PREPARATION AND USE OF GINSENTIDES AND GINSENTIDE-LIKE PEPTIDES

20200277343 ยท 2020-09-03

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to the methods of solid-phase peptide synthesis or recombinant production of ginsentide or ginsentide-like peptides or salts thereof. Further provided are uses of the ginsentide or ginsentide-like peptides or salts thereof as 1-adrenergic receptor antagonists and vasorelaxants, nitric oxide-boosting agents, anti-thrombotic agents, anti-atherosclerotic agents, as protective agents against doxorubicin-induced cardiotoxicity, anti-ageing and adaptogenic agents, nutraceuticals, health supplements, or cosmetic ingredients.

    Claims

    1. A method of solid-phase peptide synthesis of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65% sequence identity with the peptide of (i) over its entire sequence, wherein the method comprises the steps of: (a) synthesizing the ginsentide or ginsentide-like peptide on a solid support by stepwise coupling of Fmoc-protected; (b) cleaving the ginsentide or ginsentide-like peptide from the solid support and deprotecting the peptide; and subsequently, (c) performing organic oxidative folding of the ginsentide or ginsentide-like peptide to form native disulfide connections.

    2. The method of claim 1, wherein step (a) comprises the steps of: (i) deprotecting a first amino acid linked to the solid support by removing protective chemical groups from the first amino acid; (ii) activating chemical groups on a second amino acid to prepare the second amino acid for coupling with the first amino acid; (iii) coupling the activated second amino acid to the deprotected first amino acid to form a peptide from the first and second amino acids; and (iv) successively deprotecting, and coupling a plurality of amino acids into the growing peptide chain until the ginsentide or ginsentide-like peptide is synthesized.

    3. The method of claim 2, wherein the method comprises accelerating at least one of the deprotecting, activating, and coupling steps by applying microwave energy.

    4. The method of claim 1, wherein the organic oxidative folding is performed in non-aqueous conditions and performed in organic solvents.

    5. The method of claim 1, wherein the organic oxidative folding comprises folding the ginsentide or ginsentide-like peptide in an organic solvent comprising cysteamine and/or morpholine.

    6. The method of claim 1, wherein the organic oxidative folding is performed at 4 C.

    7. The method of claim 1, wherein the method comprises purifying the folded ginsentide or ginsentide-like peptide or salt thereof.

    8. A method of recombinantly preparing a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65% sequence identity with the peptide of (i) over its entire sequence, wherein the method comprises the steps of: (a) providing a host cell comprising a polynucleotide, wherein the polynucleotide encodes a polypeptide comprising Maltose-binding protein having the amino acid sequence set forth in SEQ ID NO:65, a enterokinase cleavage sequence having the amino acid sequence set forth in SEQ ID NO:66, and the ginsentide or ginsentide-like peptide or salt thereof; (b) culturing the host cell in a growth medium under conditions allowing production of the polypeptide, and recovering the polypeptide from the medium; and (c) generating the ginsentide or ginsentide-like peptide or salt thereof by cleaving the polypeptide using enterokinase.

    9. The method of claim 8, wherein the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs: 67-80.

    10. The method of claim 8, wherein the method further comprises purification of the recombinantly produced polypeptide prior to the enterokinase cleavage.

    11. The method of claim 8, wherein the method further comprises purification of the ginsentide or ginsentide-like peptide or salt thereof by anion-exchange chromatography and/or reverse-phase chromatography after the enterokinase cleavage.

    12-18. (canceled)

    19. A pharmaceutical composition comprising a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO: 1-64; or (ii) the amino acid sequence sharing at least 65% sequence identity with the peptide of (i) over its entire sequence.

    20. A method of treating and/or preventing thrombosis in a subject in need thereof, the method comprising administering to the subject the pharmaceutical composition of claim 19.

    21. A method of treating and/or preventing anxiety in a subject in need thereof, the method comprising administering to the subject the pharmaceutical composition of claim 19.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0036] The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings.

    [0037] FIG. 1. Schematic diagram of the adaptogenic effects of ginsentides. TP1: SEQ ID NO:1.

    [0038] FIG. 2. Schematic flow for the chemical synthesis of ginsentides.

    [0039] FIG. 3. Oxidative folding strategies for synthetic ginsentide TP1.

    [0040] FIG. 4. Comparison of natural and synthetic Ginsentide TP1 using UHPLC and MALDI-MS.

    [0041] FIG. 5. Comparison of natural and synthetic Ginsentide TP1 using 1D and 2D NMR.

    [0042] FIG. 6. Functional comparisons of natural and synthetic Ginsentide TP1 on nitric oxide production.

    [0043] FIG. 7. Recombinant expression scheme for ginsentides. Peptide fragment DDDDK: SEQ ID NO:66.

    [0044] FIG. 8. IPTG induced MBP-TP1 fusion protein expression.

    [0045] FIG. 9. Purification of MBP-TP1 fusion protein by amylose column. S Cell lysate; FTColumn flowthrough; W11.sup.st wash; W22.sup.nd Wash; EEluted proteins

    [0046] FIG. 10. Removal of MBP tag by enterokinase.

    [0047] FIG. 11. Mass spectrometry profile before and after enterokinase cleavage.

    [0048] FIG. 12. RP-HPLC and MALDI-TOF MS profiles of native and reduced kB1. Panel A and B show the RP-HPLC profiles of native and reduced kB1 with N and R representing native and reduced respectively. Panel C and D show the MS profiles of the peaks N and R accordingly. Panel E and F are the zoom-in profile of MS results in panel C and D, which demonstrate the difference between these two masses.

    [0049] FIG. 13. RP-UPLC profiles of oxidative folding of kB1 showing the effect of different bases. A. Conditions contained different concentrations of pyridine from 5-50%; B. Conditions contained different concentrations of imidazole from 5-15%; C. Conditions contained different concentrations of morpholine from 5-30%. All conditions contained 100 M peptide, 100 mM cysteamine and 10% (v/v) DMSO. The profiles show the reaction performed for 1 h. R and N represent the reduced and native form of kB1. I represents intermediate form of kB1.

    [0050] FIG. 14. RP-UPLC profiles of oxidative folding of kB1 showing the effect of cysteamine and DMSO as redox agents. R and N represent the reduced and native forms of kB1 while I indicates the folding intermediate.

    [0051] FIG. 15. RP-HPLC profiles of oxidative folding of kB1 with different thiols as reducing reagents. A. Reduced kB1; B. Conditions containing 10 mM mercaptoacetic acid; C. Conditions containing 10 mM 2-mercaptoethanol; D. Conditions containing 10 mM cysteamine. R and N represent the reduced and native forms of kB1 while I indicates the folding intermediate. All conditions contained 100 M peptide, 100 mM thiol, 10% (v/v) DMSO, 85% 2-propanol and 5% morpholine.

    [0052] FIG. 16. .sup.1H NMR spectra comparison of the natural kB1 (red) and the synthetic one (blue). Both peptides were dissolved in 90% H.sub.2O/10% D.sub.2O at pH 4.3. The spectra were obtained by a NMR spectrometer (600 MHz) at 298K.

    [0053] FIG. 17. Scheme for the purification of ginsentides from plant materials.

    [0054] FIG. 18. Ginsentide TP1, TP3 and TP8 antagonized phenylephrine-induced aortic ring contraction.

    [0055] FIG. 19. Ginsentide TP1 does not antagonized KCI-induced contracted aortic ring.

    [0056] FIG. 20. D2O exchange of Ginsentide TP1 by 1D NMR.

    [0057] FIG. 21. Amino acid sequence, second and tertiary structures of ginsentides Primary and secondary structure (top left), the overall lay of synthetic and natural TP1 (top right), the CPK model of the hydrophobic surface of TP1 (middle panels) and the 3D structure of TP5 and TP8 as determined by NMR (bottom panel). TP1: SEQ ID NO:1.

    [0058] FIG. 22. Mass spectrometry profiles of the aqueous extracts of roots of (A) Panax ginseng, (B) Panax quinquefolius and (C) Panax notoginseng using MALDI-TOF MS.

    [0059] FIG. 23. Mass spectrometry profiles of the aqueous extracts of (A) roots, (B) seeds, (C) leaves and (D) flowers of Panax ginseng using MALDI-TOF MS.

    [0060] FIG. 24. De novo sequencing of ginsentide TP1. Enzymatic digestion of S-reduced peptides by chymotrypsin and trypsin generated one major fragment each with m/z values of 2459 (SEQ ID NO:131) and 2831 (SEQ ID NO:132), respectively. The sequence of fragments were deduced using the b-ions and y-ions generated from MALDI-TOF MS/MS.

    [0061] FIG. 25. (A) HPLC profile of the partially S-reduced and S-alkylated ginsentide TP1. Peaks 1, 2, 3, N, and RA contained the 3SS, 2SS, 1SS, native peptide, and fully S-NEM alkylated peptides, respectively. A schematic representation of ginsentide TP1 disulfide mapping is also shown; (B) The putative unfolding pathway of ginsentide TP1 as determined by disulfide connectivity mapping. Under our experimental conditions, the Cys I-IV bond was the first to be reduced to generate the 3SS species, followed by the Cys V-VIII bond, generating the 2SS species, then the Cys III-VII bond generating the 1SS species, and lastly the Cys II-VI bond. TP1: SEQ ID NO:1.

    [0062] FIG. 26. Ginsentide-encoding transcripts from Panax ginseng, Panax quinquefolius and Panax notoginseng deduced from de novo assembly of transcriptome data from NCBI database. The transcriptome data used are listed as follow: Panax notoginseng flower (SRX378878), Panax quinquefolius flower (SRX062267), Panax ginseng flower (SRX181263), Panax ginseng flower (SRX378873), Panax notoginseng leaf (SRX378880), Panax quinquefolius seed (SRX529365), Panax ginseng root (ERX137460). SPase: signal peptidase. The amino acid sequences are set forth in SEQ ID NOs: 133-146.

    [0063] FIG. 27. shows that ginsentide TP1 increases cellular NO synthesis from human endothelial cells (HUVEC-CS). Comparatively, ginsentide TP1 shows a three-fold increase in potency and magnitude NO release than both ginsenosides Rb1 and Rg1. Ginsentide TP1, TP3, TP8 and synthetic TP1 shows comparable cellular NO release.

    [0064] FIG. 28. Ginsentide TP1 activates endothelial nitric oxide synthase. Representative western blot analysis on the dose-dependent and time-dependent effects of ginsentide TP1 on phosphorylated eNOS (p-eNOS) accumulations in HUVEC-CS cells. All results were expressed as meanS.E.M. from three separate experiments. * P<0.05 compared to ginsentide tP1 treated-group.

    [0065] FIG. 29. Ginsentide TP1 induced nitric oxide formation involves PI3K/Akt signaling. HUVEC-CS cells were exposed to ginsentide TP1 and (A) MK 2206 (Akt inhibitor) or (B) LY294002 (PI3K inhibitor) for 1 h. Intracellular NO production was measured by DAF-2 DA staining and expressed as normalized fluorescence intensity (C) Representative western blot analysis of time-dependent effects of ginsentide TP1 on Akt phosphorylation in HUVEC-CS cells. All results were expressed as meanS.E.M. from three separate experiments. * P<0.05 compared to ginsentide TP1 treated-group.

    [0066] FIG. 30. D.sub.2O exchange of Ginsentide TP1 by 1D NMR.

    [0067] FIG. 31. Ginsentide TP1 does not show (A) cytotoxic activities in Huh7 cells and (B) hemolytic effects. Ginsentide TP1 does not induce (C) IL-6, (D) IL-8, (E) IL-10, and (F) TNF- release from THP-1 cells. LPS was used as positive control. All results were expressed as meanS.E.M. (n=3). *P<0.05 compared to control group.

    [0068] FIG. 32. Ginsentide TP1 antagonizes P2y12 activation. Ginsentide TP1, ginsenosides Rb1 and Rg1 were tested in antagonist mode with the P2y12 Arrestin Biosensor Assay using 6.4 nM 2-methylthio-ADP to induce P2y12 activation. P2y12 activation was measured by relative luminescence units and expressed as percentage of inhibition relative to blank.

    [0069] FIG. 33. D.sub.2O exchange of Ginsentide TP1 by 1D NMR.

    [0070] FIG. 34. Ginsentide TP1 inhibits platelet aggregation in vivo. 10 mg/kg ginsentide TP1 was injected to SD rat intravenously for 20 min. Platelet-rich plasma was isolated by centrifugation. Platelet aggregation was examined upon ADP or arachidonic acid stimulation.

    [0071] FIG. 35. Pull down assay followed by LC-MS/MS and western blot analysis revealed that ginsentide TP1 interacts with ESAM.

    [0072] FIG. 36. Ginsentide TP1 inhibited basal monocyte adhesion to endothelium. Ginsentide TP1 was co-incubated with CFSE-labelled THP-1 monocytic cell and HUVEC-CS endothelial monolayer for 1 h. Adhesion inhibitory peptides (GRGDSP) was used as a control.

    [0073] FIG. 37. Heparin-binding properties of ginsentides using heparin HPLC affinity column. Ginsentide TP1, TP3 and TP9 retented in a heparin HPLC affinity column, but not TP2, TP5, TP8 and SIGGIR (negative control).

    [0074] FIG. 38. (A) Modeling the interaction between ginsentide TP1 (SEQ ID NO:1) and heparin sulfate using the ClusPro Version 2.0 server. (B) Comparison of the synthetic peptide Ac-KSGGAW-NH.sub.2 (SEQ ID NO:147) and its alanine-substituted analogues (Ac-ASGGAW-NH.sub.2 (SEQ ID NO:148), Ac-KAGGAW-NH.sub.2 (SEQ ID NO:149) and Ac-KSGGAA-NH.sub.2 (SEQ ID NO:150) on heparin binding using heparin HPLC affinity column.

    [0075] FIG. 39. Representative images of zebrafish embryos after DOX-treatment with or without ginsentide.

    [0076] FIG. 40. Heartbeat of zebrafish embryos after ginsentides-treatment.

    [0077] FIG. 41. Comparison of ventricular contractility after co-treatment of DOX with ginsentide.

    [0078] FIG. 42. Cell viability of H9c2 cells after treatment with ginsentides or ginsenosides.

    [0079] FIG. 43. Cell viability of H9c2 cells after co-treatment of DOX with ginsentides or ginsenosides Rg1, Rb1 and Re.

    [0080] FIG. 44. Effects of ginsentides on cell viability in DOX-treated breast cancer cell line (MDA-MB-231).

    [0081] FIG. 45. Plasma concentration of ginsentides after intravenous injection and oral administration in mice.

    [0082] FIG. 46. Effect of ginsentide (TP1) upon HUVEC-CS cellular proteome. Cells were treated with ginsentide and whole cellular proteome was studied through TMT based quantitative proteomic approach. (a) TMT ratio distribution of the invented dataset. (b) Differently expressed proteins in HUVEC-CS cells during ginsentide treatment. (c). Functions classification of differentially regulated proteins upon ginsentide treatment. (d) Relative protein levels of TERF2 after ginsentide treatment.

    [0083] FIG. 47. Effect of ginsentide (TP1) on hypoxic HUVEC-CS cellular proteome.

    [0084] FIG. 48. Effects of ginsentide on leukocyte adhesion to hypoxic endothelial cells.

    [0085] FIG. 49. Effects of ginsentide on hypoxia-induced adhesion molecule expressions in endothelial cells.

    [0086] FIG. 50. Effects of ginsentide on the accumulation of unfolded protein in hypoxic endothelial cells.

    [0087] FIG. 51. Effects of ginsentide on the unfolded protein response pathway in hypoxic endothelial cells.

    [0088] FIG. 52. Effects of ginsentide on apoptosis pathway in endothelial cells.

    [0089] FIG. 53. Effects of ginsentides on the survivability of hypoxic endothelial cells.

    [0090] FIG. 54. Ginsentides reduced unfolded proteins in cardiomyocyte, vascular smooth muscle cells, and myocytes.

    [0091] FIG. 55. Ginsentides reduced reactive oxygen species production in hypoxic endothelial cells.

    [0092] FIG. 56. Ginsentides increased nitric oxide production in hypoxic endothelial cells.

    [0093] FIG. 57. Ginsentide-like precursor sequences from NCBI and OneKp transcriptome database. The amino acid sequences are set forth in SEQ ID NOs:151-200.

    DETAILED DESCRIPTION OF THE INVENTION

    [0094] The following detailed description refers to, by way of illustration, specific details and embodiments in which the invention may be practiced. These embodiments are described in sufficient detail to enable those skilled in the art to practice the invention. Other embodiments may be utilized and structural, and logical changes may be made without departing from the scope of the invention. The various embodiments are not necessarily mutually exclusive, as some embodiments can be combined with one or more other embodiments to form new embodiments.

    [0095] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. The singular terms a, an, and the include plural referents unless context clearly indicates otherwise. Similarly, the word or is intended to include and unless the context clearly indicates otherwise. The term comprises means includes. In case of conflict, the present specification, including explanations of terms, will control.

    [0096] In a first aspect, the invention relates to a method of solid-phase peptide synthesis of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, wherein the method comprises the steps of: [0097] (a) synthesizing the ginsentide or ginsentide-like peptide on a solid support by stepwise coupling of Fmoc-protected, optionally further suitably side-chain protected, amino acids, dipeptides and/or oligopeptides in a linear C-terminal to N-terminal fashion, wherein addition of the glycine residue at the position corresponding to position 24 of SEQ ID NO:1 is mediated by Fmoc-(Dmb)Gly-OH; [0098] (b) cleaving the ginsentide or ginsentide-like peptide from the solid support and deprotecting the peptide; and subsequently, [0099] (c) performing organic oxidative folding of the ginsentide or ginsentide-like peptide to form native disulfide connections.

    [0100] The terms peptide, polypeptide and protein are used interchangeably herein and refer to polymers of at least two amino acids connected by peptide bonds. The terms also encompass an amino acid polymer that has been modified naturally or artificially; for example, by disulfide bond formation, glycosylation, lipidation, acetylation, or phosphorylation. The term amino acid refers to natural and/or unnatural or synthetic amino acids, including both the D and L optical isomers, amino acid analogs (for example norleucine is an analog of leucine) and derivatives known in the art. The term natural amino acid, as used herein, relates to the 20 naturally occurring L-amino acids, namely Gly (G), Ala (A), Val (V), Leu (L), Ile (I), Phe (F), Cys (C), Met (M), Pro (P), Thr (T), Ser (S), Glu (E), Gln (Q), Asp (D), Asn (N), His (H), Lys (K), Arg (R), Tyr (Y), and Trp (W). Generally, in the context of the present application, the peptides and polypeptides are shown in the N- to C-terminal orientation.

    [0101] The term pharmaceutically acceptable salt as used herein means those salts of a peptide of interest that are safe and effective for administration to a mammal and that possess the desired biological activity.

    [0102] The term sequence identity as used herein refers to the extent that two sequences are identical (i.e., on a nucleotide-by-nucleotide basis for nucleic acids or amino acid-by-amino acid basis for peptides) over a window of comparison. This is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.

    [0103] It should be noted that the sequence identity is always calculated in relation to a reference sequence over its entire length. In this connection, the term window of comparison, as used herein, refers to a conceptual segment of contiguous nucleotide or amino acid positions wherein a nucleotide or amino acid sequence may be compared to a reference sequence and wherein the portion of the nucleotide or amino acid sequence in the comparison window may comprise additions or deletions (i.e., gaps) while the reference sequence does not comprise additions or deletions for optimal alignment of the two sequences.

    [0104] Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman, Adv. Appl. Math. 1981, 2:482; by the alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 1970, 48:443; by the search for similarity method of Pearson and Lipman, Proc. Nat. Acad. Sci. U.S.A. 1988, 85:2444; or by computerized implementations of these algorithms (including, but not limited to CLUSTAL in the PC/Gene program by Intelligentics, Mountain View, Calif.; and GAP, BESTFIT, BLAST, FASTA, or TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis., U.S.A.). The CLUSTAL program is well described by Higgins and Sharp, Gene 1988, 73:237-244; Higgins and Sharp, CABIOS 1989, 5:151-153; Corpet et al., Nucleic Acids Res. 1988, 16:10881-10890; Huang et al, Computer Applications in the Biosciences 1992, 8:155-165; and Pearson et al., Methods in Molecular Biology 1994, 24:307-331. Alignment is also often performed by inspection and manual alignment.

    [0105] It should be noted that the peptide sequences described herein only define the primary structure of the peptides, i.e. the sequence of amino acids, without including any information about the disulfide bridges (SS) that may be existing in the peptides. Disulfide bridges are produced by the oxidative folding of two different thiol groups (SH) present in the peptides. The peptides described herein contain at least eight different thiol groups (i.e. eight cysteine residues each containing a thiol group) and may theoretically form zero, one, two, three, four, or more intramolecular disulfide bridges. However, it should be understood that the peptides in the context of the whole application comprise native disulfide connectivity (i.e. Cys I-IV, Cys II-VI, Cys III-VII, and Cys V-VIII) as illustrated in Table 1.

    [0106] Preferred embodiments of ginsentides and ginsentide-like peptides in accordance with the present application are described in Table 1 and Table 2.

    TABLE-US-00001 TABLE 1 Amino acid sequence of ginsentides mRNA Ginsentide Amino acid sequence SEQ ID expression TP1 text missing or illegible when filed 1 PG, PN TP2 text missing or illegible when filed 2 PG, PQ TP3 text missing or illegible when filed 3 PG, PQ TP4 text missing or illegible when filed 4 PG TP5 text missing or illegible when filed 5 PG, PQ TP6 text missing or illegible when filed 6 PG, PQ TP7 text missing or illegible when filed 7 PG TP8 text missing or illegible when filed 8 PQ TP9 text missing or illegible when filed 9 PQ TP10 text missing or illegible when filed 10 PQ TP11 text missing or illegible when filed 11 PQ TP12 text missing or illegible when filed 12 PQ TP13 text missing or illegible when filed 13 PN TP14 [00001]embedded image 14 PQ text missing or illegible when filed indicates data missing or illegible when filed

    [0107] Each G in bold indicates a glycine residue introduced by Fmoc-(Dmb)Gly-OH during the solid-phase peptide synthesis.

    [0108] PG: Panax ginseng; PN: Panax notoginseng; PQ: Panax quinquefolius.

    [0109] Disulfide connectivity: Cys I-IV, Cys II-VI, Cys III-VII and Cys V-VIII.

    TABLE-US-00002 TABLE2 Aminoacidsequenceofpreferredginsentide-likepeptides SEQ ID Source Aminoacidsequence 15 Angiopterisevecta CIPKGGWCLFDIMGCCKPCGCLAGFCWVVGDDCN 16 Amaranthusretroflexus CVPKGTPCLYKPEPCCGANCFCDTSAYTFQYVCKCY 17 Agrostisstolonifera CLPSGGFCMFRPTDCCGNCGCLYPVGVCYGSRCEE 18 Blasiasp. CLKNGEFCWGDPSGCCGNCGCLIIPGVCYGTGC 19 Bazzaniatrilobata CLNGGGYCGSFTREACCYNCVCMMAFCVCG 20 Coffeacanephora CSPFGKPCRYNPWGCCDSCVCVATPADEGRCLGNC 21 Daucuscarota CLPNGGFCMFRPMDCCGSCGCLYPVGVCFGTGC 22 Daucuscarota CYPKGHECRTDPTLCCHNCGCIMPVGVCFGINC 23 Eragrostiscurvula CLPSGGFCMFRPKDCCGSCGCLYPIGVCFGSSC 24 Eleusinecoracana CIPMGGFCLFNLRGCCGSCGCLAGFCWRDASSCDL 25 Eleusinecoracana CIPMGGFCLGNLRGCCGSCGCLAGFCWRPASSCDS 26 Elymuswawawaiensis CLPSGGFCMFRPKDCCGNCGCLYPIGVCYGSRCEE 27 Gossypiumhirsutum CKPKGSFCLFDLQSCCRPCGCLAGWCYNIDHDCNEYT 28 Griselinialittoralis CISSGGFCMFNPRDCCGSCGCLYPMGICYGSSC 29 Gossypiumraimondii CKPIGSFCLFDLTSCCRPCGCLAGFCYNLDHNCNEYT 30 Gossypiumraimondii CKPKGSFCLFDLTSCCRPCGCLAGWCYNYDHECNEYT 31 Gossypiumraimondii CIAKGGFCLFDLTSCCRPCGCLAGWCYNIDHDCKEYT 32 Gossypiumraimondii CIAKGGFCLFDLTSCCRPCGCLAGWCYNIDHDCNEYA 33 Gossypiumraimondii CIAKGGFCLFDLTSCCRPCGCLAGWCYNIDHDCNEYT 34 Hibiscuscannabinus CIPKGGWCLFDIMGCCKPCGCLAGFCWVVGDDCN 35 Hibbertiagrossulariifolia CSPLGGKCGDLVECCSGCVCIWPTYTCVGHC 36 Hederahelix CQPFDAPCDTFYGFYCCGSCTCTYVDFWHTSRCTGSC 37 Heracleumlanatum CLPAGGFCMFRPMDCCGTCGCLYPVGVCFGNDC 38 Lennoamadreporoides CIGAGGFCMFNPMDCCGNCGCLYPVGICFGTGC 39 Microteamadreporoides CLNGGGYCGSFTREACCYNCVCMMAFCVCG 40 Mollugonudicaulis CKSAGEWCGFSWTDCCNSCGCLAGFCYGTSC 41 Myodocarpussp. CIPKGGFCLFDLRGCCGMCGCLAGVCFNYDHPCEE 42 Menyanthestrifoliata CLSSGGFCMFRPNDCCGNCGCLYPVGICYGTGC 43 Oryzasativa CLPAGGFCMFRPMDCCGNCGCLYPVGVCYGSRCEE 44 Pholismaarenarium CLPAGGFCMFRPMDCCGNCGCLYPVGVCYGSRCEE 45 Pholismaarenarium CISAGGFCFFDPMNCCGNCGCLYPVGICVGTNC 46 Polysciasfruticosa CSPLGGKCGDLVECCSGCVCIWPTYTCVGHC 47 Polysciasfruticosa CIPLGGDCTDLFDCCPGCVCIITDLTCDGNCFRGA 48 Polysciasfruticosa CLTLGLYCGGGSGECCSGCLCVYPTLTCRGNCYRGA 49 Phyllanthussp. CSDPGGYCVPFFQGCCNDCSCLDLGVVAGVCVCI 50 Populustrichocarpa CISSGGWCFTQPKNCCGNCGCLYPIGICFGSDC 51 Populustrichocarpa CISSGGWCFPNPKNCCGNCGCLYPIGICFGSDC 52 Populustremula CISSGGFCFTQPMNCCGNCGCLYPLGICYGSDC 53 Salixdasyclados CLPSGGFCMFQPMNCCGNCGCLYPIGVCYGSNC 54 Theobromacacao CLSAGGFCMFNPMDCCGNCGCLYPMGICYGSGC 55 Theobromacacao CLSAGGFCMFNPMDCCGNCGCLFPMGICYGSGC 56 Theobromacacao CLSAGGFCMFNPMDCCGNCGCLYPMGFCYGSGC 57 Theobromacacao CLSAGGFCMFNPMDCCGNCGCLYPLGFCYGSGC 58 Theobromacacao CLSAGGFCMFDPMDCCGNCGCLYPMGICYGSGC 59 Theobromacacao CLSAGGFCMFIPMDCCGNCGCLFLMGFCYGSGC 60 Theobromacacao CLSAGGFCMFIPMDCCGNCGCLFPMGFCYGSGC 61 Theobromacacao CLSAGGFCMFNPMDCCGNCGCLYPMGICYGSGC 62 Theobromacacao CPSAGGFCMFNPMDCCGNCGCLYPMGICYGSGC 63 Theobromacacao CLSAGGFCMFNPMDCCGNCGCLYPLGICYGSGC 64 Triticumaestivum CLPAGGFCMFRPMDCCGNCGCLYPAGVCYGTRCEE

    [0110] Solid-phase peptide synthesis or SPPS refers to the direct chemical synthesis of peptides, wherein an insoluble support is used as an anchor for the growing peptide chain, which is typically built up one amino acid at a time. The free N-terminal amine of a solid-phase attached peptide is coupled to an N-protected amino acid unit. This unit is then deprotected, revealing a new N-terminal amine to which a further amino acid unit may be attached. The general principle of SPPS is one of repeated cycles of such coupling-wash-deprotection-wash steps, adding, typically one amino acid at a time, until the peptide of the desired sequence and length has been synthesized. As will be understood by those skilled in the art it is possible, in principle, to couple N-protected peptides instead of single amino acids to the growing chain in one or more elongation cycles. The present invention also encompasses methods wherein one or more larger N-protected peptides, or oligopeptides, typically having a length of up to 20 amino acid, preferably up to 10 amino acids, more preferably up to 5 amino acids, still more preferably up to 4 amino acids are added to the growing chain. In a particularly preferred embodiment, a method as defined herein is provided, wherein step a) comprises stepwise coupling amino acids, dipeptides and/or tripeptides, preferably amino acids and/or dipeptides to the growing peptide chain. In a most preferred embodiment of the invention, step a) comprises stepwise coupling of single amino acids or building blocks (e.g. amino acid pairs) to the growing peptide chain.

    [0111] Preferably, in accordance with the present invention, the growing peptide is anchored to the resin through the terminal carboxyl group. Nevertheless, the use of certain linkers allowing for anchoring of the growing peptide-chain via a side-chain residue, is also envisaged and may even be preferred.

    [0112] The solid support for SPPS typically is a solid, non-soluble support material. For the purposes of the present invention, such a solid support comprises sites for anchoring of a first amino acid (or peptide). Such functional sites for anchoring of the peptide are termed linkers. If needed, other linker moieties such as e.g. more specialized, for instance more acid-labile, linkers may be grafted to the first, integral linkers on the premade solid support, which is often then referred to as a handle. Polymeric organic resin supports are the most common type of solid support material, typically comprising highly solvated polymers with an equal distribution of functional groups. Examples include Polystyrene (PS); Polyacrylamide (PA); polyethylene glycol (PEG); PEG-Polystyrene (PEG-PS) or PEG-Polyacrylamide (PEG-PA); and other PEG-based supports. The invention is not particularly limited with respect to the solid support material. The 2-chlorotritylchloride resin, Wang resin (4-Benzyloxybenzyl Alcohol resin) and PAM resin (4-hydroxymethyl-phenylacetamidomethyl), are particularly suitable solid support materials for methods of the present invention. Other suitable examples include, but are not limited to: PEG-HMPB (cross-linked PEG functionalized with 4-(4-Hydroxymethyl-3-methoxyphenoxy)butyric acid); Rink amide resin (4-(2,4-Dimethoxyphenyl-Fmoc-aminomethyl-phenoxy-resin); and Merrifield resin (copolymer of styrene and chloromethylstyrene cross-linked with divinylbenzene). Solid support materials should meet several requirements, besides being chemically inert and able to withstand the conditions of synthesis: solid support particles are preferably of conventional and uniform size, mechanically robust, easily filterable and highly accessible to the solvents allowing the penetration of the reagents and the enlargement of the peptide chain within its microstructure. Resins as used in the present invention are typically of standard mesh size, which is about 50-500 mesh, more preferably 100 to 400 mesh.

    [0113] As stated above, the present method concerns so-called Fmoc SPPS methods, wherein Fmoc (Fluorenylmethyloxycarbonyl) N-protected amino acids and peptides are added to the growing chain. Fmoc protection in solid support peptide synthesis has significant advantages because its removal involves very mild basic conditions (e.g. piperidine solution), such that it does not disturb the acid labile linker between the peptide and the resin. Fmoc N-protected amino acids are commercially available. Furthermore, reactions to produce Fmoc N-protected amino acids or peptides are common general knowledge for those skilled in the art.

    [0114] Each incoming amino acid that is added to the growing peptide chain is preferably also protected, where suitable, with a side-chain protecting group, which is typically acid-labile. Protection groups suitable for this purpose are well known in the art. Commonly employed carboxy-protection groups for Glutamine and Aspartic acid are e.g. Mpe, O-1-Adamantyl, O-benzyl and even simply alkyl esters may be used, though less common. For the sake of ease, typically and preferably tert-butyl groups are used. Tyrosine may typically be protected by protection groups such as tert-butyl ether or Z- or more preferably 2-Bromo-Z-esters. It is equally possible to use tritylalkohol protection groups such as 2-chloro-trityl or 4-methoxy or 4,4 methoxy-trityl groups. Preferably, a trityl or a tert-butyl (tBu) protection group is used, most preferably a tBu protection group, meaning the tyrosyl side chain is modified to a tertiary-butyl ether. The tBu group is only efficiently removed under strongly acidic condition. Suitable Arginine protective groups include 2,2,4,6,7-pentamethyldihydrobenzofuranyl-5-sulfonyl (Pbf), adamantyloxy-carbonyl and isobornyl-oxy-carbonyl, 2,2,5,7,8-pentamethylenchromanesulfonyl-6-sulfonyl (Pmc), 4-methoxy-2,3,6-trimethylbenzenesulfonyl (Mtr) and its 4-tert.butyl-2,3,5,6-tetramethyl homologue (Tart) or Boc, which are only cleaved under strongly acidic conditions. Preferably, Pbf, Pmc, Mtr, most preferably Pbf is used. Upon global deprotection of side chains under strongly acidic conditions, in usually aqueous medium, bystander-alkylation of deprotected tyrosine is not observed with Pmc, Mtr and Pbf. Serine and, Threonine typically may be protected by e.g. tert-butyl or trityl, most preferably tert-butyl. Other modes of protection are equally feasible, e.g. with benzyl, though less preferred since eventually requiring removal under less desirable condition. Similar considerations apply to protection of Lysine; typically and preferably, Lys is protected with Boc. Tryptophan must not necessarily be protected during solid-phase synthesis, though protection with typically Boc is evisaged. As regards side chain protection groups, the aforementioned is valid both for the natural L-amino acids as well as for their D-homologues.

    [0115] Therefore, in various embodiments, step (a) comprises the steps of: [0116] (i) deprotecting a first amino acid linked to the solid support by removing protective chemical groups from the first amino acid; [0117] (ii) activating chemical groups on a second amino acid to prepare the second amino acid for coupling with the first amino acid; [0118] (iii) coupling the activated second amino acid to the deprotected first amino acid to form a peptide from the first and second amino acids; and [0119] (iv) successively deprotecting, and coupling a plurality of amino acids into the growing peptide chain until the ginsentide or ginsentide-like peptide is synthesized.

    [0120] The abundance of glycine and cysteine residues in the ginsentide sequence usually poses synthetic challenges in the chemical synthesis thereof, especially in the C-terminus. Attempts to synthesize ginsentides by stepwise synthesis using solid-phase methods have failed because the C-terminal fragments formed aggregates, preventing a successful synthesis. The method described herein addresses these challenges. In particular, a strategically selected glycine residue, i.e. the one at the position corresponding to position 24 of SEQ ID NO:1, is alkylated by a reversible protecting group to prevent aggregation during the synthesis. Fmoc-(Dmb)Gly-OH is used for the addition of the glycine residue at this position, while Fmoc-Gly-OH may be used for the introduction of glycine residues at other positions.

    [0121] Coupling reagents for Fmoc peptide synthesis are well-known in the art. Coupling reagents may be mixed anhydrides, (e.g. propane phosphonic acid anhydride) or other acylating agents such as activated esters or acid halogenides (e.g. isobutyl-chloroformiate or ICBF), or they may be carbodiimides (e.g. 1-ethyl-3-(3-dimethylaminopropyl)-carbodiimide, diisopropyl-carbodiimide, dicyclohexyl-carbodiimide), activated benzotriazine-derivatives (e.g. 3-(diethoxyphosphoryloxy)-1,2,3-benzotriazine-4(3H)-one or DEPBT) or uronium or phosphonium salt derivatives of benzotriazol. In view of best yield, short reaction time and protection against racemization during chain elongation, it is preferred that the coupling reagent is selected from the group consisting of uronium salts and phosphonium salts of benzotriazol capable of activating a free carboxylic acid function along with that the reaction is carried out in the presence of a base. Suitable and likewise preferred examples of such uronium or phosphonium coupling salts are e.g. HBTU (O-1H-benzotriazole-1-yl)-N,N,N,N-tetramethyl uronium hexafluorophosphate), BOP (benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate), PyBOP (Benzotriazole-1-yl-oxy-tripyrrolidinophosphonium hexafluorophosphate), PyAOP, HCTU (O-(1H-6-chloro-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), TCTU (O-1H-6-chloro benzotriazole-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate), HATU (O-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), TATU (O-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate), TOTU (O-[cyano(ethoxycarbonyl)methyleneamino]-N,N,N,N-tetramethyluronium tetrafluoroborate), HAPyU (O-(benzotriazol-1-yl)oxybis-(pyrrolidino)-uronium hexafluorophosphate.

    [0122] For coupling of the Fmoc amino acids to the peptide, the carboxyl group is usually activated. This is important for speeding up the reaction. There are two main types of activating groups: carbodiimides and triazolols. The use of these activating coupling additives is particularly preferred when using the highly activating uronium or phosphonium salt coupling reagents. Most preferably the coupling additive is a N-hydroxy-benzotriazol derivative (or 1-hydroxy-benzotriazol derivative) or is an N-hydroxy-benzotriazine derivative. Suitable examples include N-hydroxy-succinimide, N-hydroxy-3,4-dihydro-4-oxo-1,2,3-benzotriazine (HOOBt), 1-hydroxy-7-azabenzotriazole (HOAt) and N-hydroxy-benzotriazole (HOBt). N-hydroxy-benzotriazine derivatives are particularly preferred, in a most preferred embodiment, the coupling reagent additive is hydroxy-3,4-dihydro-4-oxo-1,2,3-benzotriazine. Most common carbodiimides are dicyclohexylcarbodiimide (DCC) and diisopropylcarbodiimide (DIC).

    [0123] Activation of the Fmoc amino acid is typically done in the presence of a base reagent. Preferably, the base reagent is a weak base whose conjugated acid has a pKa value of from pKa 7.5 to 15, more preferably of from pKa 7.5 to 10, and which base preferably is a tertiary, sterically hindered amine. Examples of such and further preferred are Hunig-base (N,N-diisopropylethylamine; DIPEA), N,N-dialkylaniline, 2,4,6-trialkylpyridine, 2,6-trialkylpyridine or N-alkyl-morpholine with the alkyl being straight or branched C.sub.1-C.sub.4 alkyl, more preferably it is N-methylmorpholine (NMM) or collidine (2,4,6-trimethylpyridine), most preferably it is collidine.

    [0124] The amount of the various reactants in the coupling reaction can and will vary greatly. Reagents are typically used in large excess to speed-up the reaction and drive it to completion. Typically the amount of solid support to the amount of Fmoc-amino acid will be a molar ratio ranging from about 1:1 to 1:10. In one embodiment, the amount of solid support to the amount of Fmoc-amino acid to the amount of activating compound is a molar ratio of about 1:4. The reaction conditions for the coupling steps, such as reaction time, temperature, and pH may vary without departing from the scope of the invention. The coupling temperature is usually in the range of from 15 to 30 C., especially where using phosphonium or uronium type coupling reagents. Typically, a temperature of about 20 to 25 C. is applied for coupling.

    [0125] In various embodiments, the method comprises accelerating at least one of the deprotecting, activating, and coupling steps by applying microwave energy.

    [0126] Microwave energy applied to the contents of the reaction vessel during the deprotecting, activating, coupling, and cleaving steps greatly decreases the length of time necessary to complete these reactions. The method for applying microwave energy may be moderated by the microwave source in such a way as to provide the fastest reaction time while accumulating the least amount of heat, thus more microwave energy may be applied and heat-associated degradation of the reaction contents does not occur. This method may include, but not limited to, spiking the microwave energy in large amounts for short lengths of time.

    [0127] The method may include cooling the reaction vessel and thus its contents, during and between applications of microwave energy up to and including the final cleaving step. The cooling mechanism of the method operates during amino acid extension cycles, the term cycle used herein to refer to the deprotection, activation, and coupling necessary to link one amino acid to another. The cooling system can also operate during and between applications of microwave energy in a given cycle to keep the bulk temperature of the reaction contents down. The cooling system can also operate when the complete peptide is cleaved from the resin. Alternatively, by controlling the power rather than strictly controlling the temperature, a desired control over the progress of a reaction can also be provided.

    [0128] It should be noted that the amino acid sequence of any one of SEQ ID NOs:1-64 as described above only defines the primary structure of the ginsentide or ginsentide-like peptide, i.e. the sequence of amino acids, without including any information about the disulfide bridges (SS) that may be existing in the peptide.

    [0129] Disulfide bridges are produced by the oxidative folding of two different thiol groups (SH) present in the peptide. The peptide described herein contains eight different thiol groups (i.e. eight cysteine residues each containing a thiol group) and therefore may form zero, one, two, three, or four intramolecular disulfide bridges. The number of possible disulfide bridge connectivity patterns (cysteine pairings) increases rapidly with the number of bound cysteines.

    [0130] To form native intracellular disulfide bonds, the synthesis process described herein is followed by oxidative folding of the synthesized peptide. The oxidative folding of a peptide or a protein refers to the concurrent formation of one or more native disulfide bonds of its reduced form to an oxidized folded form with identical disulfide connectivity with the native molecule. Disulfides in a peptide or and protein stabilizes its structure and maintains its biological activities. Many bioactive peptides are cysteine-rich, containing 2-5 disulfide bonds. However, the oxidative folding or refolding of synthetic or recombinant peptides or proteins, particularly those that are cysteine-rich, is invariably performed in an aqueous buffered solution and in the presence of a pair of reducing and oxidizing reagents to facilitate the correct disulfide bond formation by disulfide-exchange reactions. However, oxidative folding in an aqueous solution is a limiting step in their preparation because of unpredictability of generating isomeric and dead-end products. Chemoselective disulfide approaches which selectively form each disulfide pair stepwise can achieve correct pairing disulfide bonds, but the process is laborious and generally suffers from low yields. Approaches of oxidative folding for cysteine-rich peptides include air oxidation, the use of strong oxidizing agents or reduced/oxidized glutathiones and invariably in aqueous media at a basic pH, which may be referred to as aqueous oxidative folding. In this invention, an ultra-fast oxidative folding of peptides in non-aqueous conditions and performed in organic solvents (organic oxidative folding) has been achieved. Compared to the aqueous oxidative folding, the organic oxidative folding is remarkably faster.

    [0131] In various embodiments, organic oxidative folding comprises folding the ginsentide or ginsentide-like peptide in an organic solvent (preferably DMSO and/or isopropanol) comprising cysteamine and/or morpholine, e.g. in a folding buffer comprising 10% (v/v) DMSO, 84.36% (v/v) isopropanol, 5% (v/v) morpholine and 0.64% (v/v) Cysteamine (10M).

    [0132] In various embodiments, the organic oxidative folding is performed at 4 C.

    [0133] It is believed that the method of organic oxidative folding described herein enables the formation of native disulfide bonds of cysteine-rich peptides within minutes, e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, or 59 minutes, preferably within 5 minutes, which is remarkably faster than conventional methods known in the art such as aqueous oxidative folding.

    [0134] In various embodiments, the method comprises purifying the folded ginsentide or ginsentide-like peptide or salt thereof, preferably by RP-HPLC.

    [0135] Without wishing to be bound to any particular theory, it is believed that the ginsentide or ginsentide-like peptide prepared by the method described herein have four native disulfide bonds as described in Table 1. The prepared ginsentide or ginsentide-like peptide is identical to the natural peptide and is functionally indistinguishable therefrom.

    [0136] It should be noted that the methods of solid-phase peptide synthesis and organic oxidative folding described herein can also be used in the preparation of other cysteine-rich peptides. Such uses are also within the scope of the present application.

    [0137] In a second aspect, the invention relates to a method of recombinantly preparing a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, wherein the method comprises the steps of: [0138] (a) providing a host cell comprising a polynucleotide, wherein the polynucleotide encodes a polypeptide comprising Maltose-binding protein having the amino acid sequence set forth in SEQ ID NO:65, a enterokinase cleavage sequence having the amino acid sequence set forth in SEQ ID NO:66, and the ginsentide or ginsentide-like peptide or salt thereof; [0139] (b) culturing the host cell in a growth medium under conditions allowing production of the polypeptide, and recovering the polypeptide from the medium; and [0140] (c) generating the ginsentide or ginsentide-like peptide or salt thereof by cleaving the polypeptide using enterokinase.

    [0141] The polypeptide may be recombinantly expressed in a host cell or a cell-free system. The polypeptide may be produced using any known and well-established expression system and recombinant cell culturing technology. The polypeptide may also be produced in a host cell in a transgenic organism such as a goat or a plant.

    [0142] The term host cell for the purposes of the present invention refers to any cell that is commonly used for expression, i.e. transcription and translation of the polynucleotides for the production of the polypeptides of interest. In particular, the term host cell relates to prokaryotes, lower eukaryotes, plants, insect cells or mammalian cell culture systems. Host cells include, without limitation, bacterial, microbial, plant or animal cells, e.g. Escherichia coli, Bacillus subtilis; Saccharomyces cerevisiae, Pichia pastoris, or CHO cells.

    [0143] For recombinant production of the polypeptide typically a polynucleotide encoding the polypeptide is isolated and inserted into a replicable vector such as a plasmid for further cloning (amplification) or expression. In various embodiments a polynucleotide encoding a polypeptide according to the invention is included in a vector such as a plasmid. The term vector as used herein refers to a polynucleotide capable of transporting another nucleic acid to which it has been linked. In one embodiment, the vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. In another embodiment, the vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. The vectors disclosed herein can be capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors) or can be can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome (e.g., non-episomal mammalian vectors).

    [0144] When using recombinant techniques, the polypeptide can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the polypeptide is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 1992; 10: 163-167 describe a procedure for isolating polypeptides which are secreted to the periplasmic space of E coli. The polypeptide can either be directly obtained in a soluble and folded state or recovered in form of inclusion bodies, followed by renaturation in vitro. A further option is the use of specific host strains having an oxidizing intracellular milieu, which may thus allow the formation of disulfide bonds in the cytosol (Venturi M, Seifert C, Hunte C. J Mol Biol 2002; 315, 1-8).

    [0145] In various embodiments, the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs: 67-130.

    TABLE-US-00003 TABLE3 AminoacidsequencesofSEQIDNOs:65-80 SEQ ID Name NO Sequence Maltose- 65 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein IKVTVEHPDKLEEKFPQVAATGDGPDIIF WAHDRFGGYAQSGLLAEITPDKAFQDKLY PFTWDAVRYNGKLIAYPIAVEALSLIYNK DLLPNPPKTWEEIPALDKELKAKGKSALM FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDANAGKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LG enterokinase 66 DDDDK cleavage sequence Maltose- 67 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP1 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCKSGGAWCGFDPHGCCGNCGCL VGFCYGTGC Maltose- 68 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP2 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCKSSGAWCGFDPHGCCGNCGCL VGFCYGTGC Maltose- 69 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP3 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCKSAGTWCGFDPHGCCGSCGCL VGFCYGVSC Maltose- 70 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP4 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCLKNGEFCWGDPSGCCGNCGCL IIPGVCYGTGC Maltose- 71 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP5 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCKSSGAWCGFDPHGCCGNCGCL VGFCYGTDC Maltose- 72 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP6 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCIPGGGFCMFEPLSCCVNCGCI LVPGVCYCG Maltose- 73 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP7 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCKSGGTWCGFDPHGCCGNCGCL VGFCYGTGC Maltose- 74 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP8 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCISSGGWCGFDLHGCCGNCGCL VGFCYGTGC Maltose- 75 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP9 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCKSGGSWCGFDPHGCCGNCGCL VGFCYGTGC Maltose- 76 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP10 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCIFSGGWCGFDLHGCCGNCGCL VGFCYGTGC Maltose- 77 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP11 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCLKNGQFCWGNPSGCCGNCGCL IIPGVCYGTGC Maltose- 78 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP12 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCIPGGGFCMFEPLSCCHNCGCL LVPGVCYCG Maltose- 79 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP13 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCIPNGGFCMFEPLSCCVNCGCI LVPGVCYCG Maltose- 80 MKIKTGARILALSALTTMMFSASALAKIE binding EGKLVIWINGDKGYNGLAEVGKKFEKDTG protein- IKVTVEHPDKLEEKFPQVAATGDGPDIIF enterokinase WAHDRFGGYAQSGLLAEITPDKAFQDKLY cleavage PFTWDAVRYNGKLIAYPIAVEALSLIYNK sequence- DLLPNPPKTWEEIPALDKELKAKGKSALM TP14 FNLQEPYFTWPLIAADGGYAFKYENGKYD IKDVGVDNAGAKAGLTFLVDLIKNKHMNA DTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSA GINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELVKDPRIAATME NAQKGEIMPNIPQMSAFWYAVRTAVINAA SGRQTVDEALKDAQTNSSSNNNNNNNNNN LGDDDDKCLKVGKICLGRGLKECCPSATC GCLLGFCIKC

    [0146] The recombinantly produced polypeptide is further cleaved by enterokinase immediately after the C-terminal ends of the enterokinase cleavage site (Asp-Asp-Asp-Asp-Lys, SEQ ID NO:66) such that the ginsentide or ginsentide-like peptide is released for further purification.

    [0147] In various embodiments, the method further comprises purification of the recombinantly produced polypeptide prior to the enterokinase cleavage, preferably by amylose resin purification.

    [0148] The polypeptide produced by the cells can be purified using any conventional purification technology, for example, by gel electrophoresis, dialysis, affinity chromatography, or preferably by anion-exchange chromatography and/or reverse-phase chromatography. The choice of the purification method that is used for a particular polypeptide of the invention is within the knowledge of the person of average skill in the art.

    [0149] Without wishing to be bound to any particular theory, ginsentide or ginsentide-like peptides recombinantly produced using the method described herein have native disulfide bonds making organic oxidative folding of the ginsentide or ginsentide-like peptides unnecessary.

    [0150] Due to their high sequence similarity, it is believed that the ginsentides or ginsentide-like peptides described herein have similar biological functions.

    [0151] In addition, it should be understood that a polypeptide comprising, consisting essentially of, or consisting of a ginsentide or ginsentide-like peptide of the invention may also be prepared using the methods detailed above. It may also be used in the applications described below. Such methods of preparation and uses of these polypeptides are also within the scope of the present application. The ginsentide or ginsentide-like peptides and the polypeptides described herein are preferably substantially free of impurities, but may still contain extraneous compounds or impurities that can come from many sources, such as unreacted starting materials, by-products, degradation products, and residual components of host cells.

    [0152] It should also be understood that enriched fractions obtained by chromatographic, size-exclusion, or methods related to purification to enrich peptides with MW between 2-5 kDa from ginseng plants or plants containing ginsentide-related compounds from natural sources, as well as their use in the nutraceutical, pharmaceutical or cosmetic applications described below are also within the scope of the present application.

    [0153] In a third aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as an 1-adrenergic receptor antagonist and vasorelaxant.

    [0154] In a fourth aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as a nitric oxide-boosting agent.

    [0155] In a fifth aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as an anti-thrombotic agent.

    [0156] In a sixth aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as an anti-atherosclerotic agent.

    [0157] In a seventh aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as a protective agent against doxorubicin-induced cardiotoxicity.

    [0158] In an eighth aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as an anti-ageing and adaptogenic agent.

    [0159] In a ninth aspect, the invention relates to use of a ginsentide or ginsentide-like peptide or a pharmaceutically acceptable salt thereof or enriched fractions by chromatographic, size-exclusion, or methods related to purification from ginseng plants or plants containing ginsentides or ginsentide-like peptides thereof, said ginsentide or ginsentide-like peptide having (i) the amino acid sequence set forth in any one of SEQ ID NO:1-64; or (ii) the amino acid sequence sharing at least 65%, preferably at least 75%, even more preferably at least 85%, most preferably at least 95% sequence identity with the peptide of (i) over its entire sequence, as a nutraceutical, a health supplement, or a cosmetic ingredient.

    [0160] The term nutraceutical as used herein refers to a substance intended to supplement a diet and provide nutrients, such as, for example, vitamins, minerals, fiber, fatty acids, or amino acids, that may be missing or may not be consumed in sufficient quantity in the diet. The term health supplement as used herein includes food and food supplement to animals and/or humans, fortification of food, dietary supplement, functional (and medical) food and nutrient supplement. The term cosmetic ingredient as used herein refers to any agent that may be comprised in a cosmetic formulation for cosmetic use, such as skin conditioning agents and anti-aging agents.

    [0161] In various embodiments of the afore-described third to ninth aspects of the invention, the ginsentide or ginsentide-like peptide or salt thereof, regardless of whether it is commercially obtained, isolated from natural sources, or preferably synthetically or recombinantly prepared by a method described herein, can be used in vitro as a biologically active agent. In various embodiments, it can be administered to a subject (e.g. a human or an animal) in need thereof in an effective amount for the treatment or prevention of a condition, disease or disorder considered suitable, alone or in combination (simultaneously, sequentially or separately) with one or more other agents. Such conditions, diseases or disorders include, without limitation, hypertension, ischaemic heart disease, thrombosis, atherosclerosis, erectile dysfunction, stroke, myocardial infarction, heart failure, cancer, aging and aging-related diseases.

    [0162] Accordingly, the ginsentide or ginsentide-like peptide or salt thereof can be formulated into compositions further comprising a pharmaceutically acceptable carrier. The term pharmaceutically acceptable carrier as used herein means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the peptide from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; sterile distilled water; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; pH buffered solutions; polyesters, polycarbonates or polyanhydrides; and other non-toxic compatible substances employed in pharmaceutical formulations. See Remington: The Science and Practice of Pharmacy, 19th Ed. (Easton, Pa.: Mack Publishing Co., 1995), which discloses typical carriers and conventional methods of preparing pharmaceutical formulations.

    [0163] The skilled artisan would also realize that proper formulation is dependent upon the route of administration selected for the specific application, and the proper route and mode of administering the peptide of the invention to a subject should be determined on a case-by-case basis.

    [0164] The composition of the invention can be administered via any parenteral or non-parenteral (enteral) route that is therapeutically effective for proteinaceous or nucleic acid-based drugs. Parenteral application methods include, for example, intracutaneous, subcutaneous, intramuscular, intratracheal, intranasal, intravitreal or intravenous injection and infusion techniques, e.g. in the form of injection solutions, infusion solutions or tinctures, as well as aerosol installation and inhalation, e.g. in the form of aerosol mixtures, sprays or powders. An overview about pulmonary drug delivery, i.e. either via inhalation of aerosols (which can also be used in intranasal administration) or intracheal instillation is given by Patton et al. Proc Amer Thoracic Soc 2004; Vol. 1 pages 338-344, for example). Non-parenteral delivery modes are, for instance, orally, e.g. in the form of pills, tablets, capsules, solutions or suspensions, or rectally, e.g. in the form of suppositories. Peptides of the invention can be administered systemically or topically in formulations containing conventional non-toxic pharmaceutically acceptable excipients or carriers, additives and vehicles as desired.

    [0165] In one embodiment of the present invention the pharmaceutical is administered parenterally to a mammal, and in particular to humans. Corresponding administration methods include, but are not limited to, for example, intracutaneous, subcutaneous, intramuscular, intratracheal or intravenous injection and infusion techniques, e.g. in the form of injection solutions, infusion solutions or tinctures as well as aerosol installation and inhalation, e.g. in the form of aerosol mixtures, sprays or powders.

    [0166] The dosage of the peptide of the invention applied may vary within wide limits to achieve the desired preventive effect or therapeutic response. It will, for instance, depend on the half-life of the peptide in vivo. Further, the optimal dosage will depend on the biodistribution of the peptide, the mode of administration, the severity of the disease/disorder being treated as well as the medical condition of the patient. If wanted, the peptide may also be given in a sustained release formulation, for example liposomal dispersions or hydrogel-based polymer microspheres, like PolyActive or OctoDEX (cf. Bos et al., Business Briefing: Pharmatech 2003: 1-6). Other sustained release formulations available are for example PLGA based polymers (PR pharmaceuticals), PLA-PEG based hydrogels (Medincell) and PEA based polymers (Medivas).

    [0167] Accordingly, the peptide of the present invention can be formulated into compositions using pharmaceutically acceptable ingredients as well as established methods of preparation (Gennaro, A. L. and Gennaro, A. R. (2000) Remington: The Science and Practice of Pharmacy, 20th Ed., Lippincott Williams & Wilkins, Philadelphia, Pa.). To prepare the pharmaceutical compositions, pharmaceutically inert inorganic or organic excipients can be used. To prepare e.g. pills, powders, gelatine capsules or suppositories, for example, lactose, talc, stearic acid and its salts, fats, waxes, solid or liquid polyols, natural and hardened oils can be used. Suitable excipients for the production of solutions, suspensions, emulsions, aerosol mixtures or powders for reconstitution into solutions or aerosol mixtures prior to use include water, alcohols, glycerol, polyols, and suitable mixtures thereof as well as vegetable oils.

    [0168] In some embodiments, the ginsentide or ginsentide-like peptide or salt thereof can be comprised in any cosmetic compositions known in the art to provide for topical skin rejuvenation and/or anti-aging compositions.

    [0169] The formulations can be sterilized by numerous means, including filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile medium just prior to use.

    [0170] The compositions and the methods of therapeutic or cosmetic applications of the ginsentide or ginsentide-like peptides and compositions described above are also within the scope of the present application.

    [0171] The present invention is further illustrated by the following examples. However, it should be understood, that the invention is not limited to the exemplified embodiments.

    EXAMPLES

    Materials and Methods

    General Procedures for Peptide Solid Phase Synthesis by Fmoc-Chemistry

    [0172] For peptide-hydrazides, firstly, the 2-chlorotritylchloride resin was swelled in dry DCM for a while, 5% hydrazine in dry DMF was directly added. After 0.5 hr, the resin was washed with DCM (3), DMF (3), and DCM (3). Peptides were then assembled on the hydrazine-trityl resin using typical Fmoc SPPS protocols. All amino acids were used in 4 eq of the resin, and preactivated by 4 eq of PyBop and 8 eq of DIEA. After 1 to 2 hr coupling of amino acid, the resin was washed with DCM (3), DMF (3), and DCM (3). The successive -amino group deprotection was performed in 20% piperidine in DMF (5 min, 10 min) between each amino acid coupling step. Finally, a peptide-hydrazide was released from resin by using the cleavage reagent: a mixture of 90% TFA, 5% EDT, 2.5% TIS and 2.5% water. After precipitated from ether, the crude peptide-hydrazide was purified by prep-HPLC, the molecular weight was determined by ESI-MS.

    [0173] For cysteinyl peptides, firstly, 2 eq of Fmoc-Cys(Trt)-OH was dissolved in dry DCM (with a small amount of dry DMF for solubility), and added into the swelled 2-chlorotritylchloride resin with 5 eq (respective to the amino acid) of DIEA. After 1 hr reaction, the resin was washed with DCM (3), DMF (3), and DCM (3). For capping any remaining reactive trityl groups, the resin was reacted with methanol for 15 min. Once the cysteine residue was attached on the resin, amino acid coupling, -amino group deprotection and final peptide cleavage were performed according to the same procedure described in the above.

    Microwave-Assisted Automated Peptide Synthesis

    [0174] Microwave-assisted peptide synthesis was performed in 0.1 mmol and 0.25 mmol on CEM microwave peptide synthesizer, liberty 1 according to the manual instruction. Fmoc-(Dmb) Gly-OH was used in peptide C-terminal part instead of Fmoc-Gly-OH. Fmoc deprotection was done in 20% piperidine/DMF containing 0.1 M HOBt. Coupling of Fmoc/tBu-protected amino acids were achieved by 5 eq amino acids activated by PyBop in DMF. The parameters used in the microwave synthesis was shown in the below table.

    TABLE-US-00004 TABLE 6 MW-SPPS parameters used in the synthesis (CEM microwave peptide synthesizer, liberty 1) Number of Amino acid couplings Power (W) Temp ( C.) Time (s) Coupling Asn 2 20 50 600 Asp 2 20 50 600 Cys 2 20 50 600 Pro 2 20 50 600 AA followed by 1 20 50 600 Pro Other AAs Deprotection Initial depro 1 20 55 30 depro 1 20 55 180

    [0175] After the completion of peptide synthesis, the peptide was cleaved in a mixture of 90% TFA, 5% EDT, 2.5% TIS and 2.5% water. And then, the peptide precipitated by ether was directly used in the folding reaction.

    Ligation of Peptide-Hydrazide with Cysteinyl Peptide

    [0176] Briefly, a Fmoc-peptide hydrazide was first oxidized to form peptide azide by sodium nitrite (5 eq of peptide) at pH 3.0 in 0.2 M phosphate buffer, pH 3.0, containing 6 M Gdn-HCl, at 20 degree for 20 min. After addition of sodium 2-mercaptoethanesulfonate (MESNa) (final conc. 1%), and adjustment of pH to 7.0, the peptide thioester was then formed. Finally, this peptide thioester reacted chemoselectively with Cysteinyl-peptide to produce the full-length peptide by generating a native amide bond at the ligation site. The removal of Fmoc from the ligated full-length peptide was done in 20% piperidine with TCEP for 20 min.

    Folding of Reduced Peptides to Native Form

    [0177] For most ginsentides and cysteine-rich peptides, the folding was performed in 20% DMSO in 0.1 M (NH).sub.4HCO.sub.3 containing cysteamine/cystamine. The ratio of peptide:cysteamine:cystamine was around 1:200:10. 10% TFE, 5% or 10% IPA may be included depending on peptides' solubility. Peptides were dissolved in very small amount of DMSO, and then, added into the folding buffer, folded at 4 degree, overnight. After folding, the reaction was buffer-exchanged and concentrated by using Sek-Pak C18 cartridge. The concentrated folding mixture was purified by using HPLC to get pure folded products.

    [0178] For organic oxidative folding, peptides were dissolved in very small amount of DMSO, added into the folding buffer comprising 10% (v/v) DMSO, 84.36% (v/v) isopropanol, 5% (v/v) morpholine and 0.64% (v/v) Cysteamine (10M), and was folded at 4 C. for 5 min. After folding, the reaction was buffer-exchanged and concentrated by using Sek-Pak C18 cartridge. The concentrated folding mixture was purified by using HPLC to get pure folded products.

    Recombinant Expression of Ginsentides

    Overall Strategies for the Recombinant Expression of Ginsentides

    [0179] 1. Targeted sequence was cloned into a vector, where the ginsentide was fused to the C-terminal of periplasmic signal sequence-maltose binding protein (MBP) with a DDDK cleavable sequence in between (enterokinase can cleave at the C-terminal of DDDK);

    [0180] 2. Plasmid was transformed into E. coli and selected using ampicillin-containing agar plates;

    [0181] 3. A single colony was picked and cultured in liters of ampicillin-containing LB broth at 37 C., shaking at 200 rpm until optical density reaches around 0.6;

    [0182] 4. Induction was performed using 0.1 mM IPTG at 16 C. overnight;

    [0183] 5. The cell lysate was loaded to an amylose affinity column and eluted using maltose; and

    [0184] 6. Enterokinase was used for cleavage of maltose binding protein (MBP).

    [0185] 7. Anion exchange and reversed phase-HPLC was used to purify the recombinant expressed ginsentides.

    Isolation and Purification of Ginsentides from Panax ginseng, P. Quinquefolius, or P. notoginseng

    [0186] About 1 kg of dried roots, leaves, seeds or flowers of Panax ginseng, P. quinquefolius, or P. notoginseng were extracted with 10 litres of water. After filtration, the filtrate was then loaded onto a C18 flash column (Grace Davison, US) and eluted with 70% ethanol. The eluted fractions were then loaded onto an SP Sepharose resin column (GE Healthcare, UK), eluted with 1 M NaCl (pH 3.0), and followed by ultrafiltration (ViVaflow 200, 2000 MWCO hydrostat). Further purification was performed by reversed-phase high performance liquid chromatography (RP-HPLC) (Shimadzu, Japan). A linear gradient of mobile phase A (0.05% TFA/H.sub.2O) and mobile phase B (0.05% TFA/ACN) was used on the C18 column (25022 mm, 5 m, 300 ) (Grace Davison, US).

    [0187] This invention relates to the synthesis and use of ginsentides as a peptidogenic adaptogen to prolong our health span. The role of peptide adaptogenics is to extend the chronological clock of cellular and organismal ageing. In turn, they intervene age-related diseases and promote active and healthy ageing. Ginsentides in particular, are able to address cardiovascular diseases and frailty, which are the underlying cause of numerous chronic and old-age-related diseases such as cancer, cardiovascular diseases, inflammatory conditions, stress, and other metabolic conditions. FIG. 1 is a schematic diagram depicting the adaptogenic effects of ginsentide. The synthesis and uses of ginsentides will be described in the following sections: [0188] 1. Ginsentides production [0189] 2. Ginsentides as 1-adrenergic receptor antagonists and vasorelaxants of rat aorta ring [0190] 3. Ginsentides as nitric oxide-boosting agents [0191] 4. Ginsentides as anti-thrombotic agents [0192] 5. Ginsentides as anti-atherosclerotic agents [0193] 6. Ginsentides as protective agents against doxorubicin-induced cardiotoxicity [0194] 7. Ginsentides as anti-ageing and adaptogenic agent

    Example 1: Ginsentides Production

    [0195] The abundance of glycine and cysteine in the ginsentide sequence posed synthetic challenges in their synthesis of ginsentides, especially in the C-terminus. Attempts to synthesize ginsentides by a stepwise synthesis using solid-phase methods failed because the C-terminal fragments formed aggregates, preventing a successful synthesis. Therefore, the present invention described a stepwise solid-phase synthesis strategies of the chemical synthesis of ginsentides to overcome these synthetic challenges. In particular, a strategically selected Gly residue was alkylated by a reversible protecting group to prevent aggregation to permit a successful synthesis of ginsentide TP1 as a representative example.

    [0196] An organic oxidative folding system for disulfide bond formation has been invented. Using this invention, the oxidative folding is accelerated a thousand fold in forming native disulfide bonds of cysteine-rich peptides within minutes (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, or 59 minutes) instead of hours. The invention also improves reaction yield and can be performed in high peptide concentrations without observable peptide precipitations. In addition, all reagents used in this method are inexpensive, which makes the synthesis economically favorable. Thus, it can be applied to large scale production of cysteine-rich peptides.

    [0197] Recombinant expression of ginsentides is advantageous as the use of chemicals for the production of ginsentides will be eliminated. Moreover, the expressed ginsentides produced using the recombinant expression platform will be in its folded state, making the second step of oxidative folding unnecessary.

    Technical Description of the Invention

    [0198] i. Table 1 illustrates the amino acid sequence of ginsentides. [0199] ii. FIG. 2 shows the schematic flow for the chemical synthesis of ginsentides [0200] iii. FIG. 3 shows the oxidative folding strategies for synthetic ginsentide TP1 [0201] iv. FIG. 4, 5, 6 shows that the synthetic ginsentide is identical to natural ginsentides, and is functionally indistinguishable from natural ginsentide obtained from ginseng. [0202] v. FIG. 7-11 shows the recombinant expression scheme for ginsentide.

    [0203] Oxidative folding relates to an approach for forming disulfide bonds in peptides and proteins. In this method, reduced or partially oxidized peptides are fully oxidized in a nonaqueous system using organic solvents and compatible organic reducing and oxidizing (redox) reagents.

    [0204] The rationale of our invention is based on the observation that oxidative folding is mediated by thiol-disulfide exchange reactions which are SN2 reaction. Such reactions are strongly favored in organic solvents than in aqueous conditions in which the attacking thiol nucleophiles are being solvated by water. Eliminating water in the oxidative folding condition should accelerate the thiol-disulfide exchange reactions, and in turn, the oxidative process.

    [0205] In this invention, four major components are introduced: an organic base, organic solvent, structure-enhancing co-solvent and redox reagents. An organic base, such as pyridine, imidazole or morpholine, is used to provide a suitable basicity for the disulfide formation while organic solvent provides an environment in which the thiol-disulfide exchange reaction is one thousand times faster than in aqueous conditions, which are the prevailing practice in literature. In addition, structure-enhancing co-solvents and redox reagents ensure the correct disulfide paring of folding products. Using structure-enhancing solvents such as trifluoroethanol (TFE), the native secondary structure is formed preferentially, thus bringing the native pairing of cysteines in proximity to form the correct disulfide connections. Using organic-solvent-compatible reductant such as cysteamine and oxidant dimethyl sulfoxide (DMSO), the incorrect disulfide connection is able to be shuffled to the correct disulfide connection by thiol-disulfide exchange reactions.

    [0206] The reduced peptides can be synthesized by either solid/solution phase synthesis or recombinant expression. Then it is purified and lyophilized. Reduced peptides are dissolved in pure DMSO, which also acts as a mild oxidant, and diluted with organic solvents to a final concentration of 0.1 mM to 1 mM. Subsequently, an organic base and reductants are added. The reductant can be dissolved in a small amount of water if it is not soluble in organic solvents. It is preferred that the final volume of water should not exceed 20% of the whole mixture.

    [0207] The aforesaid procedure is employed to fold a cyclic peptide kalata B1 (kB1) as an example. Dissolve fully reduced kB1 in DMSO as a stock. Add 2-propanol as the organic solvent to dilute the peptide stock. Then add organic bases including pyridine, imidazole or morpholine and the reductant cysteamine. Each condition contains 100 M of reduced kB1, 10% (v/v) DMSO and 100 mM cysteamine with various concentrations of solvent and base. [0208] FIG. 12 shows the RP-HPLC and MALDI-TOF MS profiles of native and reduced kB1. [0209] Table 4 shows the oxidative folding conditions of kB1 with varying solvent combinations. [0210] FIG. 13 shows the RP-UPLC profiles of oxidative folding of kB1 showing the effect of different bases. [0211] FIG. 14 shows the RP-UPLC profiles of oxidative folding of kB1 and the effect of cysteamine and DMSO as redox agents. [0212] FIG. 15 shows the RP-HPLC profiles of oxidative folding of kB1 with different thiols as reducing reagents. [0213] FIG. 16 compares the 1H NMR spectra comparison of the natural and synthetic kB1 prepared by organic oxidative folding.

    TABLE-US-00005 TABLE 4 Oxidative folding conditions of kB1 with varying solvent concentrations Cysteamine Peptide Base (v/v %) 2-propanol DMSO Conc. Conc. Yield* Run Pyridine Morpholine Imidazole (%) (%) (mM) (M) (%) 1 5 85 10 100 100 27 2 30 60 10 100 100 72 3 50 40 10 100 100 82 4 90 0 10 100 100 8 5 5 85 10 100 100 80 6 10 80 10 100 100 83 7 15 75 10 100 100 84 8 5 85 10 100 100 88 9 10 80 10 100 100 89 10 20 70 10 100 100 91 11 30 60 10 100 100 90 *Yields are calculated accordingly based on RP-HPLC profiles of reactions at 1 h.

    Example 2. Ginsentides as 1 Adrenergic Receptor Antagonists and Vasorelaxants of Rat Aorta Ring

    [0214] The present invention shows that ginsentide TP1 has vasorelaxation properties. [0215] Plant peptides and proteins are often underexplored as bioactive constituents in medicinal plants. Unlike other peptides and proteins, multiple intramolecular disulfide bonds stabilize cysteine-rich peptides making them extremely stable against heat, acid and enzymatic degradation. The present invention shows that ginsentide TP1, a cysteine-rich peptide, has eight cysteine residues (four stable disulfide bonds) and a unique pseudo-cyclic structure, making it stable against heat, acid, serum and proteolytic degradation. [0216] Cysteine-rich peptides are highly cross-linked by intramolecular disulfide bridges. This forces the bulky hydrophobic side chains to expose outward, making the surface of the molecule more lipophilic. Also, the slow exchange of D20 indicates that the hydrogen bonding of ginsentides are intramolecularly connected instead of exposing outwards. These characteristics desolvate ginsentides from water. Therefore, the unique features of ginsentides could improve the intrinsic cell permeability and intestinal absorption, making it orally active.

    Technical Description

    [0217] FIG. 17 shows a schematic purification of ginsentides from ginseng plants. All ginsentides including TP1 (herein refer as natural ginsentide TP1) were purified to high homogeneity through solvent-solvent partition, ion-exchange, size exclusion, and reverse-phase high-pressure liquid chromatography. The yields of ginsentides from different plant tissues vary >10 fold, with the highest yield from seeds and flowers (0.2-0.4%) and the lowest from roots and leaves (0.01-0.03%). Thus, from 1 kg of dried flowers or seeds nearly 400 mg of ginsentides could be obtained. [0218] Table 1 illustrates the amino acid sequence of ginsentides. [0219] FIGS. 18 and 19 shows that ginsentide TP1, TP3 and TP8 relaxes phenylephrine-induced aortic ring contraction, but not KCI-induced contracted aortic ring. To examine the vasomotor response of ginsentide TP1, isolated thoracic aorta was pre-contracted with KCI (30 mM) or a selective 1-adrenergic receptor agonist, phenylephrine (0.1 M). Isometric tension was recorded as a measurement for aortic ring contraction. The ex-vivo results showed that ginsentide TP1 inhibits phenylephrine-induced aortic ring contraction in a dose-dependent manner (p<0.05), but not in the KCI-treated group. [0220] Table 5 shows that ginsentide TP1 is metabolically stable [0221] FIG. 20 shows the slow exchange of D20 indicating that the extensive hydrogen bonding network in ginsentide TP1 to confer their structurally stability. [0222] FIG. 21 shows the sequence of TP1, its secondary structure, the overall lay of synthetic and natural TP1, the CPK model of the hydrophobic surface of TP1 and the 3D structure of TP.

    TABLE-US-00006 TABLE 5 Ginsentide TP1 is metabolically stable Conditions Initial concentration remaining (%) Heat (100 C., 2 h) >71 Acid (0.2M HCl, 1 h) >99 Trypsin (37 C., 1 h) >87 Chymotrypsin (37 C., 1 h) >90 Pepsin (37 C., 1 h) >99 Human Serum (37 C., 48 h) >92

    Example 3. Ginsentides as Nitric Oxide-Boosting Agents

    [0223] The present invention shows that ginsentide TP1 induces nitric oxide synthesis. In comparison to the major members of ginsenosides such as Rg1 and Rb1 in ginseng, ginsentide TP1 is more effective than ginsenoside Rg1 and Rb1 in nitric oxide synthesis. [0224] Plant peptides and proteins are often underexplored as bioactive constituents in medicinal plants. Unlike other peptides and proteins, multiple intramolecular disulfide bonds stabilize cysteine-rich peptides making them extremely stable against heat, acid and enzymatic degradation. The present invention shows that ginsentide TP1, a cysteine-rich peptide, has eight cysteine residues (four stable disulfide bonds) forming a unique pseudo-cyclic structure, making it resistant to heat, acid, serum proteolytic degradation. [0225] Ginsentides are cysteine-rich peptides and highly cross-linked by intramolecular disulfide bridges. Because ginsentides are 31 amino acids in length and contain four disulfide bridges, ginsentides have an inside-out arrangement with the inside core filled by the four disulfide linkages. Consequently, such a structural arrangement forces the bulky hydrophobic side chains to expose outward, making the surface of the molecule more lipophilic. Indeed, the surface of ginsentide is generally consisted of hydrophobic amino acids as determined by 3D NMR. Also, ginsentides are highly compact with an extensive network of stable intra hydrogen bondings as indicated by the slow exchange of D20 in an NMR study. Intra-hydrogen bondings not only stabilize the ginsentide structures but also desolvate ginsentides from external hydrogen-bonding with water. Together, these unique features of ginsentides improve their cell permeability and intestinal absorption, making them bioavailable. In other words, ginsentides have a small-molecule-like stability and oral bioavailability, but a large foot print to increase their on-target specificity and decrease their probability of off-target side effects than small molecules.

    Technical Description of the Invention

    [0226] Table 1 illustrates the amino acid sequence of ginsentides. [0227] FIG. 22 shows the profiles of ginsentides in the three most commonly used ginseng species: P. ginseng, P. quinquefolius and P. notoginseng. [0228] FIG. 23 shows the tissue distribution of ginsentides in P. ginseng. [0229] FIG. 24 shows the de novo sequencing of ginsentide TP1. [0230] FIG. 25 shows the disulfide connectivity of ginsentide TP1. [0231] FIG. 26 illustrates the ginsentide-encoding transcripts in all three commonly used ginseng species: P. ginseng, P. quinquefolius and P. notoginseng. [0232] FIG. 27 shows that ginsentide TP1 increases cellular NO synthesis from human endothelial cells (HUVEC-CS). Comparatively, ginsentide TP1 shows a three-fold increase in potency and magnitude NO release than both ginsenosides Rb1 and Rg1. Ginsentide TP1, TP3, TP8 and synthetic TP1 shows comparable cellular NO release. [0233] FIG. 28 shows that ginsentide TP1 induces the accumulation of phosphorylated eNOS (p-eNOS). 1 M of ginsentide TP1 induced the accumulation of p-eNOS in approximately 30 min. [0234] FIG. 29 shows that ginsentide TP1 induced nitric oxide formation involves PI3K/Akt signaling. [0235] Table 5 shows that ginsentide TP1 is metabolically stable [0236] FIG. 30 shows the slow exchange of D20 indicating that the extensive hydrogen bonding network in ginsentide TP1 to confer their structurally stability. [0237] FIG. 31 shows that ginsentide TP1 is not cytotoxic to cells and hemolytic to red blood cells. Ginsnetide TP1 is not immunogenic.

    Example 4. Ginsentides as Anti-Thrombotic Agents

    [0238] The present invention shows that ginsentide TP1 has antagonistic effects against P2y12 activation. In comparison to the main ginsenosides in ginseng, ginsentide TP1 is more effective than ginsenoside Rg1 and Rb1 in antagonizing P2y12 activation. Ginsentide TP1 also exerts anti-platelet aggregative effects in vivo. [0239] Plant peptides and proteins are often underexplored as bioactive constituents in medicinal plants. Unlike other peptides and proteins, multiple intramolecular disulfide bonds stabilize cysteine-rich peptides making them extremely stable against heat, acid and enzymatic degradation. The present invention shows that ginsentide TP1, a cysteine-rich peptide, has eight cysteine residues (four stable disulfide bonds) and a unique pseudo-cyclic structure, making it stable against heat, acid, serum and proteolytic degradation. [0240] Cysteine-rich peptides are highly cross-linked by intramolecular disulfide bridges. This forces the bulky hydrophobic side chains to expose outward, making the surface of the molecule more lipophilic. Also, the slow exchange of D20 indicates that the hydrogen bonding of ginsentides are intramolecularly connected instead of exposing outwards. These characteristics desolvate ginsentides from water. Therefore, the unique features of ginsentides could improve the intrinsic cell permeability and intestinal absorption, making it orally active.

    Technical Description of the Invention

    [0241] Table 1 illustrates the amino acid sequence of ginsentides. [0242] FIG. 32 show that ginsentide TP1 antagonize P2y12 activation. Comparatively, ginsentide TP1 is more effective than both ginsenosides Rb1 and Rg1. [0243] FIG. 34 show that ginsentide TP1 inhibits platelet aggregation in vivo [0244] Table 4 illustrates that ginsentide TP1 is stable against heat, acid, proteolytic and serum-mediated degradation. [0245] FIG. 33 shows the slow exchange of D20 indicating that the extensive hydrogen bonding network in ginsentide TP1 to confer their structurally stability.

    Example 5. Ginsentides as Anti-Atherosclerotic Agents

    [0246] The present invention shows that ginsentide TP1 is an endothelial-cell selective adhesion molecule binder that antagonizes monocyte adhesion that can be useful for the management of atherosclerosis. It is five times more potent than known RGD-derived adhesion inhibitor. [0247] Plant peptides and proteins are often underexplored as bioactive constituents in medicinal plants. Unlike other peptides and proteins, multiple intramolecular disulfide bonds stabilize cysteine-rich peptides making them extremely stable against heat, acid and enzymatic degradation. The present invention shows that ginsentide TP1, a cysteine-rich peptide, has eight cysteine residues (four stable disulfide bonds) and a unique pseudo-cyclic structure, making it stable against heat, acid, serum and proteolytic degradation. [0248] Cysteine-rich peptides are highly cross-linked by intramolecular disulfide bridges. This forces the bulky hydrophobic side chains to expose outward, making the surface of the molecule more lipophilic. Also, the slow exchange of D20 indicates that the hydrogen bonding of ginsentides are intramolecularly connected instead of exposing outwards. These characteristics desolvate ginsentides from water. Therefore, the unique features of ginsentides could improve the intrinsic cell permeability and intestinal absorption, making it orally active. [0249] The present invention shows that several ginsentide binds to heparin-affinity column. It is useful for the purification of ginsentides from raw materials. [0250] Identified a new heparin-binding sequence derived from ginsentide that can be useful as a new affinity tag for recombinant expression

    Technical Description of the Invention

    [0251] Table 1 illustrates the amino acid sequence of ginsentides. [0252] FIG. 35 shows that ginsentide TP1 shows protein-protein interactions with endothelial cell selective adhesion molecules (ESAM). ESAM is involved in the interaction between monocytes and endothelium. [0253] FIG. 36 shows that ginsentide TP1 antagonists monocyte adhesion and is five times more potent than known adhesion inhibitor [0254] FIG. 37 shows that several ginsentides are heparin binder and Heparin affinity chromatography can be used for affinity purification [0255] FIG. 38 shows the identification of a novel heparin binding sequence from ginsentide TP1. For recombinant expression of proteins, this new sequence can be inserted at the N-terminal or C-terminal to aid heparin affinity purification. For facilitating efficient cellular binding, heparin binding motifs are known to bind to heparan sulfate proteoglycan and form a major part of the extracellular matrix of cells. This new heparin binding motif can be conjugated to other materials to promote their attachment to cell surface. Therefore, this novel heparin binding sequence could be useful in peptide design and engineering to facilitate efficient cellular binding, as well as being a tag for affinity purification in recombinant expression

    Example 6. Ginsentides as Protective Agents Against Doxorubicin-Induced Cardiotoxicity

    [0256] Currently, four strategies have been applied to prevent the occurrence of DOX-induced cardiotoxicity. But these strategies still have unavoidable drawbacks.

    [0257] The first strategy is to adjust the administration schedules of DOX. Some studies showed that administration of DOX via prolonged infusion can decrease the cardiotoxicity comparing with bolus administration (LEGHA, S. S., et al. Annals of Internal Medicine, 1982. 96(2): p. 133-139.). Nevertheless, a randomized trial has shown that infusion administration preferentially increases the tendency of developing metastasis in patients (Casper, E. S., et al. Cancer, 1991. 68(6): p. 1221-1229.).

    [0258] The second approach is to modify the structure of DOX and synthesize analogues. The most common used structural analogs, epirubicin and mitoxantrone, have less cardiotoxicity than DOX, but their chemotherapeutic efficacy are lower than DOX (Lehenbauer Ludke, A. R., et al. Canadian journal of physiology and pharmacology, 2009. 87(10): p. 756-763.)

    [0259] The third strategy is to develop the drug formulation of DOX to control the peak concentration after administration. Liposomal encapsulation of DOX can extends half-life of DOX and increases accumulation in tumor tissues rat rather than heart owing to its small size, but there still exists a possibility of cardiac dysfunction at high accumulative dosage (Abraham, S. A., et al. Methods in enzymology, 2005. 391: p. 71-97.).

    [0260] The last scheme to reduce the risk of DOX-induced cardiotoxicity is combination with cardioprotective agents or compounds. However, they either interfere with therapeutic potentials of DOX or may induce secondary malignancies in cancer patients, including dexrazoxane (Tebbi, C. K., et al. Journal of Clinical Oncology, 2007. 25(5): p. 493-500), N-acetylcysteine (Myers, C., et al. Semin Oncol, 1983. 10(Suppl 1): p. 53-55), GSH, co-enzyme Q10, vitamin A and -tocopherol (Legha, S. S., et al. Annals of the New York Academy of Sciences, 1982. 393(1): p. 411-417.).

    [0261] Herein, our preliminary results show that ginsentides attenuated DOX-induced cardiotoxicity both in zebrafish model and rat cardiomyocytes. Also, ginsentides have no interference with anticancer capacity of DOX during combinational treatment on breast cancer cells.

    [0262] Ginsentides, a novel class of cysteine-rich-peptides, are highly resistant to heat, acidic and enzymatic degradation, since they contain 31-33 amino acids with 8 cysteine residues and resemble a pseudo-cyclic cysteine-knot structure. In addition, pharmacokinetic profiles of ginsentides in mice have shown that they are non-toxic, orally bioavailable and relatively stable in blood. These advantages enhance ginsentides as a highly promising adjuvant cardioprotective agent during chemotherapy.

    Technical Description of the Invention

    [0263] The invention provides an approach to prevent DOX-induced cardiotoxicity by a combinational administration of DOX with ginsentides.

    (1) Cardioprotection of Ginsentides in Zebrafish

    [0264] In this invention, a zebrafish transgenic line Tg(cmlc2:gCaMP) (Chi, N.C., et al. PLoS Biol, 2008. 6(5): p. e109.), which expresses a calcium-sensitive green fluorescent protein (GFP) in cardiomyocytes was utilized to visualize and evaluate cardiac functions of zebrafish embryos.

    [0265] No adverse effect of ginsentides in zebrafish was found, even applied at high concentrations. The major side effects of DOX-induced cardiotoxicity on zebrafish embryos include (1) reduction of heartbeats, (2) ventricular contractility, and (3) triggering pericardial edema. Addition of ginsentides into DOX-treated zebrafish embryos restored the heartbeat rate near to normal level, and reduced the size of pericardial edema (FIGS. 39 and 40).

    [0266] To evaluate cardiac functions in zebrafish, ejection fraction (EF) were determined by measurement of ventricular volume at the end of systoles and diastoles. EF were markedly reduced after DOX-treatment, but was significantly increased and almost returned to normal after combinational treatment with ginsentides. (FIG. 41), demonstrating significant cardioprotection of ginsentides against DOX-induced cardiotoxicity in zebrafish.

    [0267] To identify whether ginsentides can attenuate DOX-induced cardiotoxicity in cardiomyocytes, cell viability after drug treatment was measured by MTT assay. The results showed that ginsentides display no apparent toxicity in cardiomyoctes even at high concentration, and enhance the growth of cardiomyocytes compared to major components in Panax ginseng, ginsenoside Rg1, Rb1 and Re (FIG. 42).

    [0268] After 24 h co-treatment of DOX with ginsentides, the viability of H9c2 cells was enhanced by 20% compared to the DOX-alone treatment (FIG. 43.). But ginsenoside Rg1, Rb1 and Re did not showed any protective effects on cardiomyoctes during DOX-treatment.

    (2) No Interference of Anticancer Effects on Breast Cancer Cells

    [0269] Next, we studied whether ginsentides would reduce the anticancer effects of DOX on breast tumor cells. Cell viability of MDA-MB-231 cells was not enhanced after co-treatment of DOX with ginsentides (FIG. 44.). Ginsentides only exerted protective effects on cardiomyocytes and did not interfere with the therapeutic effects of DOX on tumor cells.

    (3) Pharmacokinetics of Ginsentides in Mice

    [0270] Pharmacokinetic profiles of ginsentides in mice (FIG. 45.) show that they are orally bioavailable and relatively stable in blood. No discomfort symptoms were observed in mice after receiving ginsentides, and no death occurred during administration and after a month of administration. These advantages provide strong evidence for developing ginsentides as a therapeutic agent in clinical use.

    Example 7. Ginsentides as Anti-Ageing and Adaptogenic Agents

    [0271] Most of the anti-ageing agents are commonly grouped as antioxidant, which reduced oxidative stress and protect the cell from unwanted ageing related process. In this invention, Ginsentide TP1 is disclosed to be an anti-ageing agent, which directly prevents telomere shortening through reducing the level of telomeric repeat-binding factor 2 (TERF2).

    [0272] Unlike antioxidant anti-ageing compounds, ginsentide TP1 not only prevents oxidative stress induced ageing but also slow down overall ageing process through blocking the telomere shortening process and promote adaptation to stress.

    [0273] Unlike conventional peptide drugs, ginsentide TP1 has been proven to be a potential orally active agent due to their excellent stability in both GI tract as well as serum.

    Technical Description of the Invention

    [0274] To understand the function of ginsentide TP1 at molecular level, HUVEC-CS cells were treated with 1 M TP1 for a 30 min period. After termination of the treatment, cells were collected through scraping and washed with ice cold PBS. Cells were lysed in urea lysis buffer (8 M urea in 25 mM TEAB supplemented with protease inhibitor cocktail). Digest 200 g of protein each using in-solution trypsin digestion technique. Resultant tryptic peptides were labeled with TMT reagents, separated by reverse phase fractionation at high pH (pH8) and analyzed using nano-HPLC coupled Q-Exactive mass spectrometer. Protein identification and quantification were performed using mascot search engine (version 2.4.1) using UniProtKB human protein database and we identified a total of 5058 proteins with a list of peptides and 1% FDR cutoff. Control condition was used as denominator for TMT based relative protein quantitation. Cutoff values of 0.85 and 1.17 were used as the cutoff level of protein abundance change (FIG. 46a). Using this approach, 62 and 113 proteins were identified as up- and down-regulated in the ginsentide-treated cells (FIG. 46b). The regulated proteins were classified according to their biological functions (FIG. 46c).

    [0275] Interestingly the level of telomeric repeat-binding factor 2 (TERF2) was significantly decline after 30 min TP1 treatment (FIG. 46d). The reduction of TERF2 by TP1 should slow down the telomere shortening process and prevent cellular ageing. Therefore, ginsentide TP1 prevents the ageing process specifically in vascular cells and maintains the vascular flexibility. It will also reduce other aging related problems.

    [0276] FIG. 47 shows the effects of ginsentide TP1 on hypoxic endothelial cell proteome. Ginsentide TP1 induced unfolded protein response pathways in hypoxic endothelial cells. It also reduces apoptosis signaling pathways and reduced cell adhesion pathways.

    [0277] FIG. 48-53 shows that ginsentide TP1 promotes adaptation of endothelials cells to hypoxic stress.

    [0278] FIG. 54. Ginsentides reduced unfolded proteins in cardiomyocyte, vascular smooth muscle cells, and myocytes.

    [0279] FIG. 55. Ginsentides reduced reactive oxygen species production in hypoxic endothelial cells.

    [0280] FIG. 56. Ginsentides increased nitric oxide production in hypoxic endothelial cells.

    [0281] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein. Other embodiments are within the following claims. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.

    [0282] One skilled in the art would readily appreciate that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. Further, it will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention. The compositions, methods, procedures, treatments, molecules and specific compounds described herein are presently representative of preferred embodiments are exemplary and are not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention are defined by the scope of the claims. The listing or discussion of a previously published document in this specification should not necessarily be taken as an acknowledgement that the document is part of the state of the art or is common general knowledge.

    [0283] The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms comprising, including, containing, etc. shall be read expansively and without limitation. The word comprise or variations such as comprises or comprising will accordingly be understood to imply the inclusion of a stated integer or groups of integers but not the exclusion of any other integer or group of integers. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by exemplary embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.

    [0284] The content of all documents and patent documents cited herein is incorporated by reference in their entirety.