermann et al., Allosteric Glutaminase Inhibitors Based on a 1,4-Di(5-Amino-1,3,4-Thiadiazol-2-yl)Butane Scaffold, ACS Med. Chem. Lett. 7:520-24 (2016); McDermott et al., Design and Evaluation of Novel Glutaminase Inhibitors, Bioorg. Med. Chem. 24:1819-39 (2016), each of which is hereby incorporated by reference in its entirety). The differences between the allosteric activators inorganic phosphate and sulfate and the two most commonly used allosteric inhibitors, CB-839 and BPTES, were first compared in fluorescence assays that directly monitor GAC tetramer formation. It was found that both allosteric activators and inhibitors induced the formation of GAC tetramers; however, inhibitors were distinguished from activators by their ability to better stabilize the tetrameric state. CB-839 appears to act similarly to BPTES, so that the addition of either drug enhances tetramer formation. However, the CB-839-bound GAC tetramers labeled with FRET pairs were much less able to undergo exchange with excess unlabeled GAC subunits compared with BPTES-bound tetramers. Overall, these results agree with previous observations that CB-839 acts through a similar mechanism as BPTES, by binding at the dimer-dimer interface to promote the formation of an inactive tetramer, but with CB-839 having a significantly slower off rate compared with BPTES.
(117) To address how allosteric activators and inhibitors both enhance GAC tetramer formation but exert opposing effects on enzyme activity, the available X-ray crystal structures of the KGA/GAC enzymes were examined and differences between the conformations of the activation loop were noticed. It was reasoned that, by comparing the activation loop in the BPTES-bound GAC structure versus that for free GAC, potential residues that, when substituted with the fluorescent amino acid tryptophan, may be able to be identified that would be sensitive to the dynamics of the loop. Indeed, it was found that the selective substitution of a single amino acid within the activation loop (specifically, changing phenylalanine 327 to a tryptophan residue) yields an enzyme that retains normal catalytic activity while providing a useful readout for the binding of allosteric inhibitors and activators. The native phenylalanine at position 327 has been shown previously to be an important residue for the activation of the KGA/GAC (GLS) isoforms (DeLaBarre et al., Full-Length Human Glutaminase in Complex with an Allosteric Inhibitor, Biochemistry 50:10764-70 (2011), which is hereby incorporated by reference in its entirety). Additionally, Phe-327 is one of only two residues that differ between the liver-type (GLS2) and kidney-type (GLS) glutaminase enzymes in the activation loop, where the residue corresponding to phenylalanine at position 323 on the GLS enzymes is a tyrosine in GLS2, and phenylalanine 327 in GLS corresponds to a serine in GLS2 (Thangavelu et al., Structural Basis for the Allosteric Inhibitory Mechanism of Human Kidney-Type Glutaminase (KGA) and Its Regulation by Raf-Mek-Erk Signaling in Cancer Cell Metabolism, Proc. Natl. Acad. Sci. U.S.A. 109:7705-10 (2012); DeLaBarre et al., Full-Length Human Glutaminase in Complex with an Allosteric Inhibitor, Biochemistry 50:10764-70 (2011), each of which is hereby incorporated by reference in its entirety). GLS and GLS2 have been reported to have different catalytic properties (Curthoys et al., Regulation of Renal Ammoniagenesis: Purification and Characterization of Phosphate-Dependent Glutaminase from Rat Kidney, Arch. Biochem. Biophys. 174:82-89 (1976), which is hereby incorporated by reference in its entirety), and it is of interest in this study that, of the various substitutions examined in the activation loop of GAC, only the F327W mutant provided a useful readout for both allosteric activators and inhibitors.
(118) CB-839 has been suggested to be a more potent inhibitor of glutaminase activity compared with BPTES, with reported IC.sub.50 values of 30 nM for CB-839 and between 80 nM and 3 M for BPTES (Thangavelu et al., Structural Basis for the Allosteric Inhibitory Mechanism of Human Kidney-Type Glutaminase (KGA) and Its Regulation by Raf-Mek-Erk Signaling in Cancer Cell Metabolism, Proc. Natl. Acad. Sci. U.S.A. 109:7705-10 (2012); Robinson et al., Novel Mechanism of Inhibition of Rat Kidney-Type Glutaminase by Bis-2-(5-Phenylacetamido-1,2,4-Thiadiazol-2-yl)Ethyl Sulfide (BPTES), Biochem. J. 406:407-14 (2007); Hartwick & Curthoys, BPTES Inhibition of hGA124-551, a Truncated Form of Human Kidney-Type Glutaminase, J. Enzyme Inhib. Med. Chem. 27:861-67 (2012); DeLaBarre et al., Full-Length Human Glutaminase in Complex with an Allosteric Inhibitor, Biochemistry 50:10764-70 (2011); Gross et al., Antitumor Activity of the Glutaminase Inhibitor CB-839 in Triple-Negative Breast Cancer, Mol. Cancer Ther. 13:890-901 (2014); Shukla et al., Design, Synthesis, and Pharmacological Evaluation of Bis-2-(5-Phenylacetamido-1,2,4-Thiadiazol-2-yl)Ethyl Sulfide 3 (BPTES) Analogs as Glutaminase Inhibitors, J. Med. Chem. 55:10551-63 (2012); Thomas et al., Small Molecule Glutaminase Inhibitors Block Glutamate Release from Stimulated Microglia, Biochem. Biophys. Res. Commun. 443:32-36 (2014), each of which is hereby incorporated by reference in its entirety). However, the direct binding of these inhibitors to KGA or GAC has never been compared, which has now been able to be done by taking advantage of the quenching of the intrinsic tryptophan fluorescence of the GAC.sub.F327W mutant induced by these compounds. Based on their titration profiles, it was determined that the two inhibitors have comparable dissociation constants (30 nM and 70 nM for CB-839 and BPTES, respectively (
(119) The fluorescence assays described here for GAC tetramer formation, together with those for inhibitor binding and enzyme catalysis, allow for a more detailed analysis of how different classes of small molecule inhibitors interact with glutaminase to alter the activity of this important metabolic enzyme.
(120) The real-time fluorescence assays have provided an important and additional benefit; namely, the ability to directly monitor the interactions of allosteric anionic activators with GAC. Allosteric activators, such as inorganic phosphate, have been shown to promote changes in the oligomeric state of KGA/GAC enzymes that accompany their activation. However, although KGA/GAC oligomer formation has been consistently observed, the binding site for these anionic activators and the mechanistic outcome of oligomer formation are still not well understood. Recent studies have shown that mutations along the activation loop constitutively activate KGA/GAC so that anionic activators elicit no additional stimulatory effects (DeLaBarre et al., Full-Length Human Glutaminase in Complex with an Allosteric Inhibitor, Biochemistry 50:10764-70 (2011); McDonald et al., Effect of Lysine to Alanine Mutations on the Phosphate Activation and BPTES Inhibition of Glutaminase, Neurochem. Int 88:10-14 (2015); Ferreira et al., Active Glutaminase C Self-Assembles into a Supratetrameric Oligomer That Can Be Disrupted by an Allosteric Inhibitor, J. Biol. Chem. 288:28009-20 (2013); Li et al., Mechanistic Basis of Glutaminase Activation: A Key Enzyme That Promotes Glutamine Metabolism in Cancer Cells, J. Biol. Chem. 291:20900-10, each of which is hereby incorporated by reference in its entirety), suggesting that they exert their actions through the activation loop. The findings show that allosteric activators like inorganic phosphate induce an enhancement of the tryptophan fluorescence of the GAC.sub.F327W mutant, directly correlating with their ability to stimulate GAC activity. These results strongly support the idea that allosteric anionic activators bind at the dimer-dimer interface, changing the conformation and environment of the loop to varying degrees to promote activated GAC tetramers (
(121) In conclusion, Examples 1-8 highlight the important roles the activation loop of GAC plays in regulating enzyme activity. The results presented here show that BPTES and CB-839 interact with the activation loop in a similar manner and demonstrate the utility of this novel F327W mutant and accompanying fluorescence assays for screening the effects bisthiadiazoles exert on the GLS enzymes. Similarly, it is shown that allosteric anionic activators directly impact the conformational dynamics of the activation loop, pointing to the potential usefulness of the F327W mutant in screening for additional small molecules capable of activating these enzymes. It is also expected that other GLS proteins having a corresponding mutation may also be used in these screening assays.
(122) Although preferred embodiments have been depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are therefore considered to be within the scope of the invention as defined in the claims which follow.