Hybrid Polyketide Synthases
20200270597 ยท 2020-08-27
Inventors
- Jeffrey L. Fortman (San Francisco, CA, US)
- Andrew Hagen (Berkeley, CA, US)
- Leonard Katz (Oakland, CA, US)
- Jay D. Keasling (Berkeley, CA)
- Sean Poust (Berkeley, CA, US)
- Jingwei Zhang (San Francisco, CA, US)
- Sergey Zotchev (Tondheim, NO)
Cpc classification
C12P13/005
CHEMISTRY; METALLURGY
C12P7/46
CHEMISTRY; METALLURGY
International classification
C12N9/00
CHEMISTRY; METALLURGY
C12P17/18
CHEMISTRY; METALLURGY
C12P13/00
CHEMISTRY; METALLURGY
Abstract
The present invention provides for a polyketide synthase (PKS) capable of synthesizing an even-chain or odd-chain diacid or lactam or diamine. The present invention also provides for a host cell comprising the PKS and when cultured produces the even-chain diacid, odd-chain diacid, or KAPA. The present invention also provides for a host cell comprising the PKS capable of synthesizing a pimelic acid or KAPA, and when cultured produces biotin.
Claims
1. A non-naturally occurring polyketide synthase (PKS) which synthesizes 7 keto-8-amino-pelargonic acid (KAPA) or the odd-chain diacid pimelic acid, wherein the PKS is a hybrid PKS comprising domains from two or more PKSs.
2.-3. (canceled)
4. The non-naturally occurring PKS of claim 1, wherein the PKS synthesizes a 7-keto-8-amino-pelargonic acid (KAPA).
5. (canceled)
6. A recombinant nucleic acid encoding the polyketide synthase (PKS) of claim 1.
7. A replicon comprising the recombinant nucleic acid of claim 6, wherein the replicon is capable of stable maintenance in a host cell.
8. The replicon of claim 7, wherein the replicon is a plasmid or vector.
9. The replicon of claim 8, wherein the vector is an expression vector.
10. A host cell comprising the recombinant nucleic acid of claim 6.
11. A host cell comprising the replicon of claim 7.
12. The host cell of claim 10, wherein the host cell, when cultured, produces pimelic acid or KAPA.
13. The host cell of claim 12, wherein the host cell further comprises one or more nucleic acids encoding pimelyl-CoA synthetase, 8-amino-7-oxononanoate synthase, 7,8-diamino-pelargonic acid (DAPA) synthase, dethiobiotin synthase, and biotin synthase, the PKS synthesizes pimelic acid, and when cultured, the host cell produces biotin.
14. The host cell of claim 12, wherein the host cell further comprises one or more nucleic acids encoding 7,8-diamino-pelargonic acid (DAPA) synthase, dethiobiotin synthase, and biotin synthase, the PKS synthesizes KAPA, and when cultured the host cell produces biotin.
15. A method of producing KAPA comprising: providing a host cell of claim 12, and culturing said host cell in a suitable culture medium such that KAPA or pimelic acid is produced.
16. The method of claim 15, further comprising isolating KAPA or pimelic acid.
17. (canceled)
18. A method of producing a biotin, comprising: providing a host cell of claim 13, and culturing said host cell in a suitable culture medium such that the biotin is produced.
19. A method of producing a biotin, comprising: providing a host cell of claim 14, and culturing said host cell in a suitable culture medium such that the biotin is produced.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
DETAILED DESCRIPTION OF THE INVENTION
[0045] Before the present invention is described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0046] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0047] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.
[0048] It must be noted that as used herein and in the appended claims, the singular forms a, and, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a diacid includes a plurality of such diacids, and so forth.
[0049] The term diacid refers to a hydrocarbon possessing two carboxylic acid moieties bridged by a chain, or backbone, or one or more carbons. The branching and oxidative state of the carbon backbone is variable, as described within.
[0050] The term even-chain diacid refers to a diacid with a carbon backbone, i.e., disregarding any functional groups or substituents, with an even number of carbon atoms.
[0051] The term odd-chain diacid refers to a diacid with a carbon backbone, i.e., disregarding any functional groups or substituents, with an odd number of carbon atoms.
[0052] The term lactam refers to a heterolcyclic hydrocarbon containing an amide bond in the ring. The technology described herein allows the production of either the lactam or the cognate acid form to any lactam described (e.g. 6-aminohexanoic acid is the cognate acid of caprolactam). The terms open chain lactam or lactam cognate acid are used to describe the hydrolyzed form of the lactam, a hydrocarbon chain possessing a carboxylate at one end and a pendent amino group. The term lactam as used herein encompasses both of these chemical classes. Like the diacids, the branching and oxidative state of the carbons in the backbone is controlled as described herein. The lactams contain even or odd numbers of carbon atoms in the carbon backbone.
[0053] The term diamine refers to two amine moieties bridged by a hydrocarbon chain, or backbone, or one or more carbons. As is the case with the diacids and lactams, the branching and oxidative state of the carbon backbone is variable by design, as described herein. Diamine refers to a diamine with a carbon backbone, i.e., disregarding any functional groups or substituents, with an odd or even number of carbon atoms.
[0054] The term functional variant describes an enzyme that has a polypeptide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95% or 99% identical to any one of the enzymes described herein. The functional variant enzyme may retain amino acids residues that are recognized as conserved for the enzyme, and may have non-conserved amino acid residues substituted or found to be of a different amino acid, or amino acid(s) inserted or deleted, but which does not affect or has insignificant effect its enzymatic activity as compared to the enzyme described herein. The functional variant enzyme has an enzymatic activity that is identical or essentially identical to the enzymatic activity of the enzyme described herein. The functional variant enzyme may be found in nature or be an engineered mutant thereof.
[0055] These and other objects, advantages, and features of the invention will become apparent to those persons skilled in the art upon reading the details of the invention as more fully described below.
Polyketide Synthases (PKS)
[0056] The present invention provides for a polyketide synthase (PKS) or PKS/non-ribosomal peptide synthetase (NRPS) hybrid capable of synthesizing an even-chain or odd-chain diacid, or lactam, or diamine. The PKS or PK/NRPS is not naturally occurring. In some embodiments of the invention, the even-chain or odd-chain diacid, or lactam, or diamine is not a compound synthesized by a naturally occurring PKS or PKS/NRPS. In some embodiments of the invention, the PKS is a hybrid PKS comprising modules, domains, and/or portions thereof from two or more PKSs. Such even-chain or odd-chain diacids, or lactams, or diamines include the diketides and triketides, and polyketides of more than three ketide units, such as 4, 5, or 6 or more ketide units. The even-chain or odd-chain diacids, or lactams, or diamines can further include one or more functional groups. Such functional groups include, but are not limited to, ethyl, methyl and hydroxyl side chains, and internal olefins and ketones.
[0057] PKSs employ short chain fatty acyl CoAs in Claisen condensation reactions to produce polyketides. Unlike fatty acid synthases which utilize acetyl CoA as the starter and malonyl CoA as the extender units, and use a single module iteratively to produce the nascent acyl chains, PKSs are composed of discrete modules, each catalyzing the chain growth of a single step. Modules can differ from each other in composition so that overall, a number of different starters (e.g. acetyl CoA, propionyl CoA) and extenders, some of which contain stereospecific methyl (or ethyl) side chains can be incorporated. In addition, PKS modules do not always reduce the 3-carbonyl formed from condensation but may leave it either unreduced (ketone), partially reduced (hydroxyl, 2,3-ene) or fully reduced (3-methylene). Many polyketide synthases employ malonyl CoA or [S]-2-methylmalonyl CoA as the starter for polyketide synthesis. In such cases the terminal carboxyl group is usually removed by a decarboxylase domain present at the N-terminus of the corresponding loading domain of the PKS. In summary, the structure (and chirality) of the -carbon and -carbonyl is determined by the module of the PKS employed in the synthesis of the growing chain at each particular step. Because of the correspondence between use of modules in the synthesis and the structure of the polyketide produced, it is possible to program the synthesis to produce a compound of desired structure by selection and genetic manipulation of polyketide synthases.
TABLE-US-00001 TABLE 1 PKS sources of the various modules. Module PKS Source S1 Spirofungin PKS Loading Domain S2 Chondrochloren PKS Loading Domain (with CoA ligase domain replaced with Succinyl CoA Ligase) A Rifamycin PKS Module 2 B Oligomycin PKS Module 1 C Spiramycin PKS Module 1 D Pikromycin PKS Module 2 E Oligomycin PKS Module 3 F Erythromycin PKS Module 3 G Oligomycin PKS Module 5 H Primaricin PKS Module 7 I Tylosin PKS Module 1 J Erythromycin PKS Module 1 K Avermectin PKS Module 7 L Rapamycin PKS Module 1 M Erythromycin PKS Module 4 N Pederin Module 2 O Ascomycin Module 4 P FK506 Module 4
[0058] All extender modules carry the -acyl ACP synthase (commonly called the ketosynthase or KS) domain, which conducts the decarboxylative condensation step between the extender and the growing polyketide chain, and the acyl carrier protein (ACP) domain that carries the growing acyl chain and presents it to the cognate reductive domains for reduction of the -carbonyl. Modules can differ from each other in composition so that a number of different starter and extender units, some of which contain stereospecific side chains (e.g. methyl, ethyl, propylene) can be incorporated. The acyltransferase (AT) domain of each module determines the extender unit (e.g. malonyl CoA, methylmalonyl CoA, etc.) incorporated. In addition, PKS modules do not always reduce the -carbonyl formed from condensation but may leave it either unreduced (ketone), partially reduced (hydroxyl, 2,3-ene) or fully reduced (3-methylene), as shown in
[0059] A partial list of sources of PKS sequences that can be used in making the PKSs of the present invention, for illustration and not limitation, includes Ambruticin (U.S. Pat. No. 7,332,576); Avermectin (U.S. Pat. No. 5,252,474; MacNeil et al., 1993, Industrial Microorganisms: Basic and Applied Molecular Genetics, Baltz, Hegeman, & Skatrud, eds. (ASM), pp. 245-256; MacNeil et al., 1992, Gene 115: 119-25); Candicidin (FRO008) (Hu et al., 1994, Mol. Microbiol. 14: 163-72); Epothilone (U.S. Pat. No. 6,303,342); Erythromycin (WO 93/13663; U.S. Pat. No. 5,824,513; Donadio et al., 1991, Science 252:675-79; Cortes et al., 1990, Nature 348:176-8); FK506 (Motamedi et al., 1998, Eur. J. Biochem. 256:528-34; Motamedi et al., 1997, Eur. J. Biochem. 244:74-80); FK520 or ascomycin (U.S. Pat. No. 6,503,737; see also Nielsen et al., 1991, Biochem. 30:5789-96); Jerangolid (U.S. Pat. No. 7,285,405); Leptomycin (U.S. Pat. No. 7,288,396); Lovastatin (U.S. Pat. No. 5,744,350); Nemadectin (MacNeil et al., 1993, supra); Niddamycin (Kakavas et al., 1997, J. Bacteriol. 179:7515-22); Oleandomycin (Swan et al., 1994, Mol. Gen. Genet. 242:358-62; U.S. Pat. No. 6,388,099; Olano et al., 1998, Mol. Gen. Genet. 259:299-308); Pederin (PCT publication no. WO 2003/044186); Pikromycin (Xue et al., 2000, Gene 245:203-211); Pimaricin (PCT publication no. WO 2000/077222); Platenolide (EP Pat. App. 791,656); Rapamycin (Schwecke et al., 1995, Proc. Natl. Acad. Sci. USA 92:7839-43); Aparicio et al., 1996, Gene 169:9-16); Rifamycin (August et al., 1998, Chemistry & Biology, 5: 69-79); Soraphen (U.S. Pat. No. 5,716,849; Schupp et al., 1995, J. Bacteriology 177: 3673-79); Spiramycin (U.S. Pat. No. 5,098,837); Tylosin (EP 0 791,655; Kuhstoss et al., 1996, Gene 183:231-36; U.S. Pat. No. 5,876,991). Additional suitable PKS coding sequences are readily available to one skilled in the art, or remain to be discovered and characterized, but will be available to those of skill (e.g., by reference to GenBank). Each of the references cited is hereby specifically and individually incorporated by reference.
[0060] Of the more than one hundred PKSs examined, the correspondence between use of modules in the biosynthesis and the structure of the polyketide produced is fully understood both at the level of the protein sequence of the PKS and the DNA sequence of the corresponding genes. The programming of modules into polyketide structure can be identified by sequence determination. It is possible to clone or synthesize DNA sequences corresponding to desired modules and transfer them as fully functioning units to heterologous, otherwise non-polyketide producing hosts such as E. coli (B. A. Pfeifer, S. J. Admiraal, H. Gramajo, D. E. Cane, C. Khosla, Science 291, 1790 (2001); hereby incorporated by reference) and Streptomyces (C. M. Kao, L. Katz, C. Khosla, Science 265, 509 (1994); hereby incorporated by reference). Additional genes employed for polyketide biosynthesis have also been identified. Genes that determine phosphopantetheine: protein transferase (PPTase) that transfer the 4-phosphopantetheine co-factor of the ACP domains, commonly present in polyketide producing hosts, have been cloned in E. coli and other hosts (K. J. Weissman, H. Hong, M. Oliynyk, A. P. Siskos, P. F. Leadlay, Chembiochem 5, 116 (2004); hereby incorporated by reference). It is also possible to re-program polyketide biosynthesis to produce a compound of desired structure by either genetic manipulation of a single PKS or by construction of a hybrid PKS composed of modules from two or more sources (K. J. Weissman, H. Hong, M. Oliynyk, A. P. Siskos, P. F. Leadlay, Chembiochem 5, 116 (2004); hereby incorporated by reference).
[0061] Recombinant methods for manipulating modular PKS genes to make the PKSs of the present invention are described in U.S. Pat. Nos. 5,672,491; 5,843,718; 5,830,750; 5,712,146; and 6,303,342; and in PCT publication nos. WO 98/49315 and WO 97/02358; hereby incorporated by reference. A number of genetic engineering strategies have been used with various PKSs to demonstrate that the structures of polyketides can be manipulated to produce novel polyketides (see the patent publications referenced supra and Hutchinson, 1998, Curr. Opin. Microbiol. 1:319-329, and Baltz, 1998, Trends Microbiol. 6:76-83; hereby incorporated by reference). In some embodiments, the components of the hybrid PKS are arranged onto polypeptides having interpolypeptide linkers that direct the assembly of the polypeptides into the functional PKS protein, such that it is not required that the PKS have the same arrangement of modules in the polypeptides as observed in natural PKSs. Suitable interpolypeptide linkers to join polypeptides and intrapolypeptide linkers to join modules within a polypeptide are described in PCT publication no. WO 00/47724, hereby incorporated by reference.
[0062]
[0063] In some embodiments of the invention, the even-chain diacid has the following chemical structure:
##STR00001##
[0064] wherein each R.sub.1 is independently H, OH, OCH.sub.3, CH.sub.2CH.sub.3, or CH.sub.3, each R.sub.2 is independently a carbonyl, H or OH, n is an integer, is (1) a single bond or (2) a double bond, with the proviso that when an is a double bond then the corresponding R.sub.2 is H and n indicates the number of two-carbon-chain subunits in the carbon backbone of the even-chain diacid. Within each molecule of the even-chain diacid, the R.sub.1, R.sub.2, and within each two-carbon-subunit can be independent of (and so can be identical to or different from) the R.sub.1, R.sub.2, and of every other two-carbon-subunit of the molecule. For example, chemical structure (I) encompasses (2E, 8E)-deca-2,8-dienedioic acid (using oxylate as a loading molecule):
##STR00002##
[0065] In some embodiments of the invention, n is an integer from 1 to 10. In some embodiments of the invention, the even-chain diacid is adipic acid (or hexanedioc acid), suberic acid (or octanedioc acid), or sebacic acid (or decanedioc acid). In some embodiments of the invention, the even-chain diacid is a symmetrical compound, such as a fully reduced symmetrical aliphatic compound.
[0066] Adipic acid is a six carbon chain fully reduced symmetrical aliphatic compound with no side chains, hence no chiral centers. Diacids of a (4+n)-configuration are synthesized from the NRPS-PKS system of the present invention, a four carbon succinate is extended by n extender acyl unit(s). For example, when a six-membered chain is synthesized from the NRPS-PKS system of the present invention, a four carbon succinate is extended by one extender acyl unit. For example, when a ten-membered chain is synthesized from the NRPS-PKS system of the present invention, a four carbon succinate is extended by two extender acyl units.
[0067] In some embodiments of the invention, the odd-chain diacid has the following chemical structure:
##STR00003##
wherein each R.sub.1 and R.sub.2 are independently H, OH, OCH.sub.3, CH.sub.2CH.sub.3, or CH.sub.3, each R.sub.3 is independently a carbonyl, H or OH, n is an integer from 0 to 10 and represents the addition of two carbons to the polyketide chain, is (1) a single bond or (2) a double bond, with the proviso that when an is a double bond then the corresponding R.sub.3 is H, and n indicates the number of two-carbon-chain subunits in the carbon backbone of the even-chain diacid. Within each the odd-chain diacids, the R.sub.1, R.sub.2, R.sub.3, and within each two-carbon-subunit can be independent of (and so can be identical to or different from) the R.sub.1, R.sub.2, R.sub.3, and of every other two-carbon-subunit of the molecule.
[0068] In some embodiments, the present invention provides methods for making the odd-chain diacid malonic acid.
[0069] In some embodiments, the present invention provides methods for making the odd-chain diacid pimelic acid.
[0070] Malonic acid has numerous industrial uses. Malonate esters of alkyl chains from 1-20 carbons are used, for example, in the production of cosmetics, perfumes and fragrances, barbiturates, agrochemicals, preservatives, flavoring agents, non-steroidal anti-inflammatory agents (NSAIDS), anti-depression drugs, sedatives, anesthetics, hypnotics, anticonvulsants, and paint binders. Malonic acid is also used in chicken feed as an osteoresorptive inhibitor, as an electrolyte additive for metal anodization, to produce electroactive polymers, to produce methylidene malonates and polymers thereof, and in complex mixtures such as Santosol DME-1. These complex mixtures can be use as fire retardants, UV protective films, hydrophilic polymers and films, hydrophobic polymers and films, binders, sealants, and anaerobic adhesives. Diesters of malonate also have numerous uses. For example, diethylmalonate is used in perfumes as well as in the synthesis of many compounds such as barbiturates, artificial flavorings, vitamin B1 and vitamin B6. Other diesters that can be produced in accordance with the methods of the invention include but are not limited to dimethyl malonate, dipropyl malonate, dibutyl malonate, and up to C20 alcohols esterified to malonate.
[0071] In some embodiments, the invention results in the production of a lactam. Such lactams can be comprised of C4-C16 of either even or odd chain length. Where the terms even and odd are used, they refer to the number of carbons in the backbone of the molecule.
[0072] By starting with the 4-carbon gamma amino butyric acid (GABA), as described below, even chain lactams C4 and higher, including but not limited to caprolactam and the C12 lactam used in engineering polymer Nylon 12, can be produced. By introducing a beta-alanine loading module, such as that from the fluvirucin pathway, biosynthetic pathways that produced odd chain lactams, such as that used in engineering polymer Nylon 11, can be generated.
[0073] In some embodiments of the invention, even chain lactams are biosynthesized by using a loading module derived from a glycine-specific NRPS module. More than a dozen such modules have been identified thus far in nature (see, e.g., Rausch, et al. Nucleic Acids Research, 2005, 33 (18):5799-5808). PKS/NRPS hybrids are common in nature and a number of these biosynthesis pathways have been shown to be amenable to engineering.
[0074] In some embodiments of the invention an alpha amino acid is incorporated by the PKS/NRPS hybrid system to yield a lactam possessing a pendent side chain. For example, if a phenylalanine loading module is used in a triketide system incorporating two malonyl-CoAs and catalyzing all three possible reductions with each extension, the output is a caprolactam derivative with a phenyl side chain. The same type of approach is used in accordance with the methods of the invention to produce derivatized lactams, the cognate open chain forms and diamines by appropriate selection of the NRPS loading module. With any of the described starters (loading modules), one also exploits the flexibility of PKS systems to generate derivatives with a great variety of different oxidative states and alkyl side chains. This flexibility applies not only to the systems starting with GABA, but those starting with any other amino acid.
[0075] In some embodiments of the invention the PKS or PKS/NRPS hybrid system produces the cognate amino acid to the described lactam. These acids can be accessed biologically by incorporating a thioesterase that releases the polyketide as a free acid or by chemical hydrolysis of the lactam ex vivo.
[0076] 6-Aminocaproic acid is the cognate amino acid to caprolactam. It is used to treat excessive postoperative bleeding, especially after procedures in which a great amount of bleeding is indicated. It is marketed under the trade name Amicar. It is produced by ring opening of caprolactam. A biological route for synthesis of 6-aminocaproic acid and, therefore, caprolactam, as provided by the invention, is advantageous.
[0077] In some embodiments of the invention the PKS or PKS/NRPS hybrid system produces a diamine. These compounds can be accessed biologically by incorporating a thioesterase and amino transferase that coordinately release and convert the final Acyl-ACP thioester to a terminal amine.
[0078] The present invention provides for a polyketide synthase (PKS) capable of synthesizing 7-keto-8-amino-pelargonic acid (KAPA). KAPA is an advance intermediate in biotin biosynthesis. Introducing an alternative route to KAPA circumvents a number of regulatory check points in the biosynthesis of biotin. Therefore, the addition of a novel KAPA biosynthesis pathway or KAPA itself, to biotin producing organism is a means to increasing production of this valuable chemical. The present invention provides for a recombinant nucleic acid that encodes a polyketide synthase (PKS) capable of synthesizing KAPA. The present invention provides for a host cell comprising any of the recombinant nucleic acid and/or PKS of the present invention, wherein when cultured under a suitable condition the host cell is capable of producing KAPA, and optionally biotin. The present invention provides a method of producing KAPA, and optionally biotin, comprising: providing a host cell of the present invention, and culturing said host cell in a suitable culture medium such that KAPA, and optionally biotin, is produced. The present invention provides for a composition comprising KAPA, and optionally biotin, isolated from a host cell from which KAPA, and optionally biotin, is produced, and trace residues and/or contaminants of the host cell.
[0079] 7-Keto-8-amino-pelargonic acid (KAPA) has the following structure:
##STR00004##
[0080] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an even-chain diacid and the PKS comprises two polypeptide modules, wherein the first module comprises an aspartate specific adenylation (A) domain, modified to load succinate instead of aspartate, from the non-ribosomal peptide synthetase (NRPS) pathway for calcium-dependent antibiotic (CDA) from Saccharopolyspora erythraea linked to a peptidylcarrier protein (PCP) domain and a second module comprising a PKS ketosynthase (KS) domain, wherein the PCP domain is capable of interacting with the KS domain. In some embodiments of the invention, the PCP domain is the PCP domain from the bleomycin pathway from Streptomyces verticillus. In some embodiments of the invention, the A domain is directly linked to the PCP domain. In some embodiments of the invention, the second module comprises the KS domain (derived from the bleomycin pathway) fused to nystatin module 5, wherein the even-chain diacid produced is adipic acid (see Example 1 and
[0081] In some embodiments of the invention ery TE is used to release free acids from our hybrid PKS. In other embodiments this role is fulfilled by the thioesterase MonCII from the monensin pathway in Streptomyces cinnamonensis, or that from the spirangein PKS.
[0082] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an even-chain diacid and the PKS comprises the loading domain of the chondrochloren PKS wherein the CoA ligase domain of the loading domain is replaced with a succinyl-CoA synthetase, such the loading domain loads succinate instead of butyrate. In some embodiments, the AT specificity of the extender domain can also be changed. Two examples are shown in
[0083] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an even-chain diacid and the PKS comprises a mutant non-ribosomal peptide synthetase (NRPS) domain mutated to incorporate succinate, instead of aspartate, is used. The mutant NRPS domain is produced by substituting the amino acid(s), including an Asp to Gln change at Asp235 (the conserved Asp235 residue of the substrate-binding pocket as defined in the gramicidin S synthase phenylalanine-activating domain as identified by Challis GL, Ravel J, & Townsend Calif. Chem Biol. 2000 March; 7(3):211-24) a key residue involved in the recognition of the alpha nitrogen in an aspartate-specific A domain.
[0084] In some embodiments of the invention, the invention comprises extending and reducing a polyketide with a pendant carboxylate group.
[0085] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an even-chain diacid and the PKS comprises a terminal module comprising Nystatin modules 5 or 15 or the like, which incorporate malonyl-CoA and fully reduce a corresponding -carbonyl group, and an Ery TE domain fused to the terminal module. (See
[0086] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an even-chain diacid and the PKS comprises an etnangien loading module which incorporates succinate using a trans-AT domain. The etnangien loading module is taught in Menche et al. (J. Am. Chem. Soc. (2008) 130: 14234-14243; hereby incorporated by reference).
[0087] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an even-chain diacid and the PKS comprises a module in which a terminal carbon is incorporated as a methyl group which is later oxidized by a cytochrome P450. There are examples of methyl to carboxylate conversions in several of the amphipatic PKS pathways, such as for nystatin.
[0088] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing an odd-chain diacid and the PKS comprises a mutant non-ribosomal peptide synthetase (NRPS) domain capable of loading succinic acid.
[0089] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing lactam and the PKS comprises a non-ribosomal peptide synthetase (NRPS) domain capable of loading glycine.
[0090] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing a diamine and the PKS comprises a non-ribosomal peptide synthetase (NRPS) domain capable of loading glycine.
[0091] In some embodiments of the invention, the polyketide synthase (PKS) is capable of synthesizing lactam and the PKS comprises a loading module capable of loading beta alanine.
[0092] In some embodiments of the invention, the polyketide synthase (PKS) comprises a NRPS loading module specific for the amino acid alanine coupled to three PKS modules possessing all three reducing domains with a thioesterase (TE) at the C-terminus, wherein the PKS is capable of synthesizing 7-keto-8-amino-pelargonic acid (KAPA) (see
Nucleic Acids Encoding the PKS
[0093] The present invention provides for a recombinant nucleic acid that encodes a polyketide synthase (PKS) of the present invention. The recombinant nucleic acid can be a double-stranded or single-stranded DNA, or RNA. The recombinant nucleic acid can encode an open reading frame (ORF) of the PKS of the present invention. The recombinant nucleic acid can also comprise promoter sequences for transcribing the ORF in a suitable host cell. The recombinant nucleic acid can also comprise sequences sufficient for having the recombinant nucleic acid stably replicate in a host cell. The recombinant nucleic acid can be replicon capable of stable maintenance in a host cell. In some embodiments, the replicon is stably integrated into a chromosome of the host cell. In some embodiments, the replicon is a plasmid. The present invention also provides for a vector or expression vector comprising a recombinant nucleic acid of the present invention. The present invention provides for a host cell comprising any of the recombinant nucleic acid and/or PKS of the present invention. In some embodiments, the host cell, when cultured under a suitable condition, is capable of producing the even-chain or odd-chain diacid, or lactam, or diamine.
[0094] The large number of polyketide pathways that have been elucidated provide many different options to produce diacids, lactams, and diamines as well as the large number of derivatives in accordance with the methods of the invention. While the products can be different in size and functionality, all employ the methods of the invention for biosynthesis. The interfaces between non-cognate enzyme partners can be determined for preparing the hybrid synthase. ACP-linker-KS and ACP-linker-TE regions from the proteins of interest are aligned to examine the least disruptive fusion point for the hybrid synthase. Genetic constructions will employ one of several standard sequence and ligation independent cloning method so as to eliminate the incorporation of genetic scarring.
[0095] It will be apparent to one of skill in the art that a variety of recombinant vectors can be utilized in the practice of aspects of the invention. As used herein, vector refers to polynucleotide elements that are used to introduce recombinant nucleic acid into cells for either expression or replication. Selection and use of such vehicles is routine in the art. An expression vector includes vectors capable of expressing DNAs that are operatively linked with regulatory sequences, such as promoter regions. Thus, an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, a phage, recombinant virus or other vector that, upon introduction into an appropriate host cell, results in expression of the cloned DNA. Appropriate expression vectors are well known to those of skill in the art and include those that are replicable in eukaryotic cells and/or prokaryotic cells and those that remain episomal or those that integrate into the host cell genome.
[0096] The vectors may be chosen to contain control sequences operably linked to the resulting coding sequences in a manner that expression of the coding sequences may be effected in an appropriate host. Suitable control sequences include those that function in eukaryotic and prokaryotic host cells. If the cloning vectors employed to obtain PKS genes encoding derived PKS lack control sequences for expression operably linked to the encoding nucleotide sequences, the nucleotide sequences are inserted into appropriate expression vectors. This can be done individually, or using a pool of isolated encoding nucleotide sequences, which can be inserted into host vectors, the resulting vectors transformed or transfected into host cells, and the resulting cells plated out into individual colonies. Suitable control sequences for single cell cultures of various types of organisms are well known in the art. Control systems for expression in suitable host cells, such as yeast and prokaryotic host cells, are widely available and are routinely used. Control elements include promoters, optionally containing operator sequences, and other elements depending on the nature of the host, such as ribosome binding sites. Particularly useful promoters for prokaryotic hosts include those from PKS gene clusters that result in the production of polyketides as secondary metabolites, including those from Type I or aromatic (Type II) PKS gene clusters. Examples are act promoters, tcm promoters, spiramycin promoters, and the like. However, other bacterial promoters, such as those derived from sugar metabolizing enzymes, such as galactose, lactose (lac) and maltose, are also useful. Additional examples include promoters derived from biosynthetic enzymes such as for tryptophan (trp), the -lactamase (bla), bacteriophage lambda PL, and T5. In addition, synthetic promoters, such as the tac promoter (U.S. Pat. No. 4,551,433; hereby incorporated by reference), can be used.
[0097] As noted, particularly useful control sequences are those which themselves, or with suitable regulatory systems, activate expression during transition from growth to stationary phase in the vegetative mycelium. Illustrative control sequences, vectors, and host cells of these types include the modified S. coelicolor CH999 and vectors described in PCT publication no. WO 96/40968 and similar strains of S. lividans. See U.S. Pat. Nos. 5,672,491; 5,830,750; 5,843,718; and 6,177,262, each of which is hereby incorporated by reference. Other regulatory sequences may also be desirable which allow for regulation of expression of the PKS sequences relative to the growth of the host cell. Regulatory sequences are known to those of skill in the art, and examples include those which cause the expression of a gene to be turned on or off in response to a chemical or physical stimulus, including the presence of a regulatory compound. Other types of regulatory elements may also be present in the vector, for example, enhancer sequences.
[0098] Selectable markers can also be included in the recombinant expression vectors. A variety of markers are known which are useful in selecting for transformed cell lines and generally comprise a gene whose expression confers a selectable phenotype on transformed cells when the cells are grown in an appropriate selective medium. Such markers include, for example, genes that confer antibiotic resistance or sensitivity to the plasmid.
[0099] The various PKS nucleotide sequences, or a mixture of such sequences, can be cloned into one or more recombinant vectors as individual cassettes, with separate control elements or under the control of a single promoter. The PKS subunits or components can include flanking restriction sites to allow for the easy deletion and insertion of other PKS subunits. The design of such restriction sites is known to those of skill in the art and can be accomplished using the techniques described above, such as site-directed mutagenesis and PCR. Methods for introducing the recombinant vectors of the present invention into suitable hosts are known to those of skill in the art and typically include the use of CaCl.sub.2) or other agents, such as divalent cations, lipofection, DMSO, protoplast transformation, conjugation, and electroporation.
Host Cells Comprising the PKS
[0100] The present invention provides for a host cell comprising any of the recombinant nucleic acid and/or PKS of the present invention. In some embodiments, the host cell, when cultured, is capable of producing an even-chain or odd-chain diacid, or lactam, or diamine. The host cell can be a eukaryotic or a prokaryotic cell. Suitable eukaryotic cells include yeast cells, such as from the genus Saccharomyces or Schizosaccharomyces. A suitable species from the genus Saccharomyces is Saccharomyces cerevisiae. A suitable species from the genus Schizosaccharomyces is Schizosaccharomyces pombe. Suitable prokaryotic cells include Escherichia coli, Bacillus or Streptomyces species.
[0101] The PKS can be in a host cell, or isolated or purified. The PKS can synthesize the even-chain or odd-chain diacid, or lactam, or diamine in vivo (in a host cell) or in vitro (in a cell extract or where all necessary chemical components or starting materials are provided). The present invention provides methods of producing the even-chain or odd-chain diacid, or lactam, or diamine using any of these in vivo or in vitro means.
[0102] In some embodiments of the invention, the host cell comprises a PKS of the present invention capable of producing pimelic acid, and further comprises the enzymes pimelyl-CoA synthetase, 8-amino-7-oxononanoate synthase, 7,8-diamino-pelargonic acid (DAPA) synthase, dethiobiotin synthase, and biotin synthase, and/or one or more nucleic acids encoding pimelyl-CoA synthetase, 8-amino-7-oxononanoate synthase, DAPA synthase, dethiobiotin synthase, and biotin synthase, or functional variants thereof. When the host cell is cultured under a suitable condition, the host cell is capable of expressing or producing pimelyl-CoA synthetase, 8-amino-7-oxononanoate synthase, DAPA synthase, dethiobiotin synthase, and biotin synthase, or functional variants thereof, which in turn are capable of converting pimelic acid into biotin (or Vitamin H).
[0103] In some embodiments of the invention, the host cell comprises a PKS of the present invention capable of producing KAPA, and further comprises the enzymes 7,8-diamino-pelargonic acid (DAPA) synthase, dethiobiotin synthase, and biotin synthase, or functional variants thereof, and/or one or more nucleic acids encoding DAPA synthase, dethiobiotin synthase, and biotin synthase, or functional variants thereof. When the host cell is cultured under a suitable condition, the host cell is capable of expressing or producing DAPA synthase, dethiobiotin synthase, and biotin synthase, or functional variants thereof, which in turn are capable of converting KAPA into biotin (or Vitamin H).
[0104] Examples of suitable pimelyl-CoA synthetase are the gene products encoded by the bioW genes of Bacillus subtilus, and Bacillus sphearicus. An illustrative amino acid sequence, of B. subtilus pimelyl-CoA synthetase (GenBank Accession: AAC00261), comprises:
TABLE-US-00002 (SEQIDNO:1) 1 mngshedggkhisggerlipfhemkhtvnallekglshsrgkpdfmqiqfeevhesikti 61 qplpvhtnevscpeegqklarlllekegvsrdviekayeqipewsdvrgavlfdihtgkr 121 mdqtkekgvrvsrmdwpdanfekwalhshvpahsrikealalaskvsrhpavvaelcwsd 181 dpdyitgyvagkkmgyqritamkeygteegcrvffidgsndvntyihdlekqpiliewee 241 dhds
[0105] Examples of suitable 8-amino-7-oxononanoate synthase are the gene products encoded by the bioF genes of E. coli, B. subtilus, and B. sphearicus. An illustrative amino acid sequence, of E. coli 8-amino-7-oxononanoate synthase (GenBank Accession No.: AP_001407), comprises:
TABLE-US-00003 (SEQIDNO:2) 1 mswqekinaaldarraadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiir 61 awqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamm 121 akedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsm 181 dgdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgv 241 sgaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalit 301 rfragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtairpptvpagtarl 361 rltltaahemqdidrllevlhgng
[0106] Examples of suitable DAPA synthases are B103 of S. cerevisae, and the gene product encoded by the bioA genes of E. coli, B. subtilus, and B. sphearicus. An illustrative amino acid sequence, of E. coli DAPA synthase (GenBank Accession No.: AP 001405), comprises:
TABLE-US-00004 (SEQIDNO:3) 1 mttddlafdqrhiwhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn 61 hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam 121 kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs 181 rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi 241 lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge 301 agcfmhgptfmgnplacaaanaslailesgdwqqqvadievglreglapardaemvadvr 361 vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra 421 vgdetffcq
[0107] Examples of suitable dethiobiotin synthases are B104 of S. cerevisae, and the gene product encoded by the bioD genes of E. coli, B. subtilus, and B. sphearicus. An illustrative amino acid sequence, of E. coli dethiobiotin synthase (GenBank Accession No.: CAA00967), comprises:
TABLE-US-00005 (SEQIDNO:4) 1 mskryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalq 61 rnsslq1dyatvnpytfaeptsphiisaqegrpieslvmsaglralehkadwvlvegagg 121 wftplsdtftfadwvtgeqlpvilvvgvklgcinhamltaqvighaglt1agwvandvtp 181 pgkrhaeymttltrmipapllgeipwlaenpenaatgkyiflail
[0108] Examples of suitable biotin synthases are B102 of S. cerevisae, and the gene product encoded by the bioB genes of E. coli, B. subtilus, and B. sphearicus. An illustrative amino acid sequence, of E. coli biotin synthase (GenBank Accession No.: AP_001406), comprises:
TABLE-US-00006 (SEQIDNO:5) 1 mahrprwtlsqvtelfekplldllfeaqqvhrqhfdprqvqvstllsiktgacpedckyc 61 pqssryktgleaerlmeveqvlesarkakaagstrfcmgaawknpherdmpylegmvqgv 121 kamgleacmtlgtlsesqaqrlanagldyynhnldtspefygniittrtyqerldtlekv 181 rdagikvcsggivglgetvkdrag111q1anlptppesvpinmlvkvkgtpladnddvda 241 fdfirtiavarimmptsyvrlsagreqmneqtqamcfmagansifygckllttpnpeedk 301 dlqlfrklglnpqqtavlagdneqqqrleqalmtpdtdeyynaaal
Methods of Using the PKS
[0109] The present invention provides a method of producing an even-chain or odd-chain diacid, or lactam, or diamine comprising: providing a host cell of the present invention, and culturing said host cell in a suitable culture medium such that the even-chain or odd-chain diacid, or lactam, or diamine is produced. The method can further comprise isolating said even-chain or odd-chain diacid, or lactam, or diamine from the host cell and the culture medium. The method can further comprise reacting the even-chain or odd-chain diacid with a diamine to produce a nylon. The method can also comprise the polymerization of the lactams, or cognate amino acids. A suitable diamine is an alkane diamine, such as hexane-1,6-diamine. Alternatively, the method can further comprise reacting the even-chain or odd-chain diacid with a dialcohol to produce a polyester. A suitable dialcohol is an alkane diol, such as ethylene glycol, propane diol, or butanediol. A variety of methods for heterologous expression of PKS genes and host cells suitable for expression of these genes and production of polyketides are described, for example, in U.S. Pat. Nos. 5,843,718; 5,830,750 and 6,262,340; WO 01/31035, WO 01/27306, and WO 02/068613; and U.S. Patent Application Pub. Nos. 20020192767 and 20020045220; hereby incorporated by reference.
[0110] The present invention provides for a composition comprising an even-chain or odd-chain diacid, or lactam, or diamine isolated from a host cell from which the even-chain or odd-chain diacid, or lactam, or diamine is produced, and trace residues and/or contaminants of the host cell. Such trace residues and/or contaminants include cellular material produced by the lysis of the host cell.
[0111] The even-chain diacids, such as adipic acid, or odd-chain diacids, or lactam, or diamine, provide for the production of green nylon, such as that used in Mohawk carpet fibers. Besides nylon production, the ability to manipulate the side chains of the even-chain or odd-chain diacids, or lactams, or diamines provides for the production of novel polymer precursors that would lead to polymers with a variety of properties. These products may also serve as adhesive, lubricants or precursors for pharmaceuticals or other more complicated compounds.
Producing Biotin
[0112] The present invention provides for a method of producing biotin, comprising: providing a host cell comprising one or more nucleic acids encoding and capable of expressing or producing a PKS capable of producing pimelic acid, and pimelyl-CoA synthetase, 8-amino-7-oxononanoate synthase, DAPA synthase, dethiobiotin synthase, and biotin synthase, and culturing said host cell in a suitable culture medium such that biotin is produced. A variety of methods for heterologous expression of these genes and host cells suitable for expression of these genes and production of polyketides are described herein. A hybrid PKS capable of producing pimelic acid is taught in U.S. Patent Application Ser. No. 61/040,583, PCT International Patent Application PCT/US2009/038831, and U.S. patent application Ser. No. 12/922,204, which are incorporated by reference.
[0113] The present invention provides for a method of producing biotin, comprising: providing a host cell comprising one or more nucleic acids encoding and capable of expressing or producing a PKS capable of producing KAPA, and DAPA synthase, dethiobiotin synthase, and biotin synthase, and culturing said host cell in a suitable culture medium such that biotin is produced. A variety of methods for heterologous expression of these genes and host cells suitable for expression of these genes and production of polyketides are described herein.
[0114] The method can further comprise isolating said biotin from the host cell and the culture medium. The method can further comprise administering the isolated biotin to a human or animal in need of or suspected to be in need of biotin. In some embodiments, the administering comprises the human or animal orally ingesting the biotin.
[0115] The present invention provides for a composition comprising biotin isolated from a host cell from which the biotin is produced, and trace residues and/or contaminants of the host cell. Such trace residues and/or contaminants include cellular material produced by the lysis of the host cell. The biotin isolated is useful for nutritional purposes. The type and amount of the trace residues and/or contaminants isolated with the biotin is not harmful to the health of a human or animal orally ingesting the biotin.
[0116] The present invention has one or more of the following advantages: (1) it reduces the dependence on oil for producing certain chemicals, and (2) it serves as a means of capture and sequestration of carbon from the atmosphere.
[0117] The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.
[0118] In the examples below, reference is made to either DNA or protein sequence present in the NCBI data that is used to produce the enzymes required to make the products described. It is understood that the protein sequences can be back-translated to produce DNA segments of preferred codon usage, or that the DNA sequences present in databases can be used directly or changed to correspond to the same protein sequence with preferred codon usage.
Example 1
Production of Adipic Acid Using a Mutated NRPS a Domain
[0119] The production of adipic acid is achieved by coupling an aspartate specific A domain from the non-ribosomal peptide synthetase (NRPS) pathway for calcium-dependent antibiotic (CDA) from Saccharopolyspora erythraea to a peptidylcarrier protein (PCP) domain from bleomycin pathway from Streptomyces verticillus. This PCP is chosen because it natively interacts with a PKS ketosynthase (KS) domain. The chimeric protein is designated AAS1 (adipic acid synthase ORF 1). As a second ORF (aas2), this KS domain (bleomycin PKS) is fused to nystatin module 5 which was previously fused to the thioesterase (TE) domain from the erythromycin pathway. The two enzymes and their catalytic domains are illustrated in
TABLE-US-00007 TABLE 2 Samples labeled UI are uninduced, those labeled are induced cultures. I9 was lost. UI6 carries an Asp to Gln mutation at Asp235. Sample name Area uM mg/L UI 1 0 0 0 UI 2 0 0 0 UI 3 0 0 0 UI 4 0 0 0 UI 5 0 0 0 UI 6 42,671 1.56 0.23 UI 7 0 0 0 UI 8 0 0 0 UI 9 0 0 0 UI 10 0 0 0 UI 11 0 0 0 UI 12 0 0 0 UI 13 0 0 0 UI 14 0 0 0 UI 15 0 0 0 UI 16 0 0 0 UI 17 0 0 0 UI 18 0 0 0 UI 19 0 0 0 UI 20 0 0 0 I 1 0 0 0 I 2 0 0 0 I 3 0 0 0 I 4 0 0 0 I 5 0 0 0 I 6 0 0 0 I 7 0 0 0 I 8 0 0 0 I 9 0 0 0 I 10 0 0 0 I 11 0 0 0 I 12 0 0 0 I 13 0 0 0 I 14 0 0 0 I 15 0 0 0 I 16 0 0 0 I 17 0 0 0 I 18 0 0 0 I 19 0 0 0 I 20 0 0 0
Example 2
Production of Even-Chain Diacids Using the Spirofungin Biosynthesis Genes
[0120] Spirofungin A (
[0121] Sequencing of the corresponding genes involved in the biosynthesis of the two compounds indicated that the polyketide is produced with a 27-carbon backbone by a type I polyketide synthase and then subsequently released and processed into the 24-carbon atom backbone containing an acid group at each end. Through analysis and comparison of the sequences of the genes flanking the PKS in both organisms, we have identified the pathway for the production of that converts the final acyl-ACP intermediate of spirofungin in module 12 of the spirofungin PKS to spirofungin A (
[0122] The PKS consists of 12 modules and determines the biosynthesis of an acyl intermediate with 27 carbons in its chain. As shown in
[0123] It is possible that the spiroketal sub-structure is formed before the acyl end is converted to the acidic group, either while the acyl chain is tethered to the ACP of module 12, or immediately after it is released by the thioesterase (and opened from its macrolactam structure by the esterase (SpiN). The acid group is then formed by the action of SpiE, SpiH, and SpiF as described above. Similarly, the acid group at C24 of reveromycin is formed by the action of similar enzymes EST (RevN), ADH (RevE), FMO (RevH), and ALDH (RevF).
[0124] An approach to produce adipic acid is shown in
Example 3
Production of Even-Chain Diacids Using the Succinyl CoA Ligase
[0125] Succinyl CoA Ligase. The recent publication of the chondrochloren biosynthesis cluster shows a loading domain that consists of a CoA ligase and ACP domain (Rachid et al., Unusual chemistry in the biosynthesis of the antibiotic chondrochlorens, Biology & Chemistry 16:70-81, 2009; hereby incorporated by reference). The native system loads a four-carbon butyrate, extends with methylmalonate and fully reduces the -carbonyl (
[0126] Replacement of the CoA ligase domain with a succinyl-CoA synthetase allows the loading of succinate. There are a number of succinyl-CoA ligases. All appear to function as heterodimers or 22 tetramers. They all carry the 5 conserved domains illustrated in
[0127] This combined with the addition of the TE domain would facilitate the production of 2-methyl-hexanedioic acid (
Example 4
Production of Even-Chain Diacids Using the Etnangien Loading Module
[0128] Etnangien is a macrolide-polyene antibiotic produced from Sorangium cellulosum that is composed of a macrocylic ring and a long polyketide chain that terminates with a carboxylate group. The beginning steps of the biosynthesis of the etnangien is shown in
[0129] This acyl-intermediate is used for the next round of polyketide synthesis to yield compound c (
[0130] Production of Adipic AcidTwo strategies are used to produce adipic acid employing components of the etnangien PKS. In the first, (
[0131] In a second embodiment employing the etnangien PKS components, a chimeric PKS is constructed as a single ORF employing, as shown in
Example 5
Employing an AMP-Ligase-PCP Didomain as the Loading Module
[0132] The scheme for production of adipic acid employing an AMP ligase-PCP didomain to load succinic acid directly to the PKS is shown in
Example 6
Production of Malonic Acid Using PKS
[0133] As shown in
[0134] Numerous PKS load modules contain the cognate mAT-ACP didomains. Examples include, but are not limited to, the AT-ACP didomain from the load module from the chalcomycin PKS from Streptomyces bikiniensis (NCBI Accession No. AY509120), the niddamycin PKS from Streptomyces caelestis (NCBI Accession No. AF016585), the oligomycin PKS from Streptomyces avermitilis (NCBI Accession No. NC 003155), and the epothilone PKS from Sorangium cellulosum (NCBI Accession No. AF217189). Numerous PKSs also each contain a TE domain, any of which can be used in the assembly of the chimeric PKS herein. Examples include, but are not limited to, the TE domain from the niddamycin PKS from Streptomyces caelestis (NCBI Accession No. AF016585), the oligomycin PKS from Streptomyces avermitilis (NCBI Accession No. NC 003155), the epothilone PKS from Sorangium cellulosum (NCBI Accession No. AF217189), the pikromycin PKS from Streptomyces venezuelae (NCBI Accession No. BD232534.1), and the erythromycin PKS from Saccharopolyspora erythraea (NCBI Accession No. M63677.1). The mAT-ACP didomain or the TE domain can be cloned from the corresponding host organism or synthesized de novo employing the preferred codon usage for the ultimate malonic acid production host. The sequences separating the TE domain from its adjacent ACP domain in numerous PKSs is well understood, hence it is possible to synthesize de novo, or assemble from disparate sources, the complete mAT-ACP-TE chimeric module.
Example 7
Production of Malonic Acid Using PKS+TEII
[0135] In this embodiment, the PKS module consists of a mAT-ACP didomain that loads malonyl-CoA and a separate type II thioesterase (TEII) that is specific for removing the CoASH moiety from short chain acyl-CoA thioesters to produce short chain acids (
[0136] Examples of TEII enzymes include TEII proteins from genes involved in the biosynthesis of known polyketides, including, but not limited to, EryH from Saccharopolyspora erythraea (NCBI Accession No. M54983.1), MegH from Micromonospora megalomiceae (NCBI Accession No. AF2623245.1), GrsT from Streptomyces bikiniensis (NCBI Accession No. AY509120.1), or MonCII from Streptomyces cinnamonensis (NCBI Accession No. AF440781.1), from gene clusters involved in the biosynthesis of erythromycin, megalomicin, chalcomycin, and monensin, respectively. Other examples of TEII enzymes include the family of TesB-like enzymes from a variety of Gram-negative bacteria including, but not limited to, Escherichia coli (NCBI Accession No. ZP_003256460.1), Shigella flexneri (NCBI Accession No. NP 706346.2), Salmonella enterica (NCBI Accession No. ZP_02656512.1), or Klebsiella pneumonia (NCBI Accession No. ZP_06015648.1), or Gram positive bacteria including, but not limited to, Brucella abortus (NCBI Accession No. YP222547.1), Agrobacterium tumefaciens (NCBI Accession No. EGP58265.1), Brevibacterium linens (NCBI Accession No. ZP05914544.1), or Micrococcus luteus (NCBI Accession No. YP0029570745.1). The corresponding genes can be cloned from their native hosts or synthesized de novo employing preferred codon usage to enhance expression in the organism chosen for malonic acid production.
[0137] In this embodiment, the mAT-ACP didomain and TEII would be expressed as separate proteins either as part of an operon driven from a single promoter, or driven from separate promoters from either a single plasmid, two plasmids, a plasmid and the chromosome or from the chromosome exclusively. To enhance the overall rate of release of malonyl-CoA from the mAT-ACP didomain, genes for two or more TEII enzymes can be co-expressed in the host expressing the gene for the mAT-ACP didomain.
Example 8
Production of Malonic Acid Using Trans-AT PKS
[0138] In another embodiment of this invention, the malonate producing PKS utilizes a trans AT PKS system (
Example 9
Production of Caprolactam Using a PKS
[0139] Biosynthesis of caprolactam requires the synthesis of an amino-containing molecule that can start the biosynthesis of a polyketide chain on a PKS system. In the embodiment shown in
[0140] Load ACP and KS1 domains are on separate proteins in the native system. The PKS shown in
Example 10
Production of the GABA Starter Unit
[0141] Butirosin is an aminoglycoside antibiotic that contains a 2-hydroxy-4-aminobutyric (HABA) side chain attached to the N1 of the central sugar, 2-deoxystreptamine. The pathway for synthesis of HABA is shown in
[0142] BtrI, BtrJ, and BtrK from Bacillus circulans (NCBI Accession Nos. BAE 07073, BAE07074, and BAE07075, respectively), is synthesized de novo employing the preferred codon usage for the host of choice. BtrI is altered to create BtrI* to contain the docking domain to allow it to interact with the KS domain of the PKS shown in
Example 11
Production of Caprolactam Using a PKS
[0143] A scheme for the biosynthesis of caprolactam is shown in
Example 12
Production of 6-Aminocaproic Acid Using a PKS
[0144] Three schemes for the biosynthesis pathway of 6-aminocaproic acid are shown in
Example 13
Production of 1,6-Hexanediamine Using a PKS
[0145] Three schemes for the biosynthesis pathway of hexane-1,4-diamine are shown in
[0146] These approaches should yield the expected even-chain diacid. The PKS genes described herein, or the hosts that carry them, are available from the American Type Culture Collection (ATCC) depository.
[0147] While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.