1-tetrahydropyranylcarbonyl-2,3-dihydro-1H-indole compounds for treating cancer
10759786 ยท 2020-09-01
Assignee
Inventors
- Jolie Anne Bastian (Indianapolis, IN)
- Jiehao Chen (Carmel, IN, US)
- Jeffrey Daniel Cohen (Indianapolis, IN)
- James Robert Henry (Indianapolis, IN)
- William Thomas McMillen (Indianapolis, IN)
- Bradley Earl Reaman (Indianapolis, IN, US)
- Almudena Rubio (Carmel, IN)
- Daniel Jon Sall (Greenwood, IN)
- Gaiying Zhao (Carmel, IN)
Cpc classification
C07D309/00
CHEMISTRY; METALLURGY
C07C233/57
CHEMISTRY; METALLURGY
A61K31/403
HUMAN NECESSITIES
C07D405/06
CHEMISTRY; METALLURGY
International classification
C07D405/06
CHEMISTRY; METALLURGY
C07C233/57
CHEMISTRY; METALLURGY
A61K31/403
HUMAN NECESSITIES
Abstract
The present invention relates to certain novel 2,3-dihydro-1H-indole compounds, pharmaceutical compositions comprising the compounds, and methods of using the compounds to treat cancer, more particularly for the treatment of cancer selected from the group consisting of melanoma, acute myeloid leukemia, chronic lymphocytic leukemia, colorectal cancer, breast cancer, lung cancer, ovarian cancer, fallopian tube carcinoma, primary peritoneal carcinoma, cervical cancer, gastric cancer, liver cancer, pancreatic cancer, thyroid cancer, glioblastoma, non-Hodgkin's lymphoma, and Hodgkin's lymphoma. ##STR00001##
Claims
1. A method of treating a patient for cancer comprising administering a combination comprising 4-fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide and LY3300054 and wherein the cancer is non-small cell lung cancer or colon cancer.
2. The method of claim 1 wherein the cancer is non-small cell lung cancer.
3. The method of claim 1 wherein the cancer is colon cancer.
4. The method of claim 1, wherein 4-fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide and LY3300054 are administered simultaneously, separately, or sequentially.
5. The method of claim 1 wherein the 4-fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide is in crystalline form characterized by an X-ray powder diffraction pattern (Cu radiation, -1.54060 ) comprising at least one peak at 17.38 in combination with one or more peaks selected from the group consisting of 12.51, 15.65, 16.37, 17.56, 21.48 and 25.23 (200.2).
Description
Example 1
Racemic 4-fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide
(1) ##STR00020##
(2) Combine racemic [5-(1-aminoethyl)-2,3-dihydro-1H-indol-1-yl](tetrahydro-2H-pyran-4-yl)methanone (Preparation 3) (420 mg, 1.53 mmol) and 4-fluorobenzoic acid (257 mg. 1.84 mmol) in DCM (15 mL). To the stirring solution add N,N-diisopropylethylamine (534 L, 3.06 mmol) and 1-[bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium-3-oxide hexafluorophosphate (890 mg, 2.30 mmol). Stir the resulting mixture at room temperature for 16 hours. Evaporate the solvent and purify by reverse phase column chromatography (Redisep Rf Gold High Performance C18 Reverse Phase Column, 25-100% ACN in 10 mM aqueous ammonium bicarbonate) to give the title compound (372 mg, 61%). ES/MS (m/z): 397.2 (M+H). .sup.1H NMR (d.sub.6-DMSO) 8.73 (d, J=8 Hz, 1H), 7.98 (d, J=8 Hz, 1H), 7.93-7.89 (m, 2H), 7.28-7.23 (m, 2H), 7.22 (s, 1H), 7.12 (d, J=8 Hz, 1H), 5.07 (quin, J=8 Hz, 1H), 4.14 (t, J=8 Hz, 2H), 3.85 (m, 2H), 3.36 (m, 2H), 3.09 (t, J=8 Hz, 2H), 2.80 (m, 1H), 1.57-1.66 (m, 4H), 1.41 (d, J=7 Hz, 3H).
Example 1A
4-Fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide
(3) Synthetic Method 1:
(4) ##STR00021##
(5) Purify racemic 4-fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide (Example 1) by chiral SFC to afford the first eluting enantiomer as the title compound. ES/MS (m/z): 397.0 (M+H). Purification conditions: CHIRALPAK AD-H, 21150 mm; Mobile phase: 40% MeOH in CO.sub.2; Column temperature: 40 C.; Flow rate: 70 g/minute; UVW: 225 nm. Confirm enantiomeric enrichment of Isomer 1 by chiral analytical SFC (>99% ee, R.sub.t: 1.72 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm). .sup.1H NMR (d.sub.6-DMSO) 8.73 (d, J=8 Hz, 1H), 7.98 (d, J=8 Hz, 1H), 7.93-7.89 (m, 2H), 7.28-7.23 (m, 2H), 7.22 (s, 1H), 7.12 (d, J=8 Hz, 1H), 5.07 (quin, J=8 Hz, 1H), 4.14 (t, J=8 Hz, 2H), 3.85 (m, 2H), 3.36 (m, 2H), 3.09 (t, J=8 Hz, 2H), 2.80 (m, 1H), 1.57-1.66 (m, 4H), 1.41 (d, J=7 Hz, 3H).
(6) Synthetic Method 2:
(7) Add TEA (9.8 mL, 70.3 mmol) and then 4-fluorobenzoyl chloride (5.85 g, 36.9 mmol) to a solution of [5-(1-aminoethyl)-2,3-dihydro-1H-indol-1-yl](tetrahydro-2H-pyran-4-yl)methanone, Isomer 1 (Preparation 4A) (9.65 g, 35.2 mmol) in DCM (176 mL) at 0 C. Allow the resulting mixture to warm to room temperature and stir overnight. Dilute the reaction mixture with EtOAc (300 mL), filter through a silica gel pad and wash with EtOAc. Concentrate the filtrate and purify by silica gel column chromatography with a gradient from 25-30% ACN in DCM to give the title compound (9.4 g, 67.1%) as an off-white solid. MS (m/z): 397.2 (M+H). Confirm enantiomeric enrichment by chiral analytical SFC (>99% ee, R.sub.t: 1.74 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm). .sup.1H NMR (d.sub.6-DMSO) 8.73 (d, J=8 Hz, 1H), 7.98 (d, J=8 Hz, 1H), 7.93-7.89 (m, 2H), 7.28-7.23 (m, 2H), 7.22 (s, 1H), 7.12 (d, J=8 Hz, 1H), 5.07 (quin, J=8 Hz, 1H), 4.14 (t, J=8 Hz, 2H), 3.85 (m, 2H), 3.36 (m, 2H), 3.09 (t, J=8 Hz, 2H), 2.80 (m, 1H), 1.57-1.66 (m, 4H), 1.41 (d, J=7 Hz, 3H).
(8) Synthetic Method 3:
(9) Add TEA (65 mL, 468 mmol) to a mixture of [5-(1-aminoethyl)-2,3-dihydro-1H-indol-1-yl](tetrahydro-2H-pyran-4-yl)methanone hydrochloride, Isomer 1 (Preparation 7B) (70 g, 225 mmol) in DCM (700 mL) at 0-5 C. Add 4-fluorobenzoyl chloride (37.85 g, 239 mmol) dropwise. Warm the mixture to room temperature and stir for two hours.
(10) Add water dropwise at a rate to keep the temperature below 30 C. and stir the mixture at 20-30 C. for one hour. Separate the layers and wash the organic layer with 18% aqueous H.sub.2SO.sub.4. Separate the layers and wash the organic layer with 7% aqueous NaHCO.sub.3. Separate the layers and wash the organic layer with water. Separate the layers and then pass the organic solution through a carbon filter. Treat the solution with SI-Thiol (7 g) and heat the mixture to 40 C. Stir the resulting mixture for 12 hours. Cool the mixture to room temperature and filter the mixture through diatomateous earth. Concentrate the organic layer to 200 mL (3 vols). Add acetone (140 mL, 2 vols) and concentrate the resulting mixture to 200 mL (3 vols). Treat with additional acetone (280 mL, 4 vols) and water (280 mL, 4 vols). Heat at 65 C. for two hours until reaction is a clear solution. Cool slowly to 30 C. over three hours. Stir at 30 C. for one hour. Add water (140 mL, 2 vols) dropwise and continue stirring at 30 C. for one hour. Cool slowly to 3-8 C. over approximately two hours. Stir at this temperature for six hours. Filter and rinse the solids with water (140 mL, 2 vols). Dry the solids at 55 C. for four to six hours. Obtain the desired product as a white solid (55 g, 61.6%).
X-Ray Powder Diffraction Collection Procedure for Example 1A
(11) The XRD patterns of crystalline solids are obtained on a Bruker D4 Endeavor X-ray powder diffractometer, equipped with a CuKa source (=1.54060 ) and a Vantec detector, operating at 35 kV and 50 mA. The sample is scanned between 4 and 40 in 2, with a step size of 0.0087 in 2 and a scan rate of 0.5 seconds/step, and with 0.6 mm divergence, 5.28 mm fixed anti-scatter, and 9.5 mm detector slits. The dry powder is packed on a quartz sample holder and a smooth surface is obtained using a glass slide. Collect the crystal form diffraction patterns at ambient temperature and relative humidity.
X-Ray Powder Diffraction Collection Procedure for 1A Method 3
(12) A prepared sample of Example 1A (Synthetic method 3) is characterized by an XRD pattern using CuKa radiation as having diffraction peaks (2-theta values) as described in Table 1 below. Specifically the pattern contains a peak at 17.38 in combination with one or more of the peaks selected from the group consisting of 12.51, 15.65, 16.37, 17.56, 21.48 and 25.23 with a tolerance for the diffraction angles of 0.2 degrees (20.2).
(13) TABLE-US-00006 TABLE 1 X-ray powder diffraction peaks of Example 1A method 3 Peak Angle (2-Theta ) Intensity (%) 1 9.99 13 2 12.51 73 3 15.65 90 4 16.37 57 5 17.38 100 6 17.56 62 7 18.79 25 8 19.81 38 9 21.48 56 10 23.38 43 11 24.41 21 12 24.70 17 13 25.23 64 14 25.46 28 15 27.69 15
Determination of Absolute Configuration for Example 1A
(14) Prepare a single crystal of 4-fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide by suspending 10 mg of 4-fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide in 1:1 EtOH/heptane (1.75 mL) and slurrying on an orbital shaker for three days. Use a colorless bladed-like specimen of 4-fluoro-N-{(1R)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, approximate dimensions 0.020 mm0.080 mm0.300 mm, for the X-ray crystallographic analysis. Measure the X-ray intensity data using an I CuK radiation source (=1.54178 ) and a Bruker D8 Venture based 3-circle goniometer diffractometer equipped with Photon 100 SL area detector. Collect a total of 8840 frames. Integrate the frames with the Bruker SAINT software package using a narrow-frame algorithm. The integration of the data using a monoclinic unit cell yielded a total of 7242 reflections to a maximum 0 angle of 68.28 (0.83 resolution), of which 3059 are independent (average redundancy 2.367, completeness=95.9%, Rint=5.83%, Rsig=6.58%) and 2893 (94.57%) is greater than 2(F.sup.2). The final cell constants of a=5.5831(13) , b=5.1082(9) , c=35.013(6) , =90.578(17), volume=998.5(3) .sup.3, are based upon the refinement of the XYZ-centroids of 6280 reflections above 20 (I) with 10.09<2<136.8. Correct the data for absorption effects using the multi-scan method (SADABS). The ratio of minimum to maximum apparent transmission is 0.784. The calculated minimum and maximum transmission coefficients (based on crystal size) are 0.8020 and 0.9850. Solve the structure and refine using the Bruker SHELXTL Software Package, using the space group P 2.sub.1, with Z=2 for the formula unit, C.sub.23H.sub.2FN.sub.2O.sub.3. The final anisotropic full-matrix least-squares refinement on F2 with 264 variables converge at R1=9.17%, for the observed data and wR2=23.48% for all data. The goodness-of-fit is 1.141. The largest peak in the final difference electron density synthesis is 0.506 e/.sup.3 and the largest hole is 0.358 e/.sup.3 with an RMS deviation of 0.088 e/.sup.3. On the basis of the final model, the calculated density is 1.319 g/cm.sup.3 and F(000), 420 e. The absolute structure parameter refines to 0.12(16), verifying the stereochemistry of the chiral center. The absolute structure is determined to be the R-configuration at the stereocenter.
Example 1B
4-Fluoro-N-{(1S)-1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer 2
(15) ##STR00022##
(16) Purify racemic 4-fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide (Example 1) by chiral chromatography to afford the second eluting enantiomer as the title compound. ES/MS (m/z): 397.0 (M+H). Purification conditions: Column: CHIRALPAK AD-H, 21150 mm; Mobile phase: 40% MeOH in CO.sub.2; Column temperature: 40 C.; Flow rate: 70 g/minute; UVW: 225 nm. Confirm enantiomeric enrichment of Isomer 2 by chiral analytical SFC (98.3% ee, R.sub.t: 2.37 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm). .sup.1H NMR (d.sub.6-DMSO) 8.73 (d, J=8 Hz, 1H), 7.98 (d, J=8 Hz, 1H), 7.93-7.89 (m, 2H), 7.28-7.23 (m, 2H), 7.22 (s, 1H), 7.12 (d, J=8 Hz, 1H), 5.07 (quin, J=8 Hz, 1H), 4.14 (t, J=8 Hz, 2H), 3.85 (m, 2H), 3.36 (m, 2H), 3.09 (t, J=8 Hz, 2H), 2.80 (m, 1H), 1.57-1.66 (m, 4H), 1.41 (d, J=7 Hz, 3H).
Prepare Example 2 Essentially Analogous to Example 1, Using the Starting Material from Preparation 3
(17) TABLE-US-00007 Ex No. Chemical Name Structure Physical data 2 Racemic 4-chloro-N-{1-[1- (tetrahydro-2H-pyran-4- ylcarbonyl)-2,3-dihydro-1H- indo1-5-yl]ethyl}benzamide
Example 2A and 2B
4-Chloro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer 1 and 4-Chloro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer 2
(18) ##STR00024##
(19) Purify racemic 4-chloro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide (Example 2) by chiral SFC to afford the first eluting enantiomer (Isomer 1). ES/MS (m/z): 413.0 (M+H). Purification conditions: CHIRALPAK AD-H, 21150 mm; Mobile phase: 40% iPrOH in CO.sub.2; Flow rate: 70 g/minute; UVW: 260 nm. Confirm enantiomeric enrichment of Isomer 1 by chiral analytical SFC (>99% ee, R.sub.t=1.97 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% iPrOH in CO.sub.2; Column temperature: 40 C.; Flow rate: 5 mL/minute; UVW: 225 nm).
(20) The above purification also yields the second eluting enantiomer (Isomer 2). ES/MS (m/z): 413.0 (M+H). Confirm enantiomeric enrichment of Isomer 2 by chiral analytical SFC (>99% ee, R.sub.t: 3.04 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% iPrOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm).
Prepare Examples 3 Through Example 9 Essentially Analogous to Example 1, Using the Starting Material from Preparation 3
(21) TABLE-US-00008 Ex No. Chemical Name Structure Physical data 3 Racemic 4-cyano-N-{1-[1- (tetrahydro-2H-pyran-4- ylcarbonyl)-2,3-dihydro-1H- indol-5-yl]ethyl}benzamide
Example 9A and B
2,4-Difluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer 1 and 2,4-Difluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer 2
(22) ##STR00032##
(23) Purify racemic 2,4-difluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide (Example 9) by chiral SFC to afford the first eluting enantiomer (Isomer 1). ES/MS (m/z): 415.0 (M+H). Purification conditions: CHIRALPAK AD-H, 21150 mm; Mobile phase: 40% MeOH in CO.sub.2; Column temperature: 40 C.; Flow rate: 70 g/minute; UVW: 225 nm. Confirm enantiomeric enrichment of Isomer 1 by chiral analytical (98.6% ee, R.sub.t: 1.72 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm).
(24) The above purification also yields the second eluting (Isomer 2). ES/MS (m/z): 415.2 (M+H). Confirm enantiomeric enrichment of Isomer 2 by chiral analytical SFC (98.5% ee, R.sub.t: 2.60 minutes; Column: CHIRALPAK AD-H, 4.6150 mm; Mobile phase: 40% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm).
Prepare Examples 10 Through Example 13 Essentially Analogous to Example 1, Using the Starting Material from Preparation 7
(25) TABLE-US-00009 Ex No. Chemical Name Structure Physical data 10 4-(Difluoromethyl)-N-{1-[1- (tetrahydro-2H-pyran-4- ylcarbonyl)-2,3-dihydro-1H- indol-5-yl]ethyl}benzamide, Isomer A
Prepare Examples 14 and 15 Essentially Analogous to Example 1A, Synthetic Method 2
(26) TABLE-US-00010 Ex No. Chemical Name Structure Physical data 14 4-Fluoro-N-{2-[1-(tetrahydro- 2H-pyran-4-ylcarbonyl)-2,3- dihydro-1H-indol-5- yl]propan-2-yl}benzamide
Example 16
Diastereomeric 4-Fluoro-N-[1-{1-[tetrahydro-2H-pyran-3-ylcarbonyl]-2,3-dihydro-1H-indol-5-yl}ethyl]benzamide (Mix of 2 Diastereomers)
(27) ##STR00039##
(28) Treat a mixture of N-[1-(2,3-dihydro-H-indol-5-yl)ethyl]-4-fluorobenzamide, Isomer 1 (Preparation 24A) (150 mg, 0.528 mmol), racemic tetrahydropyran-3-carboxylic acid (100 mg. 0.739 mmol) and N,N-diisopropylethylamine (0.277 mL, 1.58 mmol) in DCM (5.28 mL) with 1-[bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium-3-oxide hexafluorophosphate (304 mg, 0.791 mmol). Stir at room temperature for 45 minutes. Dilute the reaction mixture with DCM. Add water and saturated aqueous sodium bicarbonate solution. Separate the layers and extract the aqueous layer twice with DCM. Pass the combined organic layer through a hydrophobic frit (ISOLUTE phase separator cartridge) and concentrate the filtrate. Purify by silica gel column chromatography eluting with a gradient of 20-55% acetone in hexanes to give the title compound (184 mg, 88%) as a white solid. ES/MS (m/z): 397.2 (M+H).
Example 16A and B
4-Fluoro-N-[1-{1-[tetrahydro-2H-pyran-3-ylcarbonyl]-2,3-dihydro-1H-indol-5-yl}ethyl]benzamide, Isomer 1 and 4-Fluoro-N-[1-{1-[tetrahydro-2H-pyran-3-ylcarbonyl]-2,3-dihydro-1H-indol-5-yl}ethyl]benzamide, Isomer 2
(29) ##STR00040##
(30) Purify diasteromeric 4-fluoro-N-[1-{1-[tetrahydro-2H-pyran-3-ylcarbonyl]-2,3-dihydro-1H-indol-5-yl}ethyl]benzamide (Example 16) by chiral chromatography to afford the first eluting diastereomer (Isomer 1). MS (m/z): 397.2 (M+H). Purification conditions: CHIRALCEL OJ-H, 30250 mm; Mobile phase: 100% MeOH; Flow rate: 30 mL/minute; UVW: 225 nm. Confirm enantiomeric enrichment of Isomer 1 by chiral analytical HPLC (>99% de, R.sub.t: 3.42 minutes; Column: CHIRALCEL OJ-H, 4.6150 mm; Mobile phase: 100% MeOH (containing 0.2% isopropylamine); Flow rate: 1 mL/minute; UVW: 225 nm).
(31) The above purification also yields the second eluting (Isomer 2). ES/MS (m/z): 397.2 (M+H). Confirm enantiomeric enrichment of Isomer 2 by chiral analytical HPLC (97.8% de, R.sub.t: 4.66 minutes; Column CHIRALCEL OJ-H, 4.6150 mm; Mobile phase: 100% MeOH (containing 0.2% isopropylamine); Flow rate: 1 mL/minute; UVW: 225 nm).
Example 17
4-Fluoro-2-hydroxy-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer A
(32) ##STR00041##
(33) Add 10% Pd/C (10 mg) to a nitrogen flushed solution of 2-(benzyloxy)-4-fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]ethyl}benzamide, Isomer A (Example 12) (96.0 mg, 0.19 mmol) in ethanol (2 mL) and hydrogenate with 1 atm (101 kPa) of hydrogen at room temperature for one hour. Filter over diatomaceous earth and concentrate the filtrate to obtain the desired compound (66 mg, 84%) as a white solid. ES/MS (m/z): 413.0 (M+H).
Example 18
Racemic 4-fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]propyl}benzamide
(34) ##STR00042##
(35) Treat a mixture of racemic N-[1-(2,3-dihydro-1H-indol-5-yl)propyl]-4-fluorobenzamide (Preparation 22) (200 mg, 0.650 mmol) in DCM (6.5 mL) with N,N-diisopropylethylamine (0.228 mL, 1.30 mmol). Add tetrahydropyran-4-carbonyl chloride (110 mg, 0.715 mmol) and stir for 30 minutes. Dilute the reaction mixture with DCM. Add water and saturated aqueous sodium bicarbonate solution. Separate the layers and extract the aqueous layer twice with DCM. Pass the combined organic layer through a hydrophobic frit (ISOLUTE phase separator cartridge) and concentrate the filtrate. Purify by silica gel column chromatography eluting with a gradient of 20-60% acetone in hexanes to give the title compound as a light peach-colored foam (244 mg, 91%). ES/MS (m/z): 411.2 (M+H).
Example 18A and B
4-Fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]propyl}benzamide, Isomer 1 and 4-Fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]propyl}benzamide, Isomer 2
(36) ##STR00043##
(37) Purify racemic 4-fluoro-N-{1-[1-(tetrahydro-2H-pyran-4-ylcarbonyl)-2,3-dihydro-1H-indol-5-yl]propyl}benzamide (Example 18) by chiral SFC chromatography to afford the first eluting enantiomer (Isomer 1). ES/MS (m/z): 411.2 (M+H). Purification conditions: CHIRALPAK AS-H, 21150 mm column; Mobile phase: 25% MeOH in CO.sub.2; Column temperature: 40 C.; Flow rate: 80 g/minute; UVW: 260 nm. Confirm enantiomeric enrichment of Isomer 1 by chiral analytical SFC (>99% ee, R.sub.t: 0.92 minutes; Column: CHIRALPAK AS-H, 4.6150 mm; Mobile phase: 25% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm).
(38) The above purification also yields the second eluting enantiomer (Isomer 2). ES/MS (m/z): 411.2 (M+H). Confirm enantiomeric enrichment of Isomer 2 by chiral analytical SFC (>99% ee, R.sub.t: 1.53 minutes; Column: CHIRALPAK AS-H, 4.6150 mm; Mobile phase: 25% MeOH in CO.sub.2; Flow rate: 5 mL/minute; UVW: 225 nm).
Reference Example 1
1-(2,4-Difluorophenyl)-3-{[1-(3,4,5-tritritiobenzoyl)-2,3-dihydro-1H-indol-5-yl]methyl}urea
(39) ##STR00044##
(40) In a tritaration flask, stir 1-(2,4-difluorophenyl)-3-{[1-(3,4,5-tribromobenzoyl)-2,3-dihydro-1H-indol-5-yl]methyl}urea (3 mg, 0.005 mmol), palladium (10% on carbon, 3 mg) and N,N-diisopropylethylamine (10 L, 0.06 mmol) in DMF (1 mL) under 3 Ci of tritium for three hours. Filter the reaction and co-evaporate the filtrate with EtOH to remove the labile tritium. Dissolve the residue in EtOH and purify by reverse phase column chromatography (Column: GEMINI C18 25010 mm; Mobile phase: A: water/TFA (1000:1), B: ACN/TFA (1000:1); gradient: 20-70% B over 60 minutes; flowrate 3 mL/minute) to give the title compound which was dissolved in EtOH. MS: 414.19 (M+H) and 74 Ci/mmol.
Reference Example 2
1-(2,4-Difluorophenyl)-3-{[1-(phenylcarbonyl)-2,3-dihydro-1H-indol-5-yl]methyl}urea
(41) ##STR00045##
(42) Dissolve 1-(2,4-difluorophenyl)-3-(2,3-dihydro-1H-indol-5-ylmethyl)urea (300 mg, 0.99 mmol) in DCM (20 mL) and add benzoyl chloride (0.13 mL, 1.1 mmol) and TEA (0.27 mL, 1.9 mmol). Stir the reaction mixture at room temperature for two hours. Concentrate and purify the residue by reverse phase purification (Column: Redisep Rf Gold High Performance C18 Reverse Phase Column; Mobile phase: A: 0.1% formic acid in water, B: ACN; gradient: 0-80% B over 30 minutes; flow rate: 60 mL/minute, UVW: 219/254 nm) and isolate the product by lyophilization to give the title compound (403 mg, 79%). ES/MS (m/z): 408.2 (M+H).
(43) The immune system is a critical checkpoint that restrains tumor development. As such, cancers have evolved many mechanisms to evade, suppress, or otherwise subvert the immune system. While tryptophan is absolutely essential for cancer cell growth, its degradation is selected for in a broad array of cancers through the expression of indoleamine 2,3 dioxygenase (IDO1) either by the cancer cell itself (intrinsic), or by cells in the microenvironment or tumor draining lymph nodes (TDLNs) (extrinsic). The selective activation of IDO1 in the tumor microenvironment while counter to rapid cell growth provides the tumor with an effective strategy to avoid immunosurveillance, a critical checkpoint in cancer development and resistance to therapy. The immunosuppressive activity of IDO1 is a direct result of the local depletion of tryptophan and the concomitant production of kynurenine, both of which are immunosuppressive.
(44) The immunosuppressive role of IDO1 activity impacts multiple cell types including cell suppression [T-cells (Frumento, et al. (2002) J Exp Med 196(4): 459-468; Terness, et al. (2002) J Exp Med 196(4): 447-457) and NK cells (Della Chiesa, et al. (2006) Blood 108(13): 4118-4125)], cell development [regulatory T-cells (Sharma, et al. (2007) J Clin Invest 117(9): 2570-2582; Chen, et al. (2008) J Immunol 181(8): 5396-5404; Baban, et al. (2009) J Immunol 183(4): 2475-2483)] and suppressive antigen presenting cells [suppressive dendritic cells and macrophages (Munn, et al. (2004) J Clin Invest 114(2): 280-290; Munn, et al. (2005) Immunity 22(5): 633-642; Sharma, et al. (2007) J Clin Invest 117(9): 2570-2582)], and recruitment and expansion [myeloid-derived suppressor cells (Yu, et al. (2014) J Immunol 193(5): 2574-2586; Holmgaard, et al. (2015) Cell Rep 13(2): 412-424)]. IDO1 activity exhibits these effects through depletion of tryptophan and the concomitant increase in kynurenine in the tumor, the tumor microenvironment and TDLNs.
(45) Both the local depletion of tryptophan and the production of kynurenine by IDO1 expression in the tumor microenvironment or in TDLNs support the development and activation of Tregs (Sharma, et al. (2007) J Clin Invest 117(9): 2570-2582), MDSCs (Holmgaard, et al. (2015) Cell Rep 13(2): 412-424), and regulatory dendritic cells (Sharma, et al. (2007) J Clin Invest 117(9): 2570-2582) all of which play immunosuppressive roles that support tumor growth. The depletion of tryptophan supports Treg development through the activation of the stress response kinase GCN2, which is stimulated in response to the accumulation of uncharged tRNAs. T-cells lacking GCN2 are not susceptible to IDO1-mediated inhibition of proliferation or the induction of an anergic phenotype (Munn, et al. (2005) Immunity 22(5): 633-642). In addition to tryptophan depletion, IDO1 activity leads to high concentrations of the downstream metabolite kynurenine, an important immunosuppressive molecule. Similar to tryptophan depletion, the activation of aryl hydrocarbon receptor (AHR) by kynurenine is essential for the generation of regulatory T-cells (Mezrich, et al. (2010) J Immunol 185(6): 3190-3198), and elevated production of kynurenine and expression of AHR correlate with poor prognosis in human brain cancer (Opitz, et al. (2011) Nature 478(7368): 197-203). Kynurenine blocks T-cell and NK cell proliferation (Boyland, et al. (1956) Biochem J 64(3): 578-582) and is an agonist of the AHR receptor (Mezrich, et al. (2010) J Immunol 185(6): 3190-3198; Opitz, et al. (2011) Nature 478(7368): 197-203), a transcription factor that regulates innate immune-mediated production of cytokines such as IL-1, IL-6 and IL-21, and is overexpressed in several cancers where it is thought to facilitate tumor progression and resistance to therapy (Julliard, et al. (2014) Front Immunol 5: 458). In fact, the intrinsic expression of IDO1 in cancer is regulated, in part, by kynurenine-mediated activation of an AHR-IL-6-STAT3 signaling loop that enforces the expression of IDO1 and inhibits T-cell proliferation. Expression of this IDO1 signaling axis is associated with a reduction in relapse free survival in lung cancer patients (Litzenburger, et al. (2014) Oncotarget 5(4): 1038-1051). IDO1-mediated IL-6 production also plays an important role in supporting the development of pro-tumorigenic MDSCs and disruption of IDO1 reduced IL-6 production, attenuated MDSC suppressive activity, delayed tumor growth and increased survival in a KRAS-induced lung cancer model (Smith, et al. (2012) Cancer Discov 2(8): 722-735). The connection between IDO1-dependent depletion of tryptophan and kynurenine-dependent activation of AHR provides a lynch pin explaining why tryptophan catabolism is intimately associated with immune escape, a critical checkpoint that restrains cancer progression.
(46) The regulation of IDO1 expression in the tumor microenvironment is complex. IDO1 was the first IFN--regulated gene discovered (Yoshida, et al. (1981) Proc Natl Acad Sci USA 78(1): 129-132). In fact, there is a strong correlation between IFN- and IDO1 expression across all cancer histologies (http://cancergenome.nih.gov/). Additionally, IDO1 expression is upregulated by type I interferons, TLR ligands, TNF, IL-1, CTLA-4, CD200, GITR, CD40 and TGF-, all of which play important roles in the immune system, and cancer development, progression and response to therapy. High IDO1 activity as measured by IDO1 expression, tryptophan depletion and/or increase in kynurenine has been implicated in the poor prognoses, reduced survival rates and increased metastatic potential of a wide variety of tumor types. As such, increases in serum levels of kynurenine with a concomitant reduction in tryptophan are evidenced in breast, colorectal cancer, head and neck, lung and prostate cancers (Liu, et al. (2010) Blood 115(17): 3520-3530). In addition, IDO1 is chronically activated in cancer patients (Schrocksnadel, et al. (2006) Clin Chim Acta 364(1-2): 82-90), associated with extensive disease (Huang, et al. (2002) Br J Cancer 86(11): 1691-1696), poor outcome and/or resistance to standard chemotherapy in several cancers including melanoma (Weinlich, et al. (2007) Dermatology 214(1): 8-14), acute myeloid leukemia (Chamuleau, et al. (2008) Haematologica 93(12): 1894-1898; Corm, et al. (2009) Leuk Res 33(3): 490-494), breast and cervical cancer (Inaba, et al. (2010) Gynecol Oncol 117(3): 423-428; Yu, et al. (2011) Clin Dev Immunol 2011: 469135; Yu, et al. (2013) J Immunol 190(7): 3783-3797; Chen, et al. (2014) Breast Cancer Res 16(4): 410): Clin Cancer Res. 2007 Dec. 1; 13(23):6993-7002; Trott, et al. (2016). Oncotarget, 7(41), 66540-66557, colorectal cancer, renal cell carcinoma, cutaneous melanoma, diffuse large B-cell lymphoma, endometrial cancer, gastric cancer, glioma, hepatocellular carcinoma, Hodgkin's lymphoma, laryngeal squamous cell carcinoma, lung cancer, multiple myeloma, Non-Hodgkin's lymphoma, esophageal and oral squamous cell carcinoma, osteosarcoma, ovarian cancer, pancreas ductal carcinoma, T-cell leukemia and thyroid carcinoma. IFN- is a critical effector cytokine secreted from activated NK and T-cells. Negative regulatory circuits that are engaged to restrain T-cell activity either systemically (CTLA-4) or locally (PD-L1/L2) are currently approved for use as anti-cancer agents where they enhance T-cell-mediated tumor growth inhibition. Genetic knockouts of checkpoints such as CTLA-4, PD-1 or PD-L result in the marked enhancement of IFN- production (Latchman, et al. (2004) Proc Natl Acad Sci USA 101(29): 10691-10696; Pandiyan, et al. (2007) J Immunol 178(4): 2132-2140), which can engage the immunosuppressive IFN--to-IDO1 axis. The inhibition of intrinsic IDO1 expression with 1-Methyl Tryptophan in a mouse melanoma model, significantly improved the efficacy of Ipilimumab, a CTLA-4 blocking antibody (Holmgaard, et al. (2013) J Exp Med 210(7): 1389-1402). This enhanced efficacy of Ipilimumab was associated with an increase in CD8 effector cells and a decrease in Tregs. These observations were extended to other antibodies targeting PD1, PD-L1 and GITR where the inhibition of IDO1 enhanced their anti-cancer activity. Mechanistically IDO1 was shown to impede the efficacy of these checkpoint inhibitors through the induction of Tregs with the subsequent recruitment of MDSCs creating an immunosuppressive environment at the tumor (Holmgaard, et al. (2015) Cell Rep 13(2): 412-424). Immunotherapeutic approaches to treat cancer such as IFN- itself, innate immune activators such as CpG-ODNs, anti-4-1BB (CD137), anti-OX40, anti-PD-1/PD-L1/PD-L2, anti-CTLA 4 all have the potential to activate IDO1 expression restraining their long-term efficacy in the clinic. Therefore, there may be significant therapeutic potential in combining IDO1 inhibitors with these agents. Specifically, combination of IDO1 inhibitors with anti-PD1 antibodies (pidilizumab, nivolumab, pembrolizumab), anti-PD-L1 antibodies (durvalumab, atezolizumab, avelumab), anti-CTLA-4 antibodies (ipilimumab), anti-OX40 antibodies (MEDI6469, KHK4083) and anti-4-1BB (CD137) antibodies (PF-05082566) have significant therapeutic potential in a wide range of tumor types.
(47) Taken together, these data suggest that inhibitors of tryptophan depletion and the concomitant production of kynurenine such as IDO1 inhibitors may be useful as a single agent or in combination in a variety of cancer types in both treatment nave as well as treatment resistant cancer patients. This utility has been demonstrated by known IDO1 inhibitors such as epacadostat (INCB024360) and NLG919. Epacadostat is known to bind to IDO1 and block the catabolism of tryptophan and the subsequent production of kynurenine both in vitro and in vivo. Additionally, epacadostat has demonstrated single agent efficacy in pre-clinical mouse models, CT26 and PAN02, an effect that is dependent upon the presence of T-cells. (Yue, et al. (2009) J Med Chem 52(23): 7364-7367; Koblish, et al. (2010) Mol Cancer Ther 9(2): 489-498; Liu, et al. (2010) Blood 115(17): 3520-3530; Jochems, et al. (2016) Oncotarget, Advance Publications). The pre-clinical efficacy of epacadostat has translated into human clinical trial outcomes (NCT11195311).
(48) The results of the following assays demonstrate evidence that the compounds exemplified herein are useful as kynurenine production inhibitors such as IDO1 inhibitors and may be useful in treating cancer. Furthermore, the results of the following assays demonstrate that certain exemplified compounds bind to IDO1 and that all exemplified compounds inhibit the conversion of tryptophan to kynurenine in cancer cells both in vitro and in vivo.
Binding Assay for IDO1
(49) The purpose of this assay is to demonstrate that certain exemplified compounds bind to IDO1 in vitro. Specifically, this assay assesses the ability of test compounds to compete with a tritiated spy molecule 1-(2,4-difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea and allows for the calculation of the binding affinity, IC.sub.50.
Competitive Binding of 1-(2,4-Difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea to IDO1
(50) Load 300 nM His.sub.6-IDO1 (Proteros, SwissProtID P14902, Cat # PR-0278, batch 19/59, 98 mg/mL in 25 mM MES pH 6.5, 150 mM KCl, purity >95%) diluted in DPBS to each well of nickel coated plate (Sigma, Cat # S5563) and incubate overnight at 4 C. Remove unbound proteins by washing plate with 300 L DPBS four times in BIOTEK Microplate Washer. Add 100 L of blocking buffer (0.05% TWEEN 20/DPBS) per well and incubate for one hour at room temperature to reduce nonspecific binding. While blocking the plate, prepare 50 nM 1-(2,4-difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea (Biocair, Cat # TRQ41455) by diluting in DPBS, and serially dilute unlabeled stock solution 2.5-fold in DMSO to generate an eleven point dilution curve. Add 5 L of serial diluted unlabeled compounds to 95 L of 50 nM 1-(2,4-difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea, add mixture to the wells in the plate, and incubated at room temperature for four hours with gentle shaking. To determine the maximum displacement of the tritiated-spy molecule (1-(2,4-difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea), add an excess amount of unlabeled 1-(2,4-difluorophenyl)-3-{[1-(phenylcarbonyl)-2,3-dihydro-1H-indol-5-yl]methyl}urea (ChemDiv, Cat # G714-0242)) 100 M to 50 nM 1-(2,4-difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea and add to nonspecific binding control wells in the plate. After four hour incubation, aspirate wells using a MultiMek96 and wash the plate quickly once with 300 L ice-cold DPBS using a BIOTEK Microplate washer. Add 100 L of 100 mM imidazole in PBS pH 7.5 to each well and incubated for 10 minutes at room temperature to displace IDO1-ligand complex from the nickel-coated plate. Transfer displaced IDO1-ligand complex into a 96-well white clear bottom plate (Costar, Cat #3632) containing 200 L of Microscint-20 (Perkin Elmer, Cat #6013621), per well using a MultiMek96. Quantitate total bound and nonspecific binding (NSB) of the 1-(2,4-difluorophenyl)-3-[[1-(3,4,5-tritritiobenzoyl)indolin-5-yl]methyl]urea ligand using a Trilux Microbeta Counter. Use total bound and NSB values to calculate the IC.sub.50 for unlabeled compound using nonlinear regression analysis in GraphPad Prism. The results of this assay demonstrate that certain exemplified compounds bind to IDO1. For example, Examples 1A and 1B demonstrate IC.sub.50 values less than 1.5 M. Specifically, the IC.sub.50 for Example 1A is 0.033 M0.0028 (n=2).
Kynurenine Production Assay (SKOV3)
(51) The purpose of this assay is to evaluate the inhibition of the production of kynurenine, N-formyl-kynurenine and the depletion of tryptophan in IDO1 expressing cancer cells and assess whether compounds are overtly toxic to these cells. Exemplary compounds are tested for the inhibition of IDO1 activity in SKOV3 (ATCC, Cat # HTB-77), an ovarian cancer cell line that intrinsically expresses IDO1. Due to IDO1 expression, SKOV3 cells degrade tryptophan with the concomitant production of kynurenine and compounds are tested for their ability to inhibit the production of kynurenine, N-formyl-kynurenine and the depletion of tryptophan. Optionally, overt toxicity of compounds can be assessed by monitoring cell viability.
Synthesis of Internal Standards
Synthesis of N-Formyl L-Kynurenine-d4 (2S)-2-amino-4-oxo-4-(2,3,4,5-tetradeuterio-6-formamido-phenyl)butanoic acid
(52) ##STR00046##
(53) Add a preformed mixture of acetic anhydride (0.026 mL, 0.264 mmol) in formic acid (0.052 mL, 1.32 mmol) to a mixture of L-kynurenine-d4 (56 mg, 0.264 mmol) in formic acid (0.132 mL). Stir the resulting mixture at room temperature under nitrogen for two hours. Dilute the reaction mixture with ACN and concentrate under a stream of nitrogen. Purify the residue by reversed-phase HPLC (Column: PHENOMENEX LUNA 5 m C18 (2) 100 AXIA, 3075 mm; eluent: A: 0.1% formic acid/water, B: 0.1% formic acid/ACN; gradient: 0% B for 2 minutes then gradient to 22% B over 5 minutes; flow: 85 mL/minutes at UVW 231/214 nm) to give the title compound 29 mg as a fluffy white solid after lyophilization. ES/MS (m/z): 241.0 (M+H).
Cell Treatment and Cell Viability
(54) Plate SKOV3 cells, an IDO1-expressing ovarian cancer cell line, at 20,000 cells per well in 100 L of McCoys 5A media (Gibco, Cat #16600-082) supplemented with non-essential amino acids (Gibco, Cat #11140-050), 1 mM sodium pyruvate (Gibco, Cat #11360-070), and 10% fetal bovine serum, complete media, in a 96 well tissue culture plate (BD Biosciences). Then, incubate cells for 16 hours in a 37 C. incubator with 5% CO.sub.2. Prepare compound serial dilutions from 10 mM stock test compounds in DMSO. Serially dilute the stock solution 3-fold in DMSO, and transfer 5 L of compounds to an intermediate dosing plate containing 95 L of complete media to generate a ten-point dilution curve with final compound concentrations ranging from either 1 M to 0.5 M or 10 M to 0.5 nM. Decant the media from the plate containing cells and blot onto paper towels. Wash plate twice with 90 L of complete media per well and replace the final wash with 90 L of complete media. After washing, add 10 L of serial diluted compounds from the intermediate dosing plate to each well of the plate(s) and incubate for 18 hours in a 37 C. incubator with 5% CO.sub.2. The final DMSO concentration in the assay is 0.5%. At the end of the 18 hours incubation, transfer 50 L of media from each well into a 96 well v-bottom plate (Thermo Scientific), seal the plate, and store at 80 C. for subsequent mass spectrometric-based measurement of kynurenine, N-formyl-kynurenine and tryptophan. Optionally, return original plate(s) to the incubator for an additional 24 hours and measure the viability of cells by adding an equal volume of CELLTITER-GLO (Promega) and measure luminescence in an PERKIN ELMER EnVision plate reader.
Mass Spectrometric (MS) Measurement of Tryptophan, N-Formyl-Kynurenine, and Kynurenine
(55) Thaw samples collected from SKOV3 cell-based assay on ice and clear any cellular debris by centrifuging plate at 3220g for one minute at 4 C. Add 12.5 L of internal standards consisting of 2.5 g/mL L-tryptophan-2,4,5,6,7-d5 (CDN Isotopes, Cat # D-1522), L-kynurenine sulfate-ring-d4,3,3-d2 (Cambridge Isotope Laboratories, Cat # DLM-7842-0.01) and internally prepared N-formyl L-kynurenine-d4. Heat seal all plates with Easy Peel seals (ThermoScientific) and mix by vortexing for 1-2 minutes and then centrifuge for one minute at 3220g at 4 C. Generate standard calibration solutions for quantification of kynurenine and N-formylkynurenine by dissolving each in water to give a final concentration of 1 mg/mL. Aliquot 20.8 L kynurenine and 23.6 L N-formylkynurenine from their respective 1 mg/mL stock and dilute to 1 mL using McCoys 5A media to give a final concentration for each standard of 100 M. Serial dilute calibration solution 2-fold in complete media to obtain a 5-point standard curve with final concentrations of 5 M to 0.313 M (kynurenine) and 2 M to 0.125 M (N-formylkynurenine). Inject 1 L of media sample (unknown) or standard calibration solution onto an LC/MS-MS system consisting of a SHIMADZU Prominence 30A HPLC system and an AB SCIEX 5500 triple quadrupole mass spectrometer. Separate analytes on a XBridge C18 column, 2.150 mm, 3.5 m (Waters, Cat #186003021) maintained at 35 C., with mobile phase flow rate of 0.7 mL/minute. The mobile phase A is 0.1% formic acid in water, and mobile phase B is MeOH. The gradient profile is: 0 minutes, 0.5% B; 0.8 minutes, 98% B; 1.10 minutes, 98% B; 1.11 minutes, 0.5% B; 1.7 minutes, and then stopped. Operate the mass spectrometer in APCI positive multiple reaction monitoring mode. Use data from standard curve samples and generate a linear fit calibration curve for each analyte using the MultiQuan software. Use the standard curve generated to calculate the analyte concentrations for the unknowns.
(56) Calculate compound IC.sub.50 values using the mass spectrometric measurement of kynurenine from the media containing 500 M of reference standard treatment as one hundred percent inhibition, and no compound but DMSO treatment as zero percent inhibition. Measurements of N-formyl-kynurenine and tryptophan are used to assess the validity of data generated by showing direct relationship between kynurenine and N-formyl-kynurenine production with the concomitant reduction in tryptophan levels. The results of this assay demonstrate that all exemplified compounds inhibit the production of kynurenine and N-formyl-kynurenine in IDO01 expressing cancer cells at IC.sub.50 values for inhibiting both kynurenine and N-formyl-kynurenine of less than 0.9 M. and of those tested (Examples 1-9) in cell viability, all of the compounds did so without being overtly toxic to the cells up to at least 1 M. For example, the IC.sub.50 for Example 1A for inhibiting kynurenine and N-formyl-kynurenine are 0.007 M0.002 (n=6) and 0.007 M0.002 (n=6) respectively. Furthermore, Example 1A does not inhibit cell proliferation up to 10 M.
In Vivo Target Inhibition Assay
(57) The purpose of this assay is to evaluate the inhibition of kynurenine production and tryptophan depletion in cancer cells in vivo. SKOV3X (Indiana University Research and Technology Center), an ovarian cancer cell line, intrinsically expresses IDO1 and readily forms tumors in the peritoneal cavity of Athymic Nude-Foxn1.sup.nu mice (Harlan). As a consequence of IDO1 expression, SKOV3X tumors locally deplete tryptophan with the concomitant production of high levels of kynurenine in the tumor microenvironment. The purpose of this assay is to measure the ability of test compounds to inhibit IDO1 evidenced by the clear reduction in kynurenine levels in the tumor.
Live Phase
(58) Culture SKOV3X in McCoys 5A media (Gibco, Cat #16600-082) supplemented with non-essential amino acids (Gibco, Cat #11140-050), 1 mM sodium pyruvate (Gibco, Cat #1360-070) and 10% FBS and incubate at 37 C. in 5% CO.sub.2. Trypsinize and isolate cells from culture and resuspend cells in Hank's balanced salt solution (HBSS). Implant 210.sup.6 SKOV3X cells into the intraperitoneal cavity of each Athymic Nude-Foxn1.sup.nu mouse (Harlan). Approximately three weeks post-implantation, palpate animals to ensure tumor formation and randomize tumor-bearing mice into vehicle control and compound treatment groups. Administer compound formulated in vehicle containing 1% hydroxyethylcellulose (HEC) and 0.025% TWEEN 80 and 0.05% Antifoam or vehicle alone by oral gavage. Generate time-course inhibition profile by dosing tumor-bearing animals with a single dose and collect plasma, liver, and tumor samples at 2, 4, 8, 12, and 24 hours post dose. Collect blood into EDTA-containing blood collection tubes (Greiner bio-one, Cat #450474) and centrifuge at 2365g, isolate plasma, and freeze at 80 C. Isolate liver and tumor fragments, record weights and flash freeze and store at 80 C.
Generation of Standard Curve, Tissue Processing and Target Inhibition
(59) Prepare calibration standards for L-kynurenine and L-tryptophan by first generating stripped matrices, which are plasma and tissue homogenates depleted of L-kynurenine and L-tryptophan by dialysis. Then, fortify stripped matrices with known amounts of L-kynurenine and L-tryptophan. Generate stripped mouse plasma by adding 10 mL of EDTA treated mouse plasma (BioreclamationIVT, Cat # MSEPLEDTA3) to a SPECTRA/POR FLOAT-A-LYZER G2 (Spectrum Labs, Cat # G235063) and placing this dialysis device in 1000 mL of phosphate buffered saline and dialyze overnight. Afterward, transfer this device to a fresh 1000 mL of phosphate buffered saline and repeat the dialysis. Transfer the stripped mouse plasma to a clean container and store at 20 C. for future use. Prepare control liver homogenate by adding 3 mL of MeOH/water (1:1, v/v) for every gram of control mouse liver and homogenize with an ultrasonic probe. Prepare control tumor homogenate in the same fashion except use a tissue grinder to homogenize tumor tissue. Add 10 mL of the control tissue homogenates, liver and tumor, to separate SPECTRA/POR FLOAT-A-LYZER G2 devices and dialyze each overnight in 1000 mL of MeOH/water (1:1, v/v), then transfer each to a fresh 1000 mL of MeOH/water (1:1, v/v) and repeat the dialysis. Transfer the stripped tissue homogenates to separate containers and store at 20 C. for future use.
(60) Prepare standard stock solutions of L-kynurenine-sulfate (Sigma Aldrich, Cat # K3750), dissolved in ACN/water (1:1, v/v) and L-tryptophan (Sigma Aldrich), dissolved in N-methyl-2-pyrrolidone/water (4:1, v/v), to give final free base concentrations of 1 mg/mL Aliquot 50 L of the respective stock solutions and dilute with MeOH/water (1:1, v/v) to yield a combined 50 g/mL working solution. Prepare six additional calibration working solutions in MeOH/water (1:1, v/v) by serial dilution of the 50,000 ng/mL solution to obtain a 7-point calibration curve with final concentrations of 25 ng/mL to 50 g/mL.
(61) Mix liver samples acquired from test subjects with MeOH/water (1:1, v/v) in a proportion of 1 gram of tissue to 3 mL of solvent and homogenized with an ultrasonic probe. Homogenize tumor samples with the same proportion of MeOH/water (1:1, v/v) using a tissue grinder. Thaw plasma samples from test subjects and mix for homogeneity.
(62) Perform extraction of calibration working solutions, the 7-point dilution series of L-kynurenine and L-tryptophan, by transferring 25 L of each sample to separate wells of a 96-well plate and add 25 L of the appropriate stripped control matrix (plasma, liver or tumor homogenate) to these wells depending upon tissue of origin of test samples. Add 25 L of MeOH/water (1:1, v/v) to separate wells followed by 25 L of the respective test samples. Next, add 180 L of ACN/MeOH (1:1, v/v) containing 250 ng/mL of L-tryptophan-2,4,5,6,7-d5 (Sigma Aldrich, Cat #615862) and L-kynurenine sulfate-ring-d4,3,3-d2 (Cambridge Isotope Laboratories, Cat # DLM-7842-0.005) to all wells and mix to precipitate proteins in the samples. Centrifuge the 96-well plate to pellet the precipitated protein material then dilute a portion of each supernatant at least 10-fold with water/TFA (100:2, v/v). Inject 10 L of each extracted sample and calibration standard onto an LC/MS-MS system consisting of a SHIMADZU SCL-10A controller with SHIMADZU LC-10ADvp HPLC pumps, a CTC-PAL autosampler and an AB SCIEX 4000 triple quadrupole mass spectrometer. Separate the analytes on an Advantage Echelon C18 column, 2.120 mm, 4 m (Analytical Sales and Service, Cat # Sprite AE1822) maintained at ambient conditions with a mobile phase flow rate of 1.5 mL/minute. Mobile phase A is water/TFA/1 M ammonium bicarbonate, (1000:4:1, v/v/v) and mobile phase B is ACN/TFA/1 M ammonium bicarbonate 1000:4:1, v/v/v). The gradient profile is: 0 minutes, 0.3% B; 0.03 to 0.2 minutes, 7% B; 0.3 to 0.4 minutes, 36% B; 0.41 minutes, 98% B, then stopped at 0.7 minutes to return to the original conditions. Operate the mass spectrometer in TURBOIONSPRAY positive multiple reaction monitoring mode. Use data from calibration standards curve samples and generate a quadratic fit calibration curve for each analyte using the Analyst software. Use the standard curve generated to calculate the analyte concentrations for the study samples.
(63) Use the liver concentration of kynurenine from non-tumor-bearing animals treated with vehicle as maximum inhibition or lowest level of kynurenine. Use the SKOV3X tumor concentration of kynurenine from vehicle-treated tumor-bearing mice as minimum inhibition or highest level of kynurenine. Calculate the percent inhibition for compound treated groups relative to the minimum IDO1 inhibition in the vehicle-treated tumor. The results of this assay demonstrate that Example 1A inhibits the production of kynurenine and N-formyl-kynurenine in IDO1 expressing cancer cells in vivo. Specifically, Example 1A dosed at 75 mg/kg, 25 mg/kg and 5 mg/kg resulted in 79%, 59% and 37% inhibition respectively 12 hours after dosing.
Anti-Tumor Effect of Example 1A in Mouse Syngeneic Colon26 Model for Colon Cancer and in Combination with LY3300054 in Established L55 Humanized Mouse Model
(64) Mouse Syngeneic Colon 26 Model
(65) Grow the mouse BALB/c-derived Colon26 colon cancer cell line in RPMI 1640 medium supplemented with 10 mM HEPES, 1 nM sodium pyruvate, and 10% fetal bovine serum. Harvest sub-confluent cells with trypsin and rinse twice with complete growth medium lacking serum. Initiate subcutaneous tumors by injecting 110.sup.6 cells resuspended in HBSS in the rear flank of immune-competent BALB/c mice (Envigo, Indianapolis, Ind.). Six days after tumor implantation, randomize animals based on body weight and place into their respective treatment groups using the number of animals per group as indicated.
(66) L55 Humanized Tumor Model, hPBMC Challenge, and Treatment:
(67) Grow the human NSCLC cell line, L55, in RPMI 1640 medium supplemented with 10% fetal bovine serum. Harvest sub-confluent cells with trypsin and rinse twice with growth medium lacking serum. Initiate the growth of subcutaneous tumors by injecting 510.sup.6 in a 1:1 mixture of HBSS and MATRIGEL (BD Biosciences, Franklin Lakes, N.J.) in the rear flank of NOD.Cg-Prkdc.sup.scidIl2rg.sup.tm1Wjl/SzJ mice more commonly known as NOD scid gamma chain knockout mice (NSG) mice (The Jackson Laboratory, Bar Harbour, Me.), which lack T cells, B cells, NK cells, and are deficient in cytokine signaling. When the mean tumor volume reaches approximately 200-300 mm.sup.3, randomize the animals by tumor size and body weight and place into their respective treatment groups as indicated. After randomization, challenge tumor-bearing mice with PBS alone (no PBMCs) or with PBS containing 110.sup.7 human PBMCs into the tail vein of recipients.
(68) Data Capture, Compound Formulation and Vehicle Controls (Both Models)
(69) Capture tumor size and body weight using Study Director. Estimate tumor volume (V) by using the formula: V=0.536LW.sup.2 where L=larger measured diameter and W=smaller of the perpendicular diameter. Transform the tumor volume data to a log scale to equalize variance across time and treatment groups. Analyze the log volume data with a two-way repeated measures analysis of variance by time and treatment using the MIXED procedures in SAS software (Version 9.2). The correlation model for the repeated measures is Spatial Power. Compare treated groups to the control group at each time point. Use the MIXED procedure also separately for each treatment group to calculate adjusted means and standard errors at each time point. Both analyses account for the autocorrelation within each animal and for the loss of data that occurs when animals with large tumors are removed from the study early. Calculate relative changes in tumor volume (% T/C) using the tumor volume measurements taken nearest to the last day of dosing with Example 1A, using the formula % T/C=100T/C, where T=mean tumor volume of the compound treated group, T=mean tumor volume of the compound treated group minus the mean tumor volume on the baseline day, C=mean tumor volume of the control (vehicle) group, and C=mean tumor volume of the control group minus the mean tumor volume on the baseline day. If T<0, then a tumor regression value is calculated instead of % T/C whereby % Regression=100T/T.sub.initial such that T.sub.inital=mean tumor volume on the baseline day.
(70) Assess antitumor efficacy of Example 1A and LY3300054 alone, or in combination by measuring tumor volume by three dimensional caliper measurements twice a week during the course of the study. Measure body weight twice weekly during the course of the study, as a general indicator of tolerability.
(71) Formulations for Example 1A and LY3300054: Formulate Example 1A on a weekly basis in 1% HEC/0.25% Tween 80/0.05% Antifoam and store at 4 C. Solublize LY3300054 in phosphate buffered saline and store at 4 C.
(72) Control group(s): For single agent efficacy studies, administer vehicle for Example 1A alone. For combination studies, administer both vehicles used for Example 1A and LY3300054 according to the same schedule for each compound, respectively.
(73) For monotherapy groups in combination efficacy studies, treat the animals with the desired compound and the vehicle for the compound not being dosed following the schedule for the non-dosed compound.
(74) Colon26 Syngeneic Model, Treatment and Results:
Monotherapy Example 1A
(75) Treat female BALB/c mice (n=10) bearing Colon26 tumors with Example 1A twice daily for 21 days by oral gavage at doses of 10, 50, and 100 mg/kg. Start administration of Example 1A six days after tumor implantation, and monitor tumor growth and body weight twice a week for the duration of the treatment period.
(76) Results:
(77) Treatment with 10, 50, and 100 mg/kg of Example 1A resulted in a dose-responsive effect on tumor growth with only 50 and 100 mg/kg doses showing statistically (p<0.001) relevant growth inhibition at day 20. The changes in tumor volume (% T/C) observed at day 20 were 17.5%, 31.2%, and 62.6% for the 10, 50, and 100 mg/kg doses, respectively. There were no significant tolerability issues at any dose tested with Example 1A with respect to body weight changes over the course of treatment compared to vehicle-treated mice. Body weight loss was measured as the percent change from mean body weights recorded on baseline 6 days after tumor implant for each group. At day 20, the average vehicle treated mice showed 5.5% reduction in body weight compared to baseline with the 10, 50, and 100 mg/kg dosed groups showing a 2.5%, 8%, and 2.5% reduction, respectively. While there was a dose-dependent trend in body weight loss with regard to dose, they were not statistically different from vehicle-treated mice.
(78) L55 Humanized Tumor Model, Treatment and Results:
(79) hPBMC Effect on L55 Tumor Growth
(80) The L55 NCLC human cancer cell line is intrinsically resistant to the allo-response associated with the injection of hPBMCs. The goal of these studies is to assess the ability of compounds to potentiate the allo response allowing human T cells to target and restrict the growth of a human L55 tumors in a mouse that lacks an adaptive immune system (NSG mice). To assess the contribution of hPBMCs on tumor growth inhibition of the L55 tumors, mock inject NSG mice bearing established L55 tumors (n=10) that have reached approximately 250 mm.sup.3 with PBS lacking hPBMCs, or PBS containing 110.sup.7 hPBMCs. Measure tumor volume and body weight twice a week for the duration of the treatment period.
(81) Results:
(82) There was no statistically significant inhibition of L55 tumor growth when compared to animals that did not receive hPBMCs over the course of the study. No significant tolerability issues were observed with the injection of human PBMCs over the course of the study evidenced by the lack of significant weight loss when compared to baseline, which at day 41 was 0.1% lower than at baseline.
Monotherapy Example 1A
(83) To assess the ability of Example 1A to enhance L55 tumor growth inhibition mediated by hPBMCs, mock inject NSG mice bearing established L55 tumors (n=10) that have reached approximately 250 mm.sup.3 with PBS lacking hPBMCs, and another group (n=10) with PBS containing 110.sup.7 hPBMCs. Treat both groups with 75 mg/kg Example 1A by oral gavage twice daily for 21 days. Measure tumor volume and body weight twice a week for the duration of the treatment period.
(84) Results:
(85) In the absence of hPBMCs, treatment of L55 tumors with Example 1A did not result in significant tumor growth inhibition over the course of the treatment when compared to vehicle alone without PBMCs. Treatment of L55 tumor-bearing animals with Example 1A in the presence of hPBMCs resulted in tumor growth inhibition when compared to the vehicle control group lacking hPBMCs. Statistically relevant suppression of tumor growth was most apparent at later time points with a % T/C of 47.6% at day 41 (P<0.001). No significant tolerability issues were apparent over the course of the study with hPBMCs, Example 1A, or the combination evidenced by the lack of statistically significant reductions in body weight loss when compared to baseline measurements.
(86) Monotherapy LY3300054
(87) To assess the ability of LY3300054 to enhance L55 tumor growth inhibition mediated by hPBMCs, inject two groups of NSG mice bearing established L55 tumors (n=10/group) that have reached approximately 250 mm.sup.3 with PBS containing hPBMCs. Treat one group with 10 mg/kg IgG-effector null (IgG-EN) control antibody and the other with 10 mg/kg LY3300054 by intraperitoneal injection once a week for 4 weeks. Measure tumor volume and body weight twice a week for the duration of the treatment period.
(88) Results:
(89) Treatment of L55 tumor-bearing mice that were injected with hPBMCs with 10 mg/kg IgG-EN did not alter tumor growth or progression when compared to vehicle alone with or without hPBMCs. Treatment of L55 tumor-bearing animals that had been injected with hPBMCs with 10 mg/kg LY3300064 resulted in statistically significant tumor growth inhibition when compared to vehicle-treated controls that contained or lacked hPBMCs. The change in tumor volume (% T/C) observed at the end of the dosing period when compared to vehicle alone lacking PBMCs (day 37) was 75.7%. No significant tolerability issues were apparent over the course of the study with LY3300054 with or without hPBMCs evidenced by the lack of statistically significant reductions in body weight loss when compared to baseline measurements.
Combination of Example 1A and LY3300054
(90) Inject NSG mice (n=10) bearing L55 tumors that have reached approximately 250 mm.sup.3 with hPBMCs and treat with 75 mg/kg Example 1A twice a day by oral gavage for 21 days and 10 mg/kg LY3300054 by intraperitoneal injection once a week for 4 weeks. Measure tumor volume and body weight twice a week for the duration of the treatment period.
(91) Results:
(92) Combined treatment of 75 mg/kg Example 1A and 10 mg/kg LY3300054 resulted in an improvement in the anti-tumor efficacy when compared to either monotherapy group alone. Tumor volumes were significantly lower than the vehicle alone groups that either lacked PBMCs or were injected with hPBMCs (P<0.001 at all measurements). Tumor volumes on days 30, 34, 37, and 41 were 9.6% T/C, 19.8% T/C, 13.3% T/C, and 27.3% T/C, respectively. The difference in the anti-tumor efficacy between monotherapy groups compared to the combination group was statistically significant (p<0.001). To assess whether or not the combination was additive or synergistic, the data is analyzed essentially as follows:
(93) Statistical Analysis (Both Models):
(94) The statistical analysis of the tumor volume data begins with a data transformation to a log scale to equalize variance across time and treatment groups. The log volume data are analyzed with a two-way repeated measures analysis of variance by time and treatment using the MIXED procedures in SAS software (Version 9.3). The correlation model for the repeated measures is Spatial Power. Treated groups are compared to the control group at each time point. The MIXED procedure is also used separately for each treatment group to calculate adjusted means and standard errors at each time point. Both analyses account for the autocorrelation within each animal and the loss of data that occurs when animals with large tumors are removed from the study early. The adjusted means and standard errors (s.e.) are plotted for each treatment group versus time.
(95) Combination Analysis Method (Bliss Independence for IVEF Studies):
(96) With the results of the repeated measures analysis, contrast statements are used to test for an interaction effect at each time point, comparing the mean of the vehicle and combination groups to the mean of the two single agent groups. This is equivalent to the Bliss Independence method for testing additivity. The expected additive response (EAR) for the combination is calculated on the tumor volume scale as: EAR volume=V1*V2/V0, where V0, V1, and V2 are the estimated mean tumor volumes for the vehicle control, treatment 1 alone, and treatment 2 alone, respectively. If the interaction test is significant, the combination effect is declared statistically more than additive or less than additive depending on the observed combination mean volume being less than or more than the EAR volume, respectively. Otherwise, the statistical conclusion is additive.
(97) Using this method of analysis, the tumor growth inhibition was not better than additive until days 34 and 37 where tumor growth inhibition was synergistic with P<0.008 and p<0.001, respectively. No significant tolerability issues were apparent over the course of the study with the combination of Example 1A and LY3300054 evidenced by the lack of statistically significant reductions in body weight loss when compared to baseline measurements.
(98) The compounds of the present invention are preferably formulated as pharmaceutical compositions administered by a variety of routes. Most preferably, such compositions are for oral or intravenous administration. Such pharmaceutical compositions and processes for preparing same are well known in the art. See, e.g., REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY (D. Troy, et al., eds., 21st ed., Lippincott Williams & Wilkins, 2005).
(99) As used herein, the term effective amount refers to the amount or dose of compound of the invention, or a pharmaceutically acceptable salt thereof which, upon single or multiple dose administration to the patient, provides the desired effect in the patient under diagnosis or treatment.
(100) An effective amount can be readily determined by the attending diagnostician, as one skilled in the art, by the use of known techniques and by observing results obtained under analogous circumstances. In determining the effective amount for a patient, a number of factors are considered by the attending diagnostician, including, but not limited to: the species of mammal; its size, age, and general health; the specific disease or disorder involved; the degree of or involvement or the severity of the disease or disorder; the response of the individual patient; the particular compound administered; the mode of administration; the bioavailability characteristics of the preparation administered; the dose regimen selected; the use of concomitant medication; and other relevant circumstances.
(101) The compounds of the present invention are generally effective over a wide dosage range. For example, dosages per day normally fall within the daily range of about 0.05-1000 mg. Preferably such doses fall within the daily range of 0.1-500 mg. More preferably such doses fall within the daily range of 1-200 mg. In some instances dosage levels below the lower limit of the aforesaid ranges may be more than adequate, while in other cases still larger doses may be employed without causing any harmful side effect, and therefore the above dosage ranges are not intended to limit the scope of the invention in any way. It will be understood that the amount of the compound actually administered will be determined by a physician, in the light of the relevant circumstances, including the condition to be treated, the chosen route of administration, the actual compound or compounds administered, the age, weight, and response of the individual patient, and the severity of the patient's symptoms.
(102) TABLE-US-00011 SEQUENCELISTING AminoAcidandNucleotideSequences SEQIDNO:1(humanPD-L1) MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDL AALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQ ITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSE HELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRIN TTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLC LGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET SEQIDNO:2(HCDR1ofLY3300054) KASGGTFSSYAIS SEQIDNO:3(HCDR2ofLY3300054) GIIPIFGTANYAQKFQG SEQIDNO:4(HCDR3ofLY3300054) ARSPDYSPYYYYGMDV SEQIDNO:5(LCDR1ofLY3300054) SGSSSNIGSNTVN SEQIDNO:6(LCDR2ofLY3300054) YGNSNRPS SEQIDNO:7(LCDR3ofLY3300054) QSYDSSLSGSV SEQIDNO:8(HCVRofLY3300054) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG IIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARSP DYSPYYYYGMDVWGQGTTVTVSS SEQIDNO:9(LCVRofLY3300054) QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIY GNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCQSYDSSLSGSV FGGGIKLTVLG SEQIDNO:10(HCofLY3300054) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG IIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARSP DYSPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAEGAPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK SEQIDNO:11(LCofLY3300054) QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIY GNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCQSYDSSLSGSV FGGGIKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT HEGSTVEKTVAPAECS SEQIDNO:12(DNAofHCofLY3300054) CAGGTCCAGCTGGTCCAGTCAGGGGCCGAGGTCAAAAAGCCAGGGTCATC TGTCAAAGTGTCTTGTAAGGCATCCGGGGGCACATTTTCCAGCTACGCTA TCTCCTGGGTGAGACAGGCACCAGGGCAGGGTCTGGAGTGGATGGGCGGA ATCATTCCCATCTTCGGGACCGCCAACTACGCTCAGAAGTTTCAGGGAAG GGTCACTATTACCGCCGACAAAAGCACATCTACTGCTTATATGGAGCTGT CTAGTCTGAGGTCTGAAGATACCGCAGTGTACTATTGCGCCCGGAGTCCC GACTATAGCCCTTACTATTACTATGGCATGGATGTCTGGGGCCAGGGAAC CACAGTGACAGTCTCATCCGCTAGCACCAAGGGCCCATCGGTCTTCCCCC TGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGC CTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGG CGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAG GACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGC ACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGT GGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCAC CGTGCCCAGCACCTGAAGCCGAGGGGGCACCGTCAGTCTTCCTCTTCCCC CCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATG CGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGT ATGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAG CAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCA AGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCC TCCCATCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGA GAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAA CCAAGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCG CCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACG CCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATTCCAAGCTCAC CGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGA TGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCT CCGGGCAAA SEQIDNO:13(DNAofLCofLY3300054) CAGTCCGTCCTGACACAGCCACCCTCAGCCTCTGGCACCCCTGGGCAGCG AGTGACAATCTCTTGTTCTGGGAGTTCCTCAAATATTGGTAGTAACACCG TGAATTGGTACCAGCAGCTGCCCGGCACAGCACCTAAGCTGCTGATCTAT GGAAACTCAAATAGGCCATCCGGAGTCCCCGACCGGTTCTCTGGTAGTAA ATCAGGCACTTCCGCCAGCCTGGCTATTAGCGGGCTGCAGTCTGAGGACG AAGCCGATTACTATTGCCAGTCTTACGATTCCAGCCTGTCTGGAAGTGTG TTTGGCGGAGGGATCAAGCTGACCGTCCTGGGCCAGCCTAAGGCTGCCCC CTCGGTCACTCTGTTCCCGCCCTCCTCTGAGGAGCTTCAAGCCAACAAGG CCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTG GCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCAC ACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCC TGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACG CATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTGCAGAATGCTCT