PEPTIDE VACCINES AND PEMBROLIZUMAB FOR TREATING BREAST CANCER
20200276304 ยท 2020-09-03
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K2039/55561
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K39/001174
HUMAN NECESSITIES
International classification
Abstract
The disclosure features, inter alia, combination therapies comprising pembrolizumab and one or more immunogenic XBP1-, CD138-, and CS1-derived peptides. The therapies herein can be used, e.g., for inducing an immune response in a subject having a cancer, and treating a cancer such as breast cancer, e.g., triple negative breast cancer.
Claims
1. A method of treating breast cancer, e.g., triple negative breast cancer, comprising administering to a subject: (i) pembrolizumab; and (ii) one or more of: a non-spliced XBP1 peptide described herein, a spliced XBP1 peptide described herein, a CD138 peptide described herein and a CS-1 peptide described herein; wherein the subject has, or is at risk of developing, breast cancer, e.g., triple negative breast cancer.
2. Pembrolizumab, in combination with: one or more of: a non-spliced XBP1 peptide described herein, a spliced XBP1 peptide described herein, a CD138 peptide described herein and a CS-1 peptide described herein; for use in treating breast cancer, e.g., triple negative breast cancer.
3. A method for inducing an immune response in a subject, the method comprising delivering to a subject: (i) pembrolizumab; and (ii) one or more of: a non-spliced XBP1 peptide described herein, a spliced XBP1 peptide described herein, a CD138 peptide described herein and a CS-1 peptide described herein.
4. Pembrolizumab, in combination with: one or more of: a non-spliced XBP1 peptide described herein, a spliced XBP1 peptide described herein, a CD138 peptide described herein and a CS-1 peptide described herein; for use in inducing an immune response in a subject.
5. The method or composition for use of any of claims 1-4, wherein the non-spliced XBP1 peptide is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:1.
6. The method or composition for use of any of claims 1-4, wherein the spliced XBP1 peptide is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:2.
7. The method or composition for use of any of claims 1-4, wherein the CD138 peptide is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:3.
8. The method or composition for use of any of claims 1-4, wherein the CS-1 peptide is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:4.
9. The method or composition for use of any of claims 1-4, wherein the non-spliced XBP1 peptide consists of the amino acid sequence of SEQ ID NO:1.
10. The method or composition for use of any of claims 1-4, wherein the spliced XBP1 peptide consists of the amino acid sequence of SEQ ID NO:2.
11. The method or composition for use of any of claims 1-4, wherein the CD138 peptide consists of the amino acid sequence of SEQ ID NO:3.
12. The method or composition for use of any of claims 1-4, wherein the CS-1 peptide consists of the amino acid sequence of SEQ ID NO:4.
13. The method or composition for use of any of the preceding claims, wherein the method comprises administering, or the composition for use comprises: (a) a non-spliced XBP1 peptide described herein, (b) a spliced XBP1 peptide described herein, and (c) a CD138 peptide described herein.
14. The method or composition for use of any of the preceding claims, wherein the method comprises administering, or the composition for use comprises: (a) a non-spliced XBP1 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:1, (b) a spliced XBP1 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:2, and (c) a CD138 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:3.
15. The method or composition for use of any of the preceding claims, wherein the method comprises administering, or the composition for use comprises: (a) a non-spliced XBP1 peptide that consists of the amino acid sequence of SEQ ID NO:1, (b) a spliced XBP1 peptide that consists of the amino acid sequence of SEQ ID NO:2, and (c) a CD138 peptide that consists of the amino acid sequence of SEQ ID NO:3.
16. The method or composition for use of any of claims 13-15, wherein the method comprises administering, or the composition for use further comprises: (d) a CS-1 peptide described herein.
17. The method or composition for use of any of claims 13-15, wherein the method comprises administering, or the composition for use further comprises: (d) a CS-1 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:4.
18. The method or composition for use of any of claims 13-15, wherein the method comprises administering, or the composition for use further comprises: (d) a CS-1 peptide that consists of the amino acid sequence of SEQ ID NO:4.
19. The method or composition for use of any of the preceding claims, wherein the method further comprises administering, or the composition for use further comprises a combination with one or more immune stimulating agents.
20. The method or composition for use of claim 19, wherein the immune stimulating agent is selected from an adjuvant comprising carboxymethylcellulose, polyinosinic-polycytidylic acid, and poly-L-lysine double-stranded RNA (e.g., poly IC-LC, e.g., hiltonol); an adjuvant comprising a water-and-oil emulsion (e.g., montanide); and an adjuvant comprising a protein (e.g., a cytokine, GCSF, or GM-CSF).
21. The method or composition for use of any of the preceding claims, wherein the method comprises administering, or the composition for use further comprises an additional treatment, e.g., one or more chemotherapeutic agents, one or more forms of ionizing radiation, one or more immunotherapy agents (e.g., a cancer vaccine, an immune checkpoint inhibitor), one or more immune checkpoint inhibitors, e.g., an antibody which inhibits an immune checkpoint molecule (e.g., an anti-CTLA4 antibody, e.g., ipilimumab or tremelimumab, a PD-1 antibody, or a PDL-1 antibody), or an adjuvant, e.g., a small molecule adjuvant (e.g., thalidomide or a thalidomide derivative, e.g., lenalidomide).
22. The method or composition for use of any of the preceding claims, wherein the method comprises administering, or the composition for use further comprises poly IC-LC.
23. The method or composition for use of claim 1 or 2, wherein the breast cancer is triple negative breast cancer.
24. The method or composition for use of claim 3 or 4, wherein the subject has, or is at risk of developing, or is suspected of having, a cancer, e.g., breast cancer, e.g., triple negative breast cancer.
25. The method or composition for use of any of the preceding claims, wherein the breast cancer is metastatic breast cancer, e.g., metastatic triple negative breast cancer.
26. The method or composition for use of any of the preceding claims, wherein the subject has, or is identified as having, one or more cancer cells that express XBP1, CD138, or CS1, or any combination thereof.
27. The method of any of the preceding claims, further comprising after delivering the composition to the subject, determining if an immune response occurred in the subject.
28. The method of any of the preceding claims, wherein the subject is a human.
29. The method of any of the preceding claims, wherein the subject is in remission from breast cancer, e.g., triple negative breast cancer.
30. The method of any of the preceding claims, wherein (i) and (ii) are administered separately or together.
31. The method of any of the preceding claims, wherein (i) is administered before, concurrently with, or after (ii).
32. The composition for use of any of the preceding claims, wherein (i) and (ii) are formulated for use separately or together.
33. The composition for use of any of the preceding claims, wherein (i) is formulated for administration before, concurrently with, or after (ii).
34. The method or composition for use of any of the preceding claims, wherein the pembrolizumab is administered at a dose of 200 mg.
35. The method or composition for use of any of the preceding claims, wherein the pembrolizumab is administered every 3 weeks.
36. The method or composition for use of any of the preceding claims, wherein the one or more peptides are administered at a dose of: 0.8 mg total peptide, e.g., at 0.2 mg of the non-spliced XBP1 peptide, 0.2 mg of the spliced XBP1 peptide, 0.2 mg of the CD138 peptide, and 0.2 mg of the CS-1 peptide.
37. The method or composition for use of any of the preceding claims, wherein the one or more peptides are administered at a dose of: 0.6 mg total peptide, e.g., at 0.2 mg of the non-spliced XBP1 peptide, 0.2 mg of the spliced XBP1 peptide, and 0.2 mg of the CD138 peptide.
38. The method or composition for use of any of the preceding claims, wherein the one or more peptides are administered once every week, e.g., for at least 1, 2, 3, 4, 5, or 6 weeks.
Description
DETAILED DESCRIPTION
Peptides
[0126] The combination therapies herein comprise one or more immunogenic XBP1-, CD138-, and CS-1-derived peptides (and pharmaceutical compositions thereof). The therapies herein can be used to, e.g., induce an immune response (e.g., stimulate a CTL response), or stimulate the production of an antibody, in a subject having a cancer.
[0127] A detailed description of the peptides as well as exemplary methods for making and using the peptides are set forth below.
[0128] The disclosure features combination therapies comprising one or more isolated peptides comprising an amino acid sequence that has sufficient identity with or is identical to any one of SEQ ID NOS:1-4 as depicted in Table 1.
TABLE-US-00001 TABLE1 ExamplesofXBP1,CD138,andCS1peptides AminoAcid AminoAcid SEQ ProteinofOrigin Position Sequence IDNO: non-splicedXBP1 185-193 YISPWILAV 1 splicedXBP1 368-376 YLFPQLISV 2 CD138 260-268 GLVGLIFAV 3 CS1 239-247 SLFVLGLFL 4 Bolded residues indicate amino acid changes from the corresponding wild-type amino acid sequence.
[0129] In some embodiments, the isolated peptide is at least 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or 35 amino acids in length (e.g., between 9 and 35 amino acids in length, e.g., 9-30, 9-25, 9-20, 9-15 amino acids in length) and comprises an amino acid sequence that has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity or is identical to an amino acid sequence of SEQ ID NOS:1-4. Other suitable peptides can be at least 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or 35 amino acids in length (e.g., between 9 and 35 amino acids in length, e.g., 9-30, 9-25, 9-20, 9-15 amino acids in length) and comprise an amino acid sequence of SEQ ID NOS:1-4, or an amino acid sequence with one, two, three or four substitutions of the amino acid sequence of SEQ ID NOs:1-4 The substitution can be a conservative or nonconservative substitution.
[0130] Non-spliced XBP1 peptides include a peptide of SEQ ID NO: 1 and refer to a peptide having an amino acid sequence of at least 5 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35) consecutive amino acids from the non-spliced form of human XBP1 protein having 261 amino acids and the following sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQ ARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLE NQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPL QQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRS TQKDPVPYQPPFLCQWGRHQPSWKPLMN (SEQ ID NO:5; Genbank Accession No. NP_005071), and peptides having no more than one, two, three, four, five substitutions (e.g., conservative substitutions) of the amino acids derived from the amino acid sequence of SEQ ID NO:5. The non-spliced XBP1 amino acid positions referred to in Table 1 are based on SEQ ID NO: 5.
[0131] Spliced XBP1 peptides include a peptide of SEQ ID NO: 2 and refer to a peptide having an amino acid sequence of at least 5 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34 or 35) consecutive amino acids from the spliced form of human XBP1 (XBP1 spliced) protein having 376 amino acids and the following sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQ ARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLE NQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAGAGPVV TPPEHLPMDSGGIDSSDSESDILLGILDNLDPVMFFKCPSPEPASLEELPEVYPEGPSSLPA SLSLSVGTSSAKLEAINELIRFDHIYTKPLVLEIPSETESQANVVVKIEEAPLSPSENDHPEF IVSVKEEPVEDDLVPELGISNLLSSSHCPKPSSCLLDAYSDCGYGGSLSPFSDMSSLLGVN HSWEDTFANELFPQLISV (SEQ ID NO: 6; Genbank Accession No. NP_001073007), and peptides having no more than one, two, three, four, five substitutions (e.g., conservative substitutions) of the amino acids derived from the amino acid sequence of SEQ ID NO:6. The spliced XBP1 amino acid positions referred to in Table 1 are based on SEQ ID NO: 6.
[0132] CD138 peptides include a peptide of SEQ ID NO: 3 and refer to a peptide having an amino acid sequence of at least 5 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35) consecutive amino acids from the human CD138 protein having 310 amino acids and the following sequence: MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLS QQTPSTWKDTQLLTAIPTSPEPTGLEATAAS TSTLPAGEGPKEGEAVVLPEVEPGLTARE QEATPRPRETTQLPTTHQASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTP HTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQ GATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQAN GGAYQKPTKQEEFYA (SEQ ID NO:7; Genbank Accession No. NP_002988) and peptides having no more than one, two, three, four, five substitutions (e.g., conservative substitutions) of the amino acids derived from the amino acid sequence of SEQ ID NO:7. The CD138 amino acid positions referred to in Table 1 are based on SEQ ID NO: 7.
[0133] CS-1 peptides include a peptide of SEQ ID NO: 4 and refer to a peptide having an amino acid sequence of at least 5 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35) consecutive amino acids from the human CS-1 protein having 335 amino acids and the following sequence: MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTP LVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNG SILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLL SLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI (SEQ ID NO:8; Genbank Accession No. NP_067004) and peptides having no more than one, two, three, four, five substitutions (e.g., conservative substitutions) of the amino acids derived from the amino acid sequence of SEQ ID NO:8. The CS-1 amino acid positions referred to in Table 1 are based on SEQ ID NO: 8.
[0134] Peptides Generally
[0135] The peptides described herein are often referred to using the residue number of the N and C terminal amino acids of the peptides (e.g., XBP1.sub.118-126) as the relevant sequences occur in the wild-type, full length, mature human proteins having SEQ ID NOS: 5-8. These peptides will frequently have identical sequences to the corresponding segments of the wild-type, full-length, mature proteins having SEQ ID NOS: 5-8. It is understood, however, that the terms nonspliced XBP1 peptides (e.g., nonspliced XBP1 peptides having amino acid positions: 118-136, 185-193, 186-194, 190-198, 193-200, or 111-119), spliced XBP1 peptides (e.g., spliced XBP1 peptides having amino acid positions: 197-205, 194-202, 224-232, 368-376), CD138 peptides (e.g., CD138 peptides having amino acid positions: 256-264, 265-273, 260-268, 5-13, or 7-15), and CS1 peptides (e.g., CS-1 peptides have amino acid positions 236-245, 240-248, 239-247, 232-240, or 9-17) can be peptide fragments of the XBP1 nonspliced peptide, the XBP1 spliced peptide, the CD138, or CS-1 polypeptide (respectively) of a species other than human. As will be appreciated by those skilled in the art, the numbers of the N and C terminal amino acids of peptide fragments of such non-human polypeptides are not necessarily the same as those in the corresponding peptide fragments of human polypeptides. Moreover, the lengths and/or amino acids of peptide fragments of non-human polypeptides will not necessarily be the same as those in the corresponding peptide fragments of human polypeptides. Those of skill in the art will know how to establish the N and C terminal amino acids, the lengths, and amino acid sequences of peptides derived from non-human nonspliced XBP1, spliced XBP1, CD138, and CS-1 polypeptides. One useful method for doing this is sequence alignment and, in particular, maximum homology sequence alignment.
[0136] Percent identity between two peptide sequences (e.g., a peptide of SEQ ID NOS: 1-4) and another amino acid sequence that may be at least 66% identical to the peptide) can be determined using a variety of algorithms and computer programs including, but not limited to, Clustal W (The European Bioinformatics Institute (EMBL-EBI), BLAST-Protein (National Center for Biotechnology Information (NCBI), United States National Institutes of Health), and PSAlign (University of Texas A&M; Sze et al. (2006) Journal of Computational Biology 13:309-319).
[0137] Some of the peptides described herein are heteroclitic. As used herein, heteroclitic (e.g., a heteroclitic peptide) refers to a form of a peptide in which one or more amino acids have been modified from a wild-type or original sequence in order to produce a peptide that is more immunogenic than the corresponding wild-type peptide. For example, in the exemplary heteroclitic peptides of SEQ ID NO: 1 and SEQ ID NO: 2, the bolded amino acids indicate the amino acids that are modified from the wild-type sequence of XBP1.
[0138] Also disclosed herein are variants of the human and non-human peptides described above. Variants of the human and non-human peptides described herein can include forms of the peptides having: (i) not more than 4 (e.g., 3, 2, or 1) amino acid substitutions (e.g., conservative or non-conservative substitutions); (ii) terminal or internal deletions; or (iii) terminal or internal additions, all of which are elaborated on below.
[0139] The disclosure also features combination therapies comprising peptides comprising, consisting of, or consisting essentially of, an amino acid sequence of any of SEQ ID NOs: 1-4, but with not more than four (e.g., not more than three, not more than two, or not more than 1) substitutions. The substitutions can be, e.g., conservative or non-conservative (as described above).
[0140] Conservative substitutions include substitutions within the following groups: valine, alanine and glycine; leucine, valine, and isoleucine; aspartic acid and glutamic acid; asparagine and glutamine; serine, cysteine, and threonine; lysine and arginine; and phenylalanine and tyrosine. The non-polar hydrophobic amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine. The polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine. The positively charged (basic) amino acids include arginine, lysine, and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid. Any substitution of one member of the above-mentioned polar, basic or acidic groups by another member of the same group can be deemed a conservative substitution. By contrast, a non-conservative substitution is a substitution of one amino acid for another with dissimilar characteristics.
[0141] In some embodiments, one or more (e.g., one, two, three, four, or all five) of positions three, four, five, six, seven, and eight of any of the peptides are not substituted. In some embodiments, one or more of positions three, four, five, six, seven, and eight of any of the peptides are identical to the amino acids of the peptides in Table 1.
[0142] Also featured are fusion proteins comprising: a first amino acid sequence of a peptide described herein (e.g., a nonspliced XBP1 peptide described herein, a spliced XBP1 peptide described herein, a CD138 peptide described herein and/or a CS-1 peptide described herein); and a second amino acid sequence that is heterologous to the first amino acid sequence.
[0143] The second, heterologous amino acid sequence(s) of the peptide generally do not (and are selected such that do not) adversely affect the generation in the cell of an immunogenic peptide of any of SEQ ID NOs: 1-4. The cellular machinery is expected to remove any additional sequences in the peptide to yield an immunogenic peptide of any of SEQ ID NOs: 1-4, which peptide is presented by a class I or class II MHC molecule to stimulate an immune response against XBP1-, CD138-, or CS1-expressing cancer cells.
[0144] An amino acid sequence that is heterologous to a first amino acid sequence, or the term heterologous amino acid sequence, is any amino acid sequence other than the amino acid sequence(s) flanking the first amino acid sequence as it occurs in nature. For example, two or more (e.g., two, three, four, five, six, seven, eight, nine, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more) and/or less than 20 (e.g., 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, nine, eight, seven, six, five, four, three, two, or one) carboxy- and/or amino-terminal amino acid(s) immediately flanking GLVGLIFAV (SEQ ID NO:3) in a human CD138 are not considered to be heterologous to SEQ ID NO:3. It is understood that a fusion protein containing a first amino acid sequence that is less than 100% identical to, or contains from one to four conservative substitutions in, an amino acid sequence of any of SEQ ID NOs: 1-4, may not occur in nature at all.
[0145] In some embodiments, the second amino acid sequence can be a single amino acid. It is understood that an amino acid that is heterologous to a first amino acid sequence, or the term heterologous amino acid, is any amino acid other than the amino acid(s) flanking the first amino acid sequence as it occurs in nature. For example, the two amino acid(s) immediately flanking GLVGLIFAV (SEQ ID NO:3) in a human CD138 are not considered to be heterologous to SEQ ID NO:3.
[0146] A heterologous sequence can be, for example, a sequence used for purification of the recombinant protein (e.g., FLAG, polyhistidine (e.g., hexahistidine), hemagglutinin (HA), glutathione-S-transferase (GST), or maltose-binding protein (MBP)). Heterologous sequences can also be proteins useful as diagnostic or detectable markers, for example, luciferase, green fluorescent protein (GFP), or chloramphenicol acetyl transferase (CAT). In some embodiments, the fusion protein can contain a signal sequence from another protein such as a KDEL (SEQ ID NO:11) sequence or any other described herein. In some embodiments, the fusion protein can contain all or part of an immunoglobulin molecule (e.g., all or part of an immunoglobulin heavy chain constant region; see below). In some embodiments, the fusion protein can contain a therapeutic or immune-stimulating polypeptide (e.g., a T helper epitope (e.g., a PADRE epitope or a Tetanus Toxoid universal T helper cell epitope) or all or part of a cytokine or chemokine) and/or a carrier (e.g., KLH) useful, e.g., in eliciting an immune response (e.g., for antibody generation). In some embodiments, the fusion protein can contain one or more linkers, e.g., a linker comprising a peptide sequence (see below). The fusion protein can also contain a targeting polypeptide. Heterologous sequences can be of varying length and in some cases can be longer sequences than the first amino acid sequences to which the heterologous amino acid sequences are attached. It is understood that a fusion protein containing a first amino acid sequence and a second amino acid sequence that is heterologous to the first does not correspond in sequence to a naturally occurring protein.
[0147] Targeting polypeptides, as used herein, are polypeptides that target the moiety (or moieties) they are attached to (e.g., the first amino acid sequence) to specific tissues (e.g., to a lymph node) or cells (e.g., to an antigen presenting cell or other immune cell), or where in vitro, specific isolated molecules or molecular complexes. Targeting polypeptides can be, e.g., an antibody (immunoglobulin) or antigen binding fragment thereof or a ligand for a cell surface receptor. An antibody (or antigen-binding fragment thereof) can be, e.g., a monoclonal antibody, a polyclonal antibody, a humanized antibody, a fully human antibody, a single chain antibody, a chimeric antibody, or an Fab fragment, an F(ab).sub.2 fragment, an Fab fragment, an Fv fragment, or an scFv fragment of an antibody. Antibody fragments that include, or are, Fc regions (with or without antigen-binding regions) can also be used to target the reagents to Fc receptor-expressing cells (e.g., antigen presenting cells such as interdigitating dendritic cells, macrophages, monocytes, or B cells). A ligand for a cell surface receptor can be, e.g., a chemokine, a cytokine (e.g., interleukins 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16), or a death receptor ligand (e.g., FasL or TNF).
[0148] In some embodiments, the heterologous sequence can be, e.g., a transportation sequence that aids in the delivery of the peptide to the cell or to a specific compartment of a cell (e.g., the endoplasmic reticulum or Golgi apparatus). Transportation sequences can include, e.g., membrane translocating sequence, a transportan sequence, an antennapedia sequence, a cyclic integrin-binding peptide, and a Tat-mediated peptide, or modified versions thereof.
[0149] A linker, e.g., a linker peptide, can, directly or indirectly, connect the first amino acid sequence to one or more heterologous amino acid sequences. For example, a linker can connect the first amino acid sequence to a second amino acid sequence. A linker peptide can be, or contain, e.g., stretches of amino acids where at least four to six amino acids are glycine. (See, e.g., Mancebo et al. (1990) Mol. Cell. Biol. 10:2492-2502). A linker peptide can also be, or contain, six or more (e.g., seven, eight, nine, 10, 11, or 12 or more) histidine residues. The linker peptide can be, or contain, at least one (e.g., one, two, three, four, five, six, seven, or eight or more) protease cleavage site(s). The protease sites can be, e.g., a trypsin, a chymotrypsin, or a factor Xa cleavage site. Such protease sites can be useful, e.g., to separate a first amino acid sequence from a heterologous sequence. For example, after expression and purification of a fusion protein containing a first amino acid sequence joined to a polyhistidine sequence (in this case used for purification) by a trypsin protease cleavage site, the polyhistidine sequence can be removed from first amino acid sequence by contacting the fusion protein with trypsin.
[0150] The first amino acid sequence and the second amino acid sequence can be associated with each other in a variety of ways. As used herein, associated with in the context of an interaction between two or more atoms or molecular units, includes any covalent or non-covalent bonding, or physical admixture, of two or more atoms or molecular units (e.g., a first amino acid sequence and a second amino acid sequence). The chemical nature of covalent bonds (two atoms sharing one or more pairs of valence electrons) are known in the art and include, e.g., disulfide bonds or peptide bonds. A non-covalent bond is a chemical bond between atoms or molecules that does not involve the sharing of pairs of valence electrons. For example, non-covalent interactions include, e.g., hydrophobic interactions, hydrogen-bonding interactions, ionic bonding, Van der Waals bonding, or dipole-dipole interactions. Examples of such non-covalent interactions include antibody-antigen complexing or binding pair interactions (interactions of a first and second member of a binding pair such as the interaction between streptavidin and biotin). It is understood that the term associated with (e.g., in the context of a first amino acid sequence and a second amino acid sequence) is thus coextensive with the term comprising.
[0151] In some embodiments, the first amino acid sequence and second amino acid sequence can be encoded by (and expressed as fusion protein from) a single nucleic acid sequence. In some instances, the first amino acid sequence and second amino acid sequence can be encoded by two or more (e.g., three, four, five, or six or more) different nucleic acid sequences. For example, the first amino acid sequence can be encoded by a first nucleic acid sequence and the second amino acid sequence can be encoded by a second nucleic acid sequence.
[0152] When expressed or produced separately, a first amino acid sequence and a second amino acid sequence can be cross-linked together using any of a number of known chemical cross linkers. Examples of such chemical cross-linkers are those which link two amino acid residues via a linkage that includes a hindered disulfide bond. In these linkages, a disulfide bond within the cross-linking unit is protected (by hindering groups on either side of the disulfide bond) from reduction by the action, for example, of reduced glutathione or the enzyme disulfide reductase. One suitable chemical cross-linker, 4-succinimidyloxycarbonyl--methyl-(2-pyridyldithio)toluene (SMPT), forms such a linkage between the two amino acid sequences utilizing a terminal lysine on one of the amino acid sequences and a terminal cysteine on the other. Heterobifunctional reagents which cross-link by a different coupling moiety on each amino acid sequence. In this way, the resulting dimers will be heterodimers (peptides containing the first and second amino acid sequences) rather than either homodimers (e.g., two first amino acid sequences or two second amino acid sequences) or a mixture of homodimers and heterodimers. Thus, the coupling moiety on a first amino acid sequence could be a cysteine residue and on the other a lysine residue. Other useful cross-linkers include, without limitation, chemicals that link two amino groups (e.g., N-5-Azido-2-nitrobenzoyloxysuccinimide), two sulfhydryl groups (e.g., 1,4-Bis-maleimidobutane) an amino group and a sulfhydryl group (e.g., m-Maleimidobenzoyl-N-hydroxysuccinimide ester), an amino group and a carboxyl group (e.g., 4-[p-Azidosalicylamido]butylamine), and an amino group and a guanadium group that is present in the side chain of arginine (e.g., p-Azidophenyl glyoxal monohydrate).
[0153] The coupling moieties will, in some embodiments, be at the termini (C or N) of each amino acid sequence. They can be, as indicated above, a cysteine residue on each amino acid sequence, or a cysteine on one and a lysine on the other. Where they are two cysteine residues, cross-linking can be effected by, for example, exposing amino acid sequences to oxidizing conditions.
[0154] A fusion protein can contain a first amino acid sequence and a second amino acid sequence or the fusion protein can contain more than one (e.g., two, three, four, five, six, seven, or eight or more) additional heterologous amino acid sequences. The additional heterologous amino acid sequences can flank, or be joined to, the amino terminus and/or the carboxy-terminus of the first amino acid sequence.
[0155] Where more than two amino acid sequences are to be joined, at least one of the amino acid sequences can have more than one cross-linking moiety. For example, a first amino acid sequence can have a cross-linking moiety at the amino-terminus and carboxy-terminus. Such multimers can be constructed sequentially. Thus, each amino acid sequence is joined to the next such that the terminal amino acid sequences in the chain only have one residue involved in an inter-domain (or inter-agent) bond while the internal amino acid sequence(s) each have two moieties involved in inter-domain bonds. Alternatively, one amino acid sequence (such as the first amino acid sequence) could be linked to multiple (e.g., 2, 3, 4, or 5) other amino acid sequences.
[0156] A combination therapy described herein can include a first component and a second component, wherein the first component is a peptide described herein. The second component can be, e.g., a heterologous amino acid sequence (as described above), any other antigenic peptide (e.g., a peptide other than those described herein, a detectable label (see below), a therapeutic agent, or a prophylactic agent (see below). For example, a peptide composition can contain an amino acid sequence consisting of, or consisting essentially of, any of SEQ ID NOs: 1-4 and a detectable label such as a radionuclide.
[0157] It is understood that in some embodiments, a peptide described herein can have at the amino-terminal end and/or carboxy-terminal end up to 200 (e.g., one, two, three, four, five, six, seven, eight, nine, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200) amino acids that are heterologous.
[0158] The peptides described herein can bind to a major histocompatibility complex (MHC) molecule (e.g., an MHC class I molecule or an MHC class II molecule). The Major Histocompatibility Complex or MHC is a cluster of genes that plays a role in control of the cellular interactions responsible for physiologic immune responses. In humans, the MHC is known as the HLA complex (see, e.g., Paul et al., FUNDAMENTAL IMMUNOLOGY, 3.sup.rd Edition, Raven Press, New York, (1993) and Stites, et al., IMMUNOLOGY, 8.sup.th Edition, Lange Publishing, Los Altos, Calif. (1994)).
[0159] An HLA supertype or family, as used herein, refers to sets of HLA molecules grouped on the basis of shared peptide-binding specificities. HLA class I molecules that share somewhat similar binding affinity for peptides bearing certain amino acid motifs are grouped into HLA supertypes. The terms HLA superfamily, HLA supertype family, HLA family, and HLA xx-like molecules (where xx denotes a particular HLA type), are synonyms. Types of HLA class I molecules include, e.g., HLA-A1, HLA-A2, HLA-A3, HLA-A24, HLA-B7, HLA-B27, HLA-B44, HLA-B58, or HLA-B62. Such HLA molecules are described in detail in U.S. Pat. No. 7,026,443, the entire disclosure of which is incorporated by reference in its entirety.
[0160] A peptide can bind to an MHC molecule with high affinity or intermediate affinity. As used herein, high affinity binding of a peptide to an HLA class I molecule is defined as a binding with a dissociation constant (K.sub.D) of less than 50 (e.g., 45, 40, 35, 30, 25, 20, 15, 10, 5, 1, 0.5, 0.1, or less than 0.05) nM. Intermediate affinity is a binding of a peptide to an HLA class I molecule with a K.sub.D of between about 50 nM and about 500 nM (e.g., 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, or 500 nM). High affinity binding of a peptide to HLA class II molecules is defined as binding with a K.sub.D of less than 100 (e.g., 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, 5, 1, 0.5, 0.1, or less than 0.05) nM. Intermediate affinity of a peptide for an HLA class II molecule is binding with a K.sub.D of between about 100 and about 1000 nM (e.g., 100, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, or 1000 nM). Methods for determining the binding affinity of a peptide and an MHC molecule are described in, e.g., U.S. Pat. No. 7,026,443.
[0161] The peptides described herein can also be, in association with an MHC molecule, recognized by an antigen specific T cell receptor on a T cell. A variety of suitable methods can be used to determine whether a peptide, in association with an MHC molecule, is recognized by a T cell receptor on a T cell. For example, peripheral blood lymphocytes (PBL) from normal subjects can be cultured with a test peptide in the presence of antigen presenting cells in vitro over a period of several weeks. T cells specific for the peptide become activated during this time and can be detected using, e.g., proliferation assays (carboxyfluoroscein succinimidyl ester (CFSE) assays or .sup.3H-thymidine assays), limiting dilution assays, cytotoxicity assays (e.g., calcein-release assays), or cytokine- (e.g., IFN), lymphokine-, or .sup.51Cr-release assays (see, e.g., Wentworth, P. A. et al., Mol. Immunol. 32:603, 1995; Celis, E. et al., Proc. Natl. Acad. Sci. USA 91:2105, 1994; Tsai, V. et al., J. Immunol. 158:1796, 1997; Kawashima, I. et al., Human Immunol. 59:1, 1998, the disclosures of each of which are incorporated by reference in their entirety). A suitable in vivo method involves immunizing HLA transgenic mice, wherein peptides in adjuvant are administered subcutaneously to HLA transgenic mice and several weeks following immunization, splenocytes are removed and cultured in vitro in the presence of test peptide for approximately one week and peptide-specific T cells are detected using, e.g., a .sup.51Cr-release assay (see, e.g., Wentworth, P. A. et al., J. Immunol. 26:97, 1996; Wentworth, P. A. et al., Int. Immunol. 8:651, 1996; Alexander, J. et al., J. Immunol. 159:4753, 1997, the disclosures of each of which are incorporated by reference in their entirety).
[0162] Additionally, direct quantification of antigen-specific T cells can be performed by staining T cells with detectably-labeled MHC complexes such as any of the MHC molecule multimer compositions described in International Application WO2014/071402, or HLA-I tetramers (e.g., as described in Altman, J. D. et al., Proc. Natl. Acad. Sci. USA 90:10330, 1993 and Altman, J. D. et al., Science 274:94, 1996, the disclosures of each of which are incorporated by reference in their entirety).
[0163] In some embodiments, the peptides can be modified (e.g., amino acids of the peptides can be substituted) in order to modulate (e.g., increase or decrease) one of more properties of the peptides. For example, one or more (e.g., two, three, or four) amino acids of one of the peptides depicted in Table 1 can be substituted in order to increase the affinity of the peptide for an MHC molecule. In some embodiments, an amino acid of one of the peptides described herein (e.g., a T cell Receptor contacting amino acid residue of the peptide) can be modified in order to enhance a binding interaction between a T cell receptor and the peptide (in the context of an MHC molecule). Such modified peptides are often referred to as altered peptide ligands. (See, e.g., Kalergis et al. (2000) J Immunol. 165(1):280; Conlon et al. (2002) Science 1801; and International Publication No. WO02070003, the disclosure of each of which is incorporated by reference in their entirety).
[0164] Suitable methods for modifying the peptides as well as determining the effect of the modification are described in, e.g., International Application WO2014/071402 and Collins et al. (Immunlogical Reviews (1998) 163:151-160, the disclosure of each of which is incorporated by reference in its entirety).
[0165] Suitable methods for producing the peptides herein, and nucleic acids encoding the peptides, are described in, e.g., the sections entitled Nucleic Acids and Methods for Producing the Peptides and Additional Processing of the Peptides in International Application WO2014/071402, which application is herein incorporated by reference in its entirety.
[0166] The peptides (and fusion proteins) described herein can, but need not, be isolated. The term isolated, as applied to any of the peptides (or fusion proteins) described herein, refers to a peptide, a fragment thereof, (or for compositions, a macromolecular complex), that has been separated or purified from components (e.g., proteins or other naturally-occurring biological or organic molecules) which naturally accompany it. It is understood that recombinant molecules (e.g., recombinant peptides) will always be isolated. Typically, a peptide (or fragment or macromolecular complex) is isolated when it constitutes at least 60%, by weight, of the total molecules of the same type in a preparation, e.g., 60% of the total molecules of the same type in a sample. For example, a peptide described herein is considered isolated when it constitutes at least 60%, by weight, of the total protein in a preparation or sample. In some embodiments, a molecule in the preparation consists of at least 75%, at least 90%, or at least 99%, by weight, of the total molecules of the same type in a preparation. A peptide can also be isolated when it is present in a mixture with other isolated peptides, e.g., a mixture of equal mass amounts of two, three, or four different peptides.
[0167] In some embodiments, the isolated peptides, fusion proteins, peptide-coding sequences, fusion protein-coding sequences or vectors can be frozen, lyophilized, or immobilized and stored under appropriate conditions, which allow the molecules to retain activity (e.g., the ability of a peptide to bind to an MHC molecule such as an MHC class I molecule or the ability of a vector to support expression of a peptide in a cell).
[0168] Additional Processing of the Peptides
[0169] Following the expression or synthesis of any of the peptides (or fusion proteins) described herein, the peptides (or fusion proteins) can be further processed. The further processing can include chemical or enzymatic modifications to peptides (or fusion protein) or, in cases where the peptides (or fusion proteins) are modified, the processing can include enzymatic or chemical alterations of existing modifications, or both. The additional processing of the peptides can include the addition (covalent or non-covalent joining) of a heterologous amino acid sequence such as, but not limited to, any of the heterologous amino acid sequences described above. Enzymatic treatment can involve contacting a peptide with, e.g., one or more proteases, phosphatases, or kinases under conditions that allow the peptide to be modified. Enzymatic treatment can involve contacting a peptide with one or more enzymes (e.g., an oligosaccharyltransferase or a mannosidase) capable of glycosylating, or modifying the glycosylation of, the peptide.
[0170] The processing can include the addition of, e.g., a detectable label to a peptide. For example, a peptide can be detectably labeled with an enzyme (e.g., horseradish peroxidase, alkaline phosphatase, -galactosidase, or acetylcholinesterase), a fluorescent material (e.g., umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine, fluorescein, dansyl chloride, allophycocyanin (APC), or phycoerythrin), a luminescent material (e.g., a lanthanide or chelate thereof), a bioluminescent material (e.g., luciferase, luciferin, or aequorin), or a radionuclide (e.g., .sup.3H, .sup.32P, .sup.33P, .sup.125I, or .sup.35S).sub..
[0171] The processing can also involve the coupling of the peptide (or fusion protein) to a polymer (e.g., a polyalkylene glycol moiety such as a polyethylene glycol moiety). In some embodiments, the polymer is coupled to the peptide at a site on the peptide that is an N terminus.
[0172] In some embodiments, a peptide can contain one or more internal amino acid insertions that provide an internal polymer conjugation site to which a polymer can be conjugated.
Pembrolizumab
[0173] The combination therapies herein include pembrolizumab. Pembrolizumab is a monoclonal anti-PD-1 antibody molecule having the light chain and heavy chain sequence set out below.
[0174] The International Nonproprietary Names for Pharmaceutical Substances (INN) (WHO Drug Information, Vol. 28, No. 3, 2014) (incorporated by reference in its entirety, including the section entitled pembrolizumab on p. 407) provides the pembrolizumab heavy and light chain sequences as:
TABLE-US-00002 PembrolizumabHeavychainsequence: (SEQIDNO:9) QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGG50 INPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRD100 YRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVK150 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT200 YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDT250 LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY300 RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT350 LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS400 DGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK447 PembrolizumabLightchainsequence: (SEQIDNO:10) EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRL50 LIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPL100 TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV150 QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV200
[0175] Pembrolizumab can be formulated for parenteral administration, e.g., intravenous administration.
[0176] In embodiments, pembrolizumab is administered at 200 mg every 3 weeks. In embodiments, pembrolizumab is administered every 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks. In embodiments, pembrolizumab is administered intravenously. In embodiments, pembrolizumab is administered intravenously over the course of 30 minutes. In embodiments, pembrolizumab is administered at 2 mg/kg body weight every 3 weeks.
[0177] In embodiments, the combination therapies herein comprise administering pembrolizumab and a peptide composition described herein. In embodiments, the combination therapies herein comprise administering an antibody molecule related to pembrolizumab (e.g., in place of pembrolizumab in any of the methods herein). In embodiments, the antibody molecule comprises a heavy chain sequence having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 9. In embodiments, the antibody molecule comprises a light chain sequence having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 10. In embodiments, the antibody molecule comprises a VH region having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to the VH region from SEQ ID NO: 9, or having the CH region from SEQ ID NO: 9. In embodiments, the antibody molecule comprises a VL region having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to the VL region from SEQ ID NO: 10, or having the VL region from SEQ ID NO: 10. In embodiments, the antibody molecule comprises a HC CDR1, HC CDR2, and HC CDR3 from SEQ ID NO: 9, wherein the CDRs are defined according to Kabat, Chothia, or combined Kabat and Chothia. In embodiments, the antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 from SEQ ID NO: 10, wherein the CDRs are defined according to Kabat, Chothia, or combined Kabat and Chothia.
[0178] As used herein, antibody molecule refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence. The term antibody molecule encompasses antibodies and antibody fragments. In an embodiment, an antibody molecule is a multispecific antibody molecule, e.g., a bispecific antibody molecule.
[0179] The term antibody, as used herein, refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen. Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact immunoglobulins, and may be derived from natural sources or from recombinant sources. Antibodies can be tetramers of immunoglobulin molecules.
[0180] The term antibody fragment refers to at least one portion of an antibody, that retains the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen. Examples of antibody fragments include, but are not limited to, Fab, Fab, F(ab)2, Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CH1 domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody. An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005).
[0181] The term complementarity determining region or CDR, as used herein, refers to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. For example, in general, there are three CDRs in each heavy chain variable region (e.g., HCDR1, HCDR2, and HCDR3) and three CDRs in each light chain variable region (LCDR1, LCDR2, and LCDR3). The precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (Kabat numbering scheme), Al-Lazikani et al., (1997) JMB 273,927-948 (Chothia numbering scheme), or a combination thereof. Under the Kabat numbering scheme, in some embodiments, the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3). Under the Chothia numbering scheme, in some embodiments, the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3). In a combined Kabat and Chothia numbering scheme, in some embodiments, the CDRs correspond to the amino acid residues that are part of a Kabat CDR, a Chothia CDR, or both. For instance, in some embodiments, the CDRs correspond to amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in a VH, e.g., a mammalian VH, e.g., a human VH; and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in a VL, e.g., a mammalian VL, e.g., a human VL.
Pharmaceutical Compositions
[0182] Any of the peptides, fusion proteins, or other therapeutics described herein can be incorporated into pharmaceutical compositions. Such compositions may include one or more of the peptides (and/or nucleic acids encoding the peptides) and a pharmaceutically acceptable carrier. The composition may further include pembrolizumab. As used herein the language pharmaceutically acceptable carrier includes solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. One or more peptides can be formulated as a pharmaceutical composition in the form of a syrup, an elixir, a suspension, a powder, a granule, a tablet, a capsule, a lozenge, a troche, an aqueous solution, a cream, an ointment, a lotion, a gel, an emulsion, etc. Supplementary active compounds (e.g., one or more chemotherapeutic agents) can also be incorporated into the compositions. In embodiments, the composition comprises two or more (e.g., 2, 3, 4, 5, or 6) of the peptides described herein. The composition may also include an immunogenic peptide other than one disclosed herein, e.g., a peptide from WT1 or a derivative thereof, e.g., as described herein. Other immunogenic peptides include, but are not limited to, an immunogenic peptide from MUC1, an immunogenic peptide from gp100, an immunogenic peptide from TRP-2, an immunogenic peptide from MAGI, an immunogenic peptide from NY-ESO1, an immunogenic peptide from HER-2; and an immunogenic peptide from AIM2.
[0183] A pharmaceutical composition is generally formulated to be compatible with its intended route of administration. Examples of routes of administration include oral, rectal, and parenteral, e.g., intravenous, intramuscular, intradermal, subcutaneous, inhalation, transdermal, or transmucosal. Solutions or suspensions used for parenteral application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The compositions can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. Additional formulations, e.g., for the peptide compositions, are described in International Application WO2014/071402, which is herein incorporated by reference in its entirety, including the section therein on pages 77-81 entitled Pharmaceutical Compositions.
[0184] In embodiments, the one or more peptides are formulated for injection, e.g., subcutaneous injection. In embodiments, the pembrolizumab is formulated for injection, e.g., intravenous injection.
[0185] Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the peptides (or fusion proteins or nucleic acids) can be formulated into ointments, salves, gels, or creams as generally known in the art.
[0186] In one embodiment, the compositions herein (e.g., peptides and/or antibody molecules) can be prepared with carriers that will protect the peptide or antibody molecule against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to, e.g., APCs with monoclonal antibodies to APC-specific antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811.
[0187] Any of the pharmaceutical compositions described herein can be included in a container, pack, or dispenser together with instructions for administration as described below.
[0188] Applications
[0189] The combination therapies, compositions, pharmaceutical compositions, and kits herein can be used in a variety of methods. For example, the combination therapies and compositions described herein can be used to: (i) induce an immune response in a subject with a solid tumor, e.g., a breast cancer; (ii) activate a T cell in culture (e.g., a central memory T cell and/or effector memory T cell); and/or (iii) treat or even prevent a solid tumor, e.g., a breast cancer. Solid tumors include, e.g., lung cancer, liver cancer, bile duct cancer, stomach cancer, cervical cancer, nasopharyngeal cancer, breast cancer, colon cancer, pancreatic cancer, and prostate cancer. In some embodiments, the cancer, e.g., the breast cancer, is relapsed or refractory. In some embodiments, the cancer is relapsed or refractory triple negative breast cancer.
[0190] While the utility of the combination therapies, compositions, pharmaceutical compositions, and kits herein is in no way limited to any of the particular embodiments described herein, exemplary methods in which these reagents can be used are provided below.
[0191] Methods for Inducing an Immune Response
[0192] The disclosure also features a variety of methods for inducing an immune response in a subject having a cancer, e.g., a breast cancer. The methods for inducing an immune response in a subject having a cancer can include the step of administering to a subject one or more of any of combinations described herein or any of the pharmaceutical compositions described herein. The immune response can be a CD8.sup.+ T cell, a CD4.sup.+ T cell, a cytotoxic T lymphocyte (CTL), a T.sub.H1 response, a T.sub.H2 response, or a combination of both types of responses.
[0193] The combination therapies herein can be used in a variety of applications such as methods for inducing an immune response in a subject, methods for producing an antibody in a subject, and methods for treating a cancer, e.g., a breast cancer, e.g., triple negative breast cancer.
[0194] Any of the methods herein can also be, e.g., methods for treating or preventing (prophylaxis against) a cancer (e.g., breast cancer, e.g., triple negative breast cancer, or any other cancer expressing XBP1, CD138, or CS1) in a subject. When the terms prevent, preventing, or prevention are used herein in connection with a given treatment for a given condition, they mean that the treated subject does not develop a clinically observable level of the condition at all (e.g., the subject does not exhibit one or more symptoms of the condition or, in embodiments, the subject does not develop a detectable level of the cancer).
[0195] As used herein, the term treat treatment, or treating a subject having a disorder, e.g., a cancer, are used in connection with a given treatment for a given disorder, wherein at least one symptom of the disorder is cured, healed, alleviated, relieved, altered, remedied, ameliorated, or improved. Treating includes administering an amount of a composition effective to alleviate, relieve, alter, remedy, ameliorate, improve or affect the disorder or the symptoms of the disorder. The treatment may inhibit deterioration or worsening of a symptom of a disorder or may cause the condition to develop more slowly and/or to a lesser degree (e.g., fewer symptoms or lower numbers of cancer cells in the subject) in the subject than it would have absent the treatment. For example, a treatment will be said to have treated the condition if it is given during the condition, e.g., during an early diagnosis of a cancer (e.g., the detection of a few cancer cells in a sample from the subject) that would have been expected to produce a given manifestation of the condition (an advanced cancer), and results in the subject's experiencing fewer and/or milder symptoms of the condition than otherwise expected. A treatment can treat a cancer (e.g., breast cancer, e.g., triple negative breast cancer) when the subject displays only mild overt symptoms of the cancer.
[0196] In an embodiment, the cancer is a cancer described herein. For example, the cancer can be a cancer of the bladder (including accelerated and metastatic bladder cancer), breast (e.g., estrogen receptor positive breast cancer, estrogen receptor negative breast cancer, HER-2 positive breast cancer, HER-2 negative breast cancer, triple negative breast cancer, inflammatory breast cancer), colon (including colorectal cancer), kidney (e.g., renal cell carcinoma (e.g., papillary renal cell carcinoma, clear cell carcinoma, chromphobic carcinoma)), liver, lung (including small cell lung cancer and non-small cell lung cancer (including adenocarcinoma, squamous cell carcinoma, bronchoalveolar carcinoma and large cell carcinoma)), genitourinary tract, e.g., ovary (including fallopian, endometrial and peritoneal cancers), cervix, prostate and testes, lymphatic system, rectum, larynx, pancreas (including exocrine pancreatic carcinoma), stomach (e.g., gastroesophageal, upper gastric or lower gastric cancer), gastrointestinal cancer (e.g., anal cancer or bile duct cancer), gall bladder, thyroid, leukemia (e.g., acute myeloid leukemia), neural and glial cell cancers (e.g., glioblastoma multiforme), and head and neck (e.g., nasopharyngeal cancer).
[0197] Administration can be by periodic injections of a bolus of the pharmaceutical composition or can be uninterrupted or continuous by intravenous or intraperitoneal administration from a reservoir which is external (e.g., an IV bag) or internal (e.g., a bioerodable implant, a bioartificial organ, or a colony of implanted reagent production cells). See, e.g., U.S. Pat. Nos. 4,407,957, 5,798,113 and 5,800,828, each incorporated herein by reference in their entirety.
[0198] In general, the dosage of a peptide or an antibody molecule required depends on the choice of the route of administration; the nature of the formulation; the nature or severity of the subject's illness; the immune status of the subject; the subject's size, weight, surface area, age, and sex; other drugs being administered; and the judgment of the attending medical professional.
[0199] Suitable dosages of peptide for inducing an immune response are in the range of 0.000001 to 10 mg of the reagent or antigenic/immunogenic composition per kg of the subject. Variations in the needed dosage are to be expected in view of the variety of reagents and the differing efficiencies of various routes of administration. For example, nasal or rectal administration may require higher dosages than administration by intravenous injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization as is well understood in the art. Administrations can be single or multiple (e.g., 2-, 3-, 4-, 6-, 8-, 10-, 20-, 50-, 100-, 150-, or more fold). For example, a peptide or peptides can be administered as an initial immunization and then administered one or more times subsequently as a booster immunization.
[0200] In order to optimize therapeutic efficacy (e.g., the efficacy of the one or more peptides or the nucleic acids encoding the peptides to induce an immune response in a subject), compositions containing the peptides can be first administered at different dosing regimens. The unit dose and regimen depend on factors that include, e.g., the species of mammal, its immune status, the body weight of the mammal.
[0201] The frequency of dosing for a pharmaceutical composition (e.g., a pharmaceutical composition described herein) is within the skills and clinical judgement of medical practitioners (e.g., doctors or nurses). Typically, the administration regime is established by clinical trials which may establish optimal administration parameters. However, the practitioner may vary such administration regimes according to the subject's age, health, weight, sex and medical status.
[0202] In some embodiments, a pharmaceutical composition can be administered to a subject at least two (e.g., three, four, five, six, seven, eight, nine, 10, 11, 12, 15, or 20 or more) times. For example, a pharmaceutical composition can be administered to a subject once a month for three months; once a week for a month; every other week, once a year for three years, once a year for five years; once every five years; once every ten years; or once every three years for a lifetime.
[0203] In some embodiments, the reagent can be administered with an immune modulator such as a Toll Receptor ligand or an adjuvant (see below).
[0204] As defined herein, a therapeutically effective amount of a peptide or a nucleic acid encoding a peptide is an amount of the peptide or nucleic acid that is capable of producing an immune response in a treated subject. A therapeutically effective amount of a peptide (i.e., an effective dosage) includes milligram, microgram, nanogram, or picogram amounts of the reagent per kilogram of subject or sample weight (e.g., about 1 nanogram per kilogram to about 500 micrograms per kilogram, about 1 microgram per kilogram to about 500 milligrams per kilogram, about 100 micrograms per kilogram to about 5 milligrams per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram). A therapeutically effective amount of a nucleic acid also includes microgram, nanogram, or picogram amounts of the reagent per kilogram of subject or sample weight (e.g., about 1 nanogram per kilogram to about 500 micrograms per kilogram, about 1 microgram per kilogram to about 500 micrograms per kilogram, about 100 micrograms per kilogram to about 500 micrograms per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram).
[0205] As defined herein, a prophylactically effective amount of a peptide or nucleic acid encoding a peptide is an amount of the peptide or nucleic acid that is capable of producing an immune response against a cancer cell (e.g., a breast cancer cell) in a treated subject, which immune response is capable of preventing the development of a cancer in a subject or is able to substantially reduce the chance of a subject developing or continue developing a cancer (see above). A prophylactically effective amount of a peptide (i.e., an effective dosage) includes milligram, microgram, nanogram, or picogram amounts of the reagent per kilogram of subject or sample weight (e.g., about 1 nanogram per kilogram to about 500 micrograms per kilogram, about 1 microgram per kilogram to about 500 milligrams per kilogram, about 100 micrograms per kilogram to about 5 milligrams per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram). A prophylactically effective amount of a nucleic acid also includes microgram, nanogram, or picogram amounts of the reagent per kilogram of subject or sample weight (e.g., about 1 nanogram per kilogram to about 500 micrograms per kilogram, about 1 microgram per kilogram to about 500 micrograms per kilogram, about 100 micrograms per kilogram to about 500 micrograms per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram).
[0206] The subject can be any animal capable of an immune response to an antigen such as, but not limited to, a mammal, e.g., a human (e.g., a human patient) or a non-human primate (e.g., chimpanzee, baboon, or monkey), mouse, rat, rabbit, guinea pig, gerbil, hamster, horse, a type of livestock (e.g., cow, pig, sheep, or goat), a dog, cat, or a whale. The subject can be one having, suspected of having, or at risk of developing a solid tumor such as breast cancer e.g., triple negative breast cancer, or any other type of solid tumor that expresses XBP1, CD138, or CS-1 (e.g., lung cancer, liver cancer, bile duct cancer, stomach cancer, cervical cancer, nasopharyngeal cancer, colon cancer, or pancreatic cancer). The subject can be one in remission from the cancer, e.g., the breast cancer.
[0207] The methods can also include the step of, prior to administering the one or more peptides (or nucleic acids) to the subject, determining whether one or more cancer cells of the subject's cancer (e.g., breast cancer) express XBP1, CD138, or CS-1. Expression of these proteins includes both mRNA and protein expression. Methods for detecting protein and mRNA expression in a cell include, e.g., enzyme-linked immunosorbent assay (ELISA), western and dot-blotting techniques, or immunohistochemistry techniques for detecting protein and reverse transcription-polymerase chain reaction (RT-PCR) or northern-blotting techniques for detecting mRNA.
[0208] The peptides or composition may be used in combination with other known therapies. Administered in combination, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as simultaneous or concurrent delivery. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
[0209] In some embodiments, delivery is such that the combination therapy results in a greater immune response observed than in a patient treated only with the same dose of the one or more peptides. In some embodiments, delivery is such that the combination therapy results in a greater clinical response observed than in a patient treated only with the same dose of the one or more peptides. In some embodiments, delivery is such that the combination therapy results in a greater clinical response observed than in a patient treated only with the same dose of the pembrolizumab. In some embodiments, delivery is such that the combination therapy results in a similar clinical response between the combination therapy and a pembrolizumab monotherapy, wherein the pembrolizumab is administered less frequently or at a lower dose as part of the combination therapy than as a monotherapy.
[0210] In some embodiments, the method of treatment comprises administering: (a) one or more peptides described herein, (b) pembrolizumab, and (c) one or more additional treatment. In embodiments, the additional treatment comprises surgery, chemotherapy (e.g., adjuvant or neo-adjuvant chemotherapy).
[0211] The additional treatment can be, e.g., surgery, one or more chemotherapeutic agents, one or more forms of ionizing radiation, and/or one or more immunomodulatory agents.
[0212] The one or more forms of ionizing radiation can be gamma-irradiation, X-irradiation, or beta-irradiation.
[0213] Exemplary classes of chemotherapeutic agents include, e.g., the following:
[0214] alkylating agents (including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard, Chlorethaminacil, Demethyldopan, Desmethyldopan, Haemanthamine, Nordopan, Uracil nitrogen Mustard, Uracillost, Uracilmostaza, Uramustin, Uramustine), chlormethine (Mustargen), cyclophosphamide (Cytoxan, Neosar, Clafen, Endoxan, Procytox, Revimmune), ifosfamide (Mitoxana), melphalan (Alkeran), Chlorambucil (Leukeran), pipobroman (Amedel, Vercyte), triethylenemelamine (Hemel, Hexalen, Hexastat), triethylenethiophosphoramine, Temozolomide (Temodar), thiotepa (Thioplex), busulfan (Busilvex, Myleran), carmustine (BiCNU), lomustine (CeeNU), streptozocin (Zanosar), and Dacarbazine (DTIC-Dome).
[0215] anti-EGFR antibodies (e.g., cetuximab (Erbitux) and panitumumab (Vectibix).
[0216] anti-HER-2 antibodies (e.g., trastuzumab (Herceptin).
[0217] antimetabolites (including, without limitation, folic acid antagonists (also referred to herein as antifolates), pyrimidine analogs, purine analogs and adenosine deaminase inhibitors): methotrexate (Rheumatrex, Trexall), 5-fluorouracil (Adrucil, Efudex, Fluoroplex), floxuridine (FUDF), cytarabine (Cytosar-U, Tarabine PFS), 6-mercaptopurine (Puri-Nethol)), 6-thioguanine (Thioguanine Tabloid), fludarabine phosphate (Fludara), pentostatin (Nipent), pemetrexed (Alimta), raltitrexed (Tomudex), cladribine (Leustatin), clofarabine (Clofarex, Clolar), mercaptopurine (Puri-Nethol), capecitabine (Xeloda), nelarabine (Arranon), azacitidine (Vidaza) and gemcitabine (Gemzar). Suitable antimetabolites include, e.g., 5-fluorouracil (Adrucil, Efudex, Fluoroplex), floxuridine (FUDF), capecitabine (Xeloda), pemetrexed (Alimta), raltitrexed (Tomudex) and gemcitabine (Gemzar).
[0218] vinca alkaloids: vinblastine (Velban, Velsar), vincristine (Vincasar, Oncovin), vindesine (Eldisine), vinorelbine (Navelbine).
[0219] platinum-based agents: carboplatin (Paraplat, Paraplatin), cisplatin (Platinol), oxaliplatin (Eloxatin).
[0220] anthracyclines: daunorubicin (Cerubidine, Rubidomycin), doxorubicin (Adriamycin), epirubicin (Ellence), idarubicin (Idamycin), mitoxantrone (Novantrone), valrubicin (Valstar).
[0221] topoisomerase inhibitors: topotecan (Hycamtin), irinotecan (Camptosar), etoposide (Toposar, VePesid), teniposide (Vumon), lamellarin D, SN-38, camptothecin.
[0222] taxanes: paclitaxel (Taxol), docetaxel (Taxotere), larotaxel, cabazitaxel.
[0223] epothilones: ixabepilone, epothilone B, epothilone D, BMS310705, dehydelone, ZK-Epothilone (ZK-EPO).
[0224] poly ADP-ribose polymerase (PARP) inhibitors: (e.g., BSI 201, Olaparib (AZD-2281), ABT-888, AG014699, CEP 9722, MK 4827, KU-0059436 (AZD2281), LT-673, 3-aminobenzamide).
[0225] antibiotics: actinomycin (Cosmegen), bleomycin (Blenoxane), hydroxyurea (Droxia, Hydrea), mitomycin (Mitozytrex, Mutamycin).
[0226] immunomodulators: lenalidomide (Revlimid), thalidomide (Thalomid).
[0227] immune cell antibodies: alemtuzamab (Campath), gemtuzumab (Myelotarg), rituximab (Rituxan), tositumomab (Bexxar).
[0228] interferons (e.g., IFN-alpha (Alferon, Roferon-A, Intron-A) or IFN-gamma (Actimmune)).
[0229] interleukins: IL-1, IL-2 (Proleukin), IL-24, IL-6 (Sigosix), IL-12.
[0230] HSP90 inhibitors (e.g., geldanamycin or any of its derivatives). In certain embodiments, the HSP90 inhibitor is selected from geldanamycin, 17-alkylamino-17-desmethoxygeldanamycin (17-AAG) or 17-(2-dimethylaminoethyl)amino-17-desmethoxygeldanamycin (17-DMAG).
[0231] angiogenesis inhibitors which include, without limitation A6 (Angstrom Pharmacueticals), ABT-510 (Abbott Laboratories), ABT-627 (Atrasentan) (Abbott Laboratories/Xinlay), ABT-869 (Abbott Laboratories), Actimid (CC4047, Pomalidomide) (Celgene Corporation), AdGVPEDF.11D (GenVec), ADH-1 (Exherin) (Adherex Technologies), AEE788 (Novartis), AG-013736 (Axitinib) (Pfizer), AG3340 (Prinomastat) (Agouron Pharmaceuticals), AGX1053 (AngioGenex), AGX51 (AngioGenex), ALN-VSP (ALN-VSP 02) (Alnylam Pharmaceuticals), AMG 386 (Amgen), AMG706 (Amgen), Apatinib (YN968D1) (Jiangsu Hengrui Medicine), AP23573 (Ridaforolimus/MK8669) (Ariad Pharmaceuticals), AQ4N (Novavea), ARQ 197 (ArQule), ASA404 (Novartis/Antisoma), Atiprimod (Callisto Pharmaceuticals), ATN-161 (Attenuon), AV-412 (Aveo Pharmaceuticals), AV-951 (Aveo Pharmaceuticals), Avastin (Bevacizumab) (Genentech), AZD2171 (Cediranib/Recentin) (AstraZeneca), BAY 57-9352 (Telatinib) (Bayer), BEZ235 (Novartis), BIBF1120 (Boehringer Ingelheim Pharmaceuticals), BIBW 2992 (Boehringer Ingelheim Pharmaceuticals), BMS-275291 (Bristol-Myers Squibb), BMS-582664 (Brivanib) (Bristol-Myers Squibb), BMS-690514 (Bristol-Myers Squibb), Calcitriol, CCI-779 (Torisel) (Wyeth), CDP-791 (ImClone Systems), Ceflatonin (Homoharringtonine/HHT) (ChemGenex Therapeutics), Celebrex (Celecoxib) (Pfizer), CEP-7055 (Cephalon/Sanofi), CHIR-265 (Chiron Corporation), NGR-TNF, COL-3 (Metastat) (Collagenex Pharaceuticals), Combretastatin (Oxigene), CP-751,871 (Figitumumab) (Pfizer), CP-547,632 (Pfizer), CS-7017 (Daiichi Sankyo Pharma), CT-322 (Angiocept) (Adnexus), Curcumin, Dalteparin (Fragmin) (Pfizer), Disulfiram (Antabuse), E7820 (Eisai Limited), E7080 (Eisai Limited), EMD 121974 (Cilengitide) (EMD Pharmaceuticals), ENMD-1198 (EntreMed), ENMD-2076 (EntreMed), Endostar (Simcere), Erbitux (ImClone/Bristol-Myers Squibb), EZN-2208 (Enzon Pharmaceuticals), EZN-2968 (Enzon Pharmaceuticals), GC1008 (Genzyme), Genistein, GSK1363089 (Foretinib) (GlaxoSmithKline), GW786034 (Pazopanib) (GlaxoSmithKline), GT-111 (Vascular Biogenics Ltd.), IMC-1121B (Ramucirumab) (ImClone Systems), IMC-18F1 (ImClone Systems), IMC-3G3 (ImClone LLC), INCB007839 (Incyte Corporation), INGN 241 (Introgen Therapeutics), Iressa (ZD1839/Gefitinib), LBH589 (Faridak/Panobinostst) (Novartis), Lucentis (Ranibizumab) (Genentech/Novartis), LY317615 (Enzastaurin) (Eli Lilly and Company), Macugen (Pegaptanib) (Pfizer), MEDI522 (Abegrin) (Medlmmune), MLN518 (Tandutinib) (Millennium), Neovastat (AE941/Benefin) (Aeterna Zentaris), Nexavar (Bayer/Onyx), NM-3 (Genzyme Corporation), Noscapine (Cougar Biotechnology), NPI-2358 (Nereus Pharmaceuticals), OSI-930 (OSI), Palomid 529 (Paloma Pharmaceuticals, Inc.), Panzem Capsules (2ME2) (EntreMed), Panzem NCD (2ME2) (EntreMed), PF-02341066 (Pfizer), PF-04554878 (Pfizer), PI-88 (Progen Industries/Medigen Biotechnology), PKC412 (Novartis), Polyphenon E (Green Tea Extract) (Polypheno E International, Inc), PPI-2458 (Praecis Pharmaceuticals), PTC299 (PTC Therapeutics), PTK787 (Vatalanib) (Novartis), PXD101 (Belinostat) (CuraGen Corporation), RAD001 (Everolimus) (Novartis), RAF265 (Novartis), Regorafenib (BAY73-4506) (Bayer), Revlimid (Celgene), Retaane (Alcon Research), SN38 (Liposomal) (Neopharm), SNS-032 (BMS-387032) (Sunesis), SOM230 (Pasireotide) (Novartis), Squalamine (Genaera), Suramin, Sutent (Pfizer), Tarceva (Genentech), TB-403 (Thrombogenics), Tempostatin (Collard Biopharmaceuticals), Tetrathiomolybdate (Sigma-Aldrich), TG100801 (TargeGen), Thalidomide (Celgene Corporation), Tinzaparin Sodium, TKI258 (Novartis), TRC093 (Tracon Pharmaceuticals Inc.), VEGF Trap (Aflibercept) (Regeneron Pharmaceuticals), VEGF Trap-Eye (Regeneron Pharmaceuticals), Veglin (VasGene Therapeutics), Bortezomib (Millennium), XL184 (Exelixis), XL647 (Exelixis), XL784 (Exelixis), XL820 (Exelixis), XL999 (Exelixis), ZD6474 (AstraZeneca), Vorinostat (Merck), and ZSTK474.
[0232] anti-androgens which include, without limitation nilutamide (Nilandron) and bicalutamide (Caxodex).
[0233] antiestrogens which include, without limitation tamoxifen (Nolvadex), toremifene (Fareston), letrozole (Femara), testolactone (Teslac), anastrozole (Arimidex), bicalutamide (Casodex), exemestane (Aromasin), flutamide (Eulexin), fulvestrant (Faslodex), raloxifene (Evista, Keoxifene) and raloxifene hydrochloride.
[0234] anti-hypercalcaemia agents which include without limitation gallium (III) nitrate hydrate (Ganite) and pamidronate disodium (Aredia).
[0235] apoptosis inducers which include without limitation ethanol, 2-[[3-(2,3-dichlorophenoxy)propyl]amino]-(9Cl), gambogic acid, embelin and arsenic trioxide (Trisenox).
[0236] Aurora kinase inhibitors which include without limitation binucleine 2.
[0237] Bruton's tyrosine kinase inhibitors which include without limitation terreic acid.
[0238] calcineurin inhibitors which include without limitation cypermethrin, deltamethrin, fenvalerate and tyrphostin 8.
[0239] CaM kinase II inhibitors which include without limitation 5-Isoquinolinesulfonic acid, 4-[(2S)-2-[(5-isoquinolinylsulfonyl)methylamino]-3-oxo-3-14-phenyl-1-piperazinyl)propyl]phenyl ester and benzenesulfonamide.
[0240] CD45 tyrosine phosphatase inhibitors which include without limitation phosphonic acid.
[0241] CDC25 phosphatase inhibitors which include without limitation 1,4-naphthalene dione, 2,3-bis[(2-hydroxyethyl)thio]-(9Cl).
[0242] CHK kinase inhibitors which include without limitation debromohymenialdisine.
[0243] cyclooxygenase inhibitors which include without limitation 1H-indole-3-acetamide, 1-(4-chlorobenzoyl)-5-methoxy-2-methyl-N-(2-phenylethyl)-(9Cl), 5-alkyl substituted 2-arylaminophenylacetic acid and its derivatives (e.g., celecoxib (Celebrex), rofecoxib (Vioxx), etoricoxib (Arcoxia), lumiracoxib (Prexige), valdecoxib (Bextra) or 5-alkyl-2-arylaminophenylacetic acid).
[0244] cRAF kinase inhibitors which include without limitation 3-(3,5-dibromo-4-hydroxybenzylidene)-5-iodo-1,3-dihydroindol-2-one and benzamide, 3-(dimethylamino)-N-[3-[(4-hydroxybenzoyl)amino]-4-methylphenyl]-(9Cl).
[0245] cyclin dependent kinase inhibitors which include without limitation olomoucine and its derivatives, purvalanol B, roascovitine (Seliciclib), indirubin, kenpaullone, purvalanol A and indirubin-3-monooxime.
[0246] cysteine protease inhibitors which include without limitation 4-morpholinecarboxamide, N-[(1S)-3-fluoro-2-oxo-1-(2-phenylethyl)propyl]amino]-2-oxo-1-(phenylmethyl)ethyl]-(9Cl).
[0247] DNA intercalators which include without limitation plicamycin (Mithracin) and daptomycin (Cubicin).
[0248] DNA strand breakers which include without limitation bleomycin (Blenoxane).
[0249] E3 ligase inhibitors which include without limitation N-((3,3,3-trifluoro-2-trifluoromethyl)propionyl) sulfanilamide.
[0250] EGF Pathway Inhibitors which include, without limitation tyrphostin 46, EKB-569, erlotinib (Tarceva), gefitinib (Iressa), lapatinib (Tykerb) and those compounds that are generically and specifically disclosed in WO 97/02266, EP 0 564 409, WO 99/03854, EP 0 520 722, EP 0 566 226, EP 0 787 722, EP 0 837 063, U.S. Pat. No. 5,747,498, WO 98/10767, WO 97/30034, WO 97/49688, WO 97/38983 and WO 96/33980.
[0251] farnesyltransferase inhibitors which include without limitation A-hydroxyfarnesylphosphonic acid, butanoic acid, 2-[(2S)-2-[[(2S,3S)-2-[[(2R)-2-amino-3-mercaptopropyl]amino]-3-methylpentyl]oxy]-1-oxo-3-phenylpropyl]amino]-4-(methylsulfonyl)-1-methylethylester (2S)-(9Cl), and manumycin A.
[0252] Flk-1 kinase inhibitors which include without limitation 2-propenamide, 2-cyano-3-[4-hydroxy-3,5-bis(1-methylethyl)phenyl]-N-(3-phenylpropyl)-(2E)-(9Cl).
[0253] glycogen synthase kinase-3 (GSK3) inhibitors which include without limitation indirubin-3-monooxime.
[0254] Heat Shock Protein 90 (Hsp90) chaperone modulators which include without limitation AUY922, STA-9090, ATI13387, MCP-3100, IPI-504, IPI-493, SNX-5422, Debio0932, HSP990, DS-2248, PU-H71, 17-DMAG (Alvespimycin), and XL888.
[0255] histone deacetylase (HDAC) inhibitors which include without limitation suberoylanilide hydroxamic acid (SAHA), [4-(2-amino-phenylcarbamoyl)-benzyl]-carbamic acid pyridine-3-ylmethylester and its derivatives, butyric acid, pyroxamide, trichostatin A, oxamflatin, apicidin, depsipeptide, depudecin, trapoxin and compounds disclosed in WO 02/22577.
[0256] I-kappa B-alpha kinase inhibitors (IKK) which include without limitation 2-propenenitrile, 3-[(4-methylphenyl)sulfonyl]-(2E)-(9Cl).
[0257] imidazotetrazinones which include without limitation temozolomide (Methazolastone, Temodar and its derivatives (e.g., as disclosed generically and specifically in U.S. Pat. No. 5,260,291) and Mitozolomide.
[0258] Insulin like growth factor pathway inhibitors such as IGF inhibitors or IGF receptor (IGFR1 or IGFR2) inhibitors include without limitation, small molecule inhibitors, e.g., OSI-906; anti-IGF antibodies or anti-IGFR antibodies, e.g., AVE-1642, MK-0646, IMC-A12 (cixutumab), R1507, CP-751,871 (Figitumumab).
[0259] insulin tyrosine kinase inhibitors which include without limitation hydroxyl-2-naphthalenylmethylphosphonic acid.
[0260] c-Jun-N-terminal kinase (JNK) inhibitors which include without limitation pyrazoleanthrone and epigallocatechin gallate.
[0261] mitogen-activated protein kinase (MAP) inhibitors which include without limitation benzenesulfonamide, N-[2-[[[3-(4-chlorophenyl)-2-propenyl]methyl]amino]methyl]phenyl]-N-(2-hydroxyethyl)-4-methoxy-(9Cl).
[0262] MDM2 inhibitors which include without limitation trans-4-iodo, 4-boranyl-chalcone.
[0263] MEK inhibitors which include without limitation butanedinitrile, bis[amino[2-aminophenyl)thio]methylene]-(9Cl).
[0264] MMP inhibitors which include without limitation Actinonin, epigallocatechin gallate, collagen peptidomimetic and non-peptidomimetic inhibitors, tetracycline derivatives marimastat (Marimastat), prinomastat, incyclinide (Metastat), shark cartilage extract AE-941 (Neovastat), Tanomastat, TAA211, MMI270B or AAJ996.
[0265] mTor inhibitors which include without limitation rapamycin (Rapamune), and analogs and derivatives thereof, AP23573 (also known as ridaforolimus, deforolimus, or MK-8669), CCI-779 (also known as temsirolimus) (Torisel) and SDZ-RAD.
[0266] NGFR tyrosine kinase inhibitors which include without limitation tyrphostin AG 879.
[0267] p38 MAP kinase inhibitors which include without limitation Phenol, 4-[4-(4-fluorophenyl)-5-(4-pyridinyl)-1H-imidazol-2-yl]-(9Cl), and benzamide, 3-(dimethylamino)-N-[3-[(4-hydroxylbenzoyl)amino]-4-methylphenyl]-(9Cl).
[0268] p56 tyrosine kinase inhibitors which include without limitation damnacanthal and tyrphostin 46.
[0269] PDGF pathway inhibitors which include without limitation tyrphostin AG 1296, tyrphostin 9, 1,3-butadiene-1,1,3-tricarbonitrile, 2-amino-4-(1H-indol-5-yl)-(9Cl), imatinib (Gleevec) and gefitinib (Iressa) and those compounds generically and specifically disclosed in European Patent No.: 0 564 409 and PCT Publication No.: WO 99/03854.
[0270] phosphatidylinositol 3-kinase inhibitors which include without limitation wortmannin, and quercetin dihydrate.
[0271] phosphatase inhibitors which include without limitation cantharidic acid, cantharidin, and L-leucinamide.
[0272] PKC inhibitors which include without limitation 1-H-pyrollo-2,5-dione,3-[1-[3-(dimethylamino)propyl]-1H-indol-3-yl]-4-(1H-indol-3-yl)-(9Cl), Bisindolylmaleimide IX, Sphinogosine, staurosporine, and Hypericin.
[0273] PKC delta kinase inhibitors which include without limitation, rottlerin.
[0274] polyamine synthesis inhibitors which include without limitation, DMFO.
[0275] proteasome inhibitors which include, without limitation, aclacinomycin A, gliotoxin and bortezomib (Velcade).
[0276] protein phosphatase inhibitors which include without limitation cantharidic acid, cantharidin, L-P-bromotetramisole oxalate, 2 (5H)-furanone, 4-hydroxy-5-(hydroxymethyl)-3-(1-oxohexadecyl)-(5R)-(9Cl) and benzylphosphonic acid.
[0277] protein tyrosine kinase inhibitors which include, without limitation tyrphostin Ag 216, tyrphostin Ag 1288, tyrphostin Ag 1295, geldanamycin, genistein and 7H-pyrollo[2,3-d]pyrimidine derivatives;
[0278] PTP1B inhibitors which include without limitation L-leucinamide.
[0279] SRC family tyrosine kinase inhibitors which include without limitation PP1 and PP2.
[0280] Syk tyrosine kinase inhibitors which include without limitation piceatannol.
[0281] Janus (JAK-2 and/or JAK-3) tyrosine kinase inhibitors which include without limitation tyrphostin AG 490 and 2-naphthyl vinyl ketone.
[0282] retinoids which include without limitation isotretinoin (Accutane, Amnesteem, Cistane, Claravis, Sotret) and tretinoin (Aberel, Aknoten, Avita, Renova, Retin-A, Retin-A MICRO, Vesanoid).
[0283] RNA polymerase II elongation inhibitors which include without limitation 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole.
[0284] serine/threonine kinase inhibitors which include without limitation 2-aminopurine.
[0285] sterol biosynthesis inhibitors which include without limitation squalene epoxidase and CYP2D6.
[0286] VEGF pathway inhibitors which include without limitation anti-VEGF antibodies, e.g., bevacizumab, and small molecules, e.g., sunitinib (Sutent), sorafinib (Nexavar), ZD6474 (also known as vandetanib) (Zactima), SU6668, CP-547632, AV-951 (tivozanib) and AZD2171 (also known as cediranib) (Recentin).
[0287] For example, one or more chemotherapeutic agents can be selected from the group consisting of cisplatin, carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, adriamycin, ifosfamide, melphalan, chlorambucil, bisulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide, verampil, podophyllotoxin, tamoxifen, taxol, thalidomide, lenalidomide, a proteosome inhibitor (e.g., bortezomib), an hsp90 inhibitor (e.g., tenespinmycin), transplatinum, 5-flurouracil, vincristin, vinblastin, methotrexate, or an analog of any of the aforementioned. Immunomodulatory agents include, e.g., a variety of chemokines and cytokines such as Interleukin 2 (IL-2), granulocyte/macrophage-colony stimulating factor (GM-CSF), and Interleukin 12 (IL-12).
[0288] In one embodiment, the additional therapy is one or more additional immunogenic peptide, e.g., one or more immunogenic peptide from WT1 or a derivative thereof. Exemplary WT1 immunogenic peptides include, but are not limited to, a WT1 class 1 epitope; a peptide comprising (or consisting of) RMFPNAPYL (WT1 126-134); a peptide comprising (or consisting of) YMFPNAPYL; a peptide comprising (or consisting of) RSDELVRHHNMHQRNMTKL (WT1 427-445); a peptide comprising (or consisting of) PGCNKRYFKLSHLQMHSRKHTG (WT1 331-352); a peptide comprising (or consisting of) SGQARMFPNAPYLPSCLES (WT1 122-140); and a peptide comprising (or consisting of) SGQAYMFPNAPYLPSCLES. Other WT1 immunogenic peptides are described in U.S. Pat. No. 7,598,221, the contents of which is incorporated herein by reference. Other immunogenic peptides include, but are not limited to, an immunogenic peptide from MUC1, an immunogenic peptide from gp100, an immunogenic peptide from TRP-2, an immunogenic peptide from MAGI, an immunogenic peptide from NY-ESO1, an immunogenic peptide from HER-2; and an immunogenic peptide from AIM2.
[0289] The subject can have, be suspected of having, or be at risk of developing a cancer such as breast cancer, e.g., triple negative breast cancer, e.g., metastatic triple negative breast cancer. A subject suspected of having a cancer is one having one or more symptoms of a cancer or having one or more lab test result, e.g., blood test result, suggestive of cancer. Symptoms of cancer are well-known to those of skill in the art and generally include, without limitation, pain, weight loss, weakness, excessive fatigue, difficulty eating, loss of appetite, chronic cough, worsening breathlessness, coughing up blood, blood in the urine, blood in stool, nausea, vomiting, abdominal fullness, bloating, fluid in peritoneal cavity, vaginal bleeding, constipation, abdominal distension, perforation of colon, acute peritonitis (infection, fever, pain), pain, vomiting blood, heavy sweating, fever, high blood pressure, anemia, diarrhea, jaundice, dizziness, chills, muscle spasms, difficulty swallowing, and the like.
[0290] As used herein, a subject at risk of developing a cancer is a subject that has a predisposition to develop a cancer, i.e., a genetic predisposition to develop cancer such as a mutation in a tumor suppressor gene (e.g., mutation in BRCA1, p53, RB, or APC), has been exposed to conditions, or is presently affected by conditions, that can result in cancer. Thus, a subject can also be one at risk of developing a cancer when the subject has been exposed to mutagenic or carcinogenic levels of certain compounds (e.g., carcinogenic compounds in cigarette smoke such as acrolein, 4-aminobiphenyl, aromatic amines, benzene, benz{a}anthracene, benzo{a}pyrene, formaldehyde, hydrazine, Polonium-210 (Radon), urethane, or vinyl chloride). The subject can be at risk of developing a cancer when the subject has been exposed to, e.g., large doses of ultraviolet light or X-irradiation, or exposed (e.g., infected) to a tumor-causing/associated virus such as papillomavirus, Epstein-Barr virus, hepatitis B virus, or human T-cell leukemia-lymphoma virus. In addition, a subject can be at risk of developing a cancer when the subject suffers from an inflammation (e.g., chronic inflammation).
[0291] Triple negative breast cancer refers to a breast cancer that is negative for estrogen receptor (ER), progesterone receptor (PR), and HER2. Presence or absence of ER, PR, and HER2 can be assessed, e.g., by immunohistochemistry or quantitative PCR on a biopsy sample. This type of cancer is often treated with a combination of surgery and chemotherapy.
[0292] In some embodiments, the patient is human leukocyte antigen (HLA)-A2 positive.
[0293] In some embodiments, the patient has an Eastern Cooperative Oncology Group (ECOG) performance status of 0 or 1; has adequate bone marrow function, evidenced by a platelet count 75109/L and an absolute neutrophil count (ANC) 1.0109/L; and/or has adequate hepatic function, evidenced by a bilirubin 2.0 mg/dL and an alanine transaminase (ALT), and aspartate transaminase (AST)2.5 the upper limit of normal (ULN).
[0294] In embodiments, (i) pembrolizumab and (ii) the one or more peptides are administered in an amount sufficient to increase progression free survival (PFS) relative to the expected course of disease without treatment, or compared to the expected course of disease upon treatment with (i) only or with (ii) only, or compared to the expected course of disease with standard of care treatment. In embodiments, (i) and (ii) are administered in an amount sufficient to increase overall survival (OS) relative to the expected course of disease without treatment, or compared to the expected course of disease upon treatment with (i) only or with (ii) only, or compared to the expected course of disease with standard of care treatment. In embodiments, (i) pembrolizumab and (ii) the one or more peptides are administered in an amount sufficient to give as good a clinical response (e.g., measured by PFS or OS) as a monotherapy with pembrolizumab, e.g., as good a clinical response with fewer adverse effects. PFS and OS can be determined according to the Response Evaluation Criteria in Solid Tumors (RECIST) guideline (version 1.1). In embodiments, (i) and (ii) are administered in an amount sufficient to induce an immune response to one or more of the peptides administered, e.g., a greater immune response than would have been observed without treatment or upon treatment with (i) only or (ii) only, or compared to the expected course of disease with standard of care treatment. Immune response can be measured, e.g., by an ELISPOT assay or as described in International Application WO2014/071402, which application is herein incorporated by reference in its entirety.
[0295] In some embodiments, the method can also include determining if an immune response occurred in a subject after administering a combination therapy described herein to the subject. Suitable methods for determining whether an immune response occurred in a subject include use of immunoassays to detect, e.g., the presence of antibodies specific for a peptide in a biological sample from the subject. For example, after the administration of the peptide or composition to the subject, a biological sample (e.g., a blood sample) can be obtained from the subject and tested for the presence of antibodies specific for the peptide(s). An immune response can also be detected by assaying for the presence or amount of activated T cells in a sample. Such assays include, e.g., proliferation assays, limiting dilution assays, cytotoxicity assays (e.g., lymphokine or .sup.51Cr-release assays), or flow cytometry assays.
[0296] In some embodiments, the methods can also include the step of determining whether a subject has a cancer. Suitable methods for such a determination depend on the type of cancer to be detected in the subject, but are known in the art. Such methods can be qualitative or quantitative. Methods for diagnosing breast cancer include mammogram, ultrasounds, MRI, biopsy, and molecular tests. Methods for diagnosing triple negative breast cancer include immunohistochemistry for PR, ER, and HER2.
[0297] Methods for Selecting a Therapy
[0298] Methods for selecting a therapy for a subject with a cancer, e.g., a breast cancer or any cancer in which XBP1, CD138, or CS1 are expressed include the steps of: optionally, determining whether one or more cells (e.g., breast cancer cells) of a subject's cancer express XBP1; and if one or more cells express XBP1, selecting as a therapy for the subject: (i) pembrolizumab, and (ii) a peptide or composition described herein e.g., a XBP1 peptide or composition comprising a XBP1 peptide described herein.
[0299] Methods for selecting a therapy for a subject with a cancer, e.g., a breast cancer can include the steps of: optionally, determining whether one or more cells (e.g., breast cancer cells) of a subject's cancer express CD138; and if one or more cells express CD138, selecting as a therapy for the subject: (i) pembrolizumab, and (ii) a peptide or composition described herein e.g., a CD138 peptide or composition comprising a CD138 peptide described herein.
[0300] Methods for selecting a therapy for a subject with a cancer, e.g., a breast cancer can include the steps of: optionally, determining whether one or more cells (e.g., breast cancer cells) of a subject's cancer express CS-1; and if one or more cells express CS-1, selecting as a therapy for the subject: (i) pembrolizumab, and (ii) a peptide or composition described herein, e.g., a CS-1 peptide or composition comprising a CS-1 peptide described herein.
[0301] It is understood that where one or more cells (e.g., breast cancer cells) of a subject's cancer express two or more of XBP1, CD138, and CS-1, a combination of suitable peptides can be delivered to the subject, e.g., via a composition described herein, in further combination with pembrolizumab. Methods for determining whether one or more cells express XBP1, CD138, or CS-1 are described, e.g., in the section on p. 104-107 entitled Methods for Selecting a Therapy of International Application WO2014/071402, which application is herein incorporated by reference in its entirety.
[0302] Kits and Articles of Manufacture
[0303] The disclosure also features a variety of kits. The kits can include, e.g., (i) pembrolizumab, (ii) one or more (e.g., one, two, three, four, five, six, seven, eight, nine, or 10 or more) of any of the peptides or compositions (or expression vectors containing nucleic acid sequences encoding one or more peptides) described herein, and (iii) instructions for administering the peptide or composition to a subject. In embodiments, (ii) comprises one or more of, e.g., all of, (a) a non-spliced XBP1 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:1, (b) a spliced XBP1 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:2, or (c) a CD138 peptide that is 35 amino acids or less in length and comprises the amino acid sequence of SEQ ID NO:3. In embodiments (ii) comprises one or more of, e.g., all of, (a) a non-spliced XBP1 peptide that consists of the amino acid sequence of SEQ ID NO:1, (b) a spliced XBP1 peptide that consists of the amino acid sequence of SEQ ID NO:2, or (c) a CD138 peptide that consists of the amino acid sequence of SEQ ID NO:3. The kit can include one or more pharmaceutically acceptable carriers and/or one or more immune stimulating agents and/or one or more immune modulating agents. The immune stimulating agents can be, e.g., a T helper epitope, an altered peptide ligand, or an adjuvant. In one embodiment, the immune stimulating agent can be a combination of carboxymethylcellulose, polyinosinic-polycytidylic acid, and poly-L-lysine double-stranded RNA (e.g., poly IC-LC, e.g., hiltonol); a water-and-oil emulsion (e.g., montanide); or a protein (e.g., a cytokine, a complement, GCSF, or GM-CSF). In one embodiment, the additional agent can be a protein, e.g., an antibody. In one embodiment, the additional agent is an immune checkpoint inhibitor. For example, an antibody which inhibits an immune checkpoint molecule can be an anti-CTLA4 antibody, e.g., ipilimumab or tremelimumab, or an anti-PD-1 antibody, or anti-PDL-1 antibody. In one embodiment, the additional agent can be a small molecule adjuvant, e.g., thalidomide or a thalidomide derivative, e.g., lenalidomide.
[0304] The kits can also contain one or more therapeutic agents, diagnostic agents, or prophylactic agents. The one or more therapeutic, diagnostic, or prophylactic agents include, but are not limited to: (i) an agent that modulates inflammatory responses (e.g., aspirin, indomethacin, ibuprofen, naproxen, steroids, cromolyn sodium, or theophylline); (ii) an agent that affects renal and/or cardiovascular function (e.g., furosemide, thiazide, amiloride, spironolactone, captopril, enalapril, lisinopril, diltiazem, nifedipine, verapamil, digoxin, isordil, dobutamine, lidocaine, quinidine, adenosine, digitalis, mevastatin, lovastatin, simvastatin, or mevalonate); (iii) drugs that affect gastrointestinal function (e.g., omeprazole or sucralfate); (iv) antibiotics (e.g., tetracycline, clindamycin, amphotericin B, quinine, methicillin, vancomycin, penicillin G, amoxicillin, gentamicin, erythromycin, ciprofloxacin, doxycycline, streptomycin, gentamicin, tobramycin, chloramphenicol, isoniazid, fluconazole, or amantadine); (v) anti-cancer agents (e.g., cyclophosphamide, methotrexate, fluorouracil, cytarabine, mercaptopurine, vinblastine, vincristine, doxorubicin, bleomycin, mitomycin C, hydroxyurea, prednisone, tamoxifen, cisplatin, or decarbazine); (vi) immunomodulatory agents (e.g., interleukins, interferons (e.g., interferon gamma (IFN-), granulocyte macrophage-colony stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF), tumor necrosis factor beta (TNF), cyclosporine, FK506, azathioprine, steroids); (ix) drugs acting on the blood and/or the blood-forming organs (e.g., interleukins, G-CSF, GM-CSF, erythropoietin, heparin, warfarin, or coumarin); or (vii) hormones (e.g., growth hormone (GH), prolactin, luteinizing hormone, TSH, ACTH, insulin, FSH, CG, somatostatin, estrogens, androgens, progesterone, gonadotropin-releasing hormone (GnRH), thyroxine, triiodothyronine); hormone antagonists; agents affecting calcification and bone turnover (e.g., calcium, phosphate, parathyroid hormone (PTH), vitamin D, bisphosphonates, calcitonin, fluoride).
OTHER EMBODIMENTS
[0305] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.