GLUCOAMYLASE BLENDS
20200270660 ยท 2020-08-27
Assignee
Inventors
Cpc classification
Y02E50/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12P7/08
CHEMISTRY; METALLURGY
C12Y302/01003
CHEMISTRY; METALLURGY
C12P19/14
CHEMISTRY; METALLURGY
International classification
C12P7/08
CHEMISTRY; METALLURGY
C12P19/14
CHEMISTRY; METALLURGY
Abstract
Methods are provided for saccharifying a starch substrate, comprising contacting the starch substrate with a glucoamylase consisting or comprising of the amino acid sequence of Fusarium verticillioides glucoamylase (Fv-GA) and further contacting the starch substrate with at least one additional glucoamylase. Additional methods are provided for saccharifying and fermenting a starch substrate to produce an end product, a biochemical end product and a fermentable beverage using a combination of Fv-GA and at least one additional glucoamylase.
Claims
1. A method for saccharifying a starch substrate, comprising contacting the starch substrate with a glucoamylase consisting of the sequence of Fv-GA (SEQ ID NO: 1), having at least 85% identity to the sequence of Fv-GA (SEQ ID NO: 1), having at least 85% identity to a catalytic domain of Fv-GA (SEQ ID NO: 1), having at least 85% identity to a linker and a catalytic domain of Fv-GA (SEQ ID NO: 1) or having at least 85% identity to an active fragment of Fv-GA (SEQ ID NO: 1) having glucoamylase activity, and contacting the starch substrate with at least one additional glucoamylase.
2. The method of claim 1, wherein the additional glucoamylase comprises Afu-GA (SEQ ID NO: 3) or An-GA (SEQ ID NO: 7).
3. The method of claim 1, wherein the additional glucoamylase is Afu-GA (SEQ ID NO: 3) or a glucoamylase having at least 85% identity to SEQ ID NO: 3.
4. The method of claim 1, wherein the additional glucoamylase is An-GA (SEQ ID NO: 7) or a glucoamylase having at least 85% identity to SEQ ID NO: 7.
5. The method of claim 1, wherein saccharifying the starch substrate results in a high glucose syrup.
6. The method of of claim 1, wherein the high glucose syrup comprises an amount of glucose selected from the list consisting of at least 95.5% glucose, at least 95.6% glucose, at least 95.7% glucose, at least 95.8% glucose, at least 95.9% glucose, at least 96% glucose, at least 96.1% glucose, at least 96.2% glucose, at least 96.3% glucose, at least 96.4% glucose, at least 96.5% glucose and at least 97% glucose.
7. The method of claim 1, further comprising fermenting the high glucose syrup to an end product.
8. The method of claim 7, wherein saccharifying and fermenting are carried out as a simultaneous saccharification and fermentation (SSF) process.
9. The method of claim 7, wherein the end product is alcohol.
10. The method of claim 9, wherein the end product is ethanol.
11. The method of claim 1, wherein the starch substrate is about, 5% to 99%, 15% to 50% or 40-99% dry solid (DS).
12. The method of claim 1, wherein each glucoamylase is dosed at a range of about 0.01 to about 10 glucoamylase unit (GAU) per gram of dry solid starch (dss).
13. The method of claim 1, wherein the starch substrate is selected from wheat, barley, corn, rye, rice, sorghum, bran, cassava, milo, millet, potato, sweet potato, tapioca, and any combination thereof.
14. The method of claim 1, wherein the starch substrate comprises liquefied starch, gelatinized starch, or granular starch.
15. The method of claim 1, further comprising adding a hexokinase, a xylanase, a glucose isomerase, a xylose isomerase, a phosphatase, a phytase, a pullulanase, a amylase, an -amylase, a protease, a cellulase, a hemicellulase, a lipase, a cutinase, a trehalase, an isoamylase, a redox enzyme, an esterase, a transferase, a pectinase, a hydrolase, an alpha-glucosidase, an beta-glucosidase, or a combination thereof to the starch substrate.
16. The method of claim 15, wherein a pullulanase is further added.
17-23. (canceled)
24. A method for saccharifying and fermenting a starch substrate to produce a biochemical end product, comprising contacting the starch substrate with a glucoamylase having at least 85% identity to Fv-GA (SEQ ID NO: 1), and with a glucoamylase having at least 85% identity to Hg-GA (SEQ ID NO: 5), under conditions suitable for biochemical fermentation
25. The method of claim 24, wherein the end product is a biochemical selected from the group consisting of an amino acid, an organic acid, citric acid, lactic acid, succinic acid, monosodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, glucono delta-lactone, sodium erythorbate, omega 3 fatty acid, butanol, lysine, itaconic acid, 1,3-propanediol, biodiesel, and isoprene.
26. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
DETAILED DESCRIPTION
[0045] The invention will now be described in detail by way of reference only using the following definitions and examples. All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.
[0046] Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., D
[0047] The headings provided herein are not limitations of the various aspects or embodiments of the invention which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.
[0048] All publications cited herein are expressly incorporated herein by reference for the purpose of describing and disclosing compositions and methodologies which might be used in connection with the invention.
I. Definitions
[0049] The term amino acid sequence is synonymous with the terms polypeptide, protein, and peptide, and are used interchangeably. Where such amino acid sequences exhibit activity, they may be referred to as an enzyme. The conventional one-letter or three-letter codes for amino acid residues are used, with amino acid sequences being presented in the standard amino-to-carboxy terminal orientation (i.e., N.fwdarw.C).
[0050] The term nucleic acid encompasses DNA, RNA, heteroduplexes, and synthetic molecules capable of encoding a polypeptide. Nucleic acids may be single stranded or double stranded, and may have chemical modifications. The terms nucleic acid and polynucleotide are used interchangeably. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the present compositions and methods encompass nucleotide sequences that encode a particular amino acid sequence. As such, the present invention contemplates every possible variant nucleotide sequence encoding GA or an amino acid variant thereof, all of which are possible given the degeneracy of the genetic code. Unless otherwise indicated, nucleic acid sequences are presented in 5-to-3 orientation.
[0051] Nucleic acid and amino acid sequences that are referred to herein as non-naturally occurring are those that are not found in nature, i.e., are the product of human manipulation and/or synthesis.
[0052] Glucoamylase or GA or GA enzyme or GA polypeptide, as used herein is defined as the amyloglucosidase class of enzymes (EC 3.2.1.3, glucoamylase, -1, 4-D-glucan glucohydrolase). These are exo-acting enzymes that catalyze the release of D-glucose from the non-reducing ends of starch and related oligo- and polysaccharides. The enzymes are also capable of hydrolyzing -1, 6 and -1,3 linkages, although generally at much slower rates than the hydrolysis of -1, 4 linkages.
[0053] A variant of an enzyme, protein, polypeptide, nucleic acid, or polynucleotide as used herein means that the variant is derived from a parent polypeptide or parent nucleic acid (e.g., native, wild-type or other defined parent polypeptide or nucleic acid) that includes at least one modification or alteration as compared to that parent. Thus, a variant may have a few mutations as compared to a parent, where by a few is meant from 1 to 10 mutations. For example, a variant having from 1 to 10 amino acid substitutions as compared to SEQ ID NO:1 can be referred to as a Fv-GA variant having a few substitutions. Alterations/modifications can include a substitution of an amino acid/nucleic acid residue in the parent for a different amino acid/nucleic acid residue at one or more sites, deletion of an amino acid/nucleic acid residue (or a series of amino acid/nucleic acid residues) in the parent at one or more sites, insertion of an amino acid/nucleic acid residue (or a series of amino acid/nucleic acid residues) in the parent at one or more sites, truncation of amino- and/or carboxy-terminal amino acid sequences or 5 and or 3 nucleic acid sequences, and any combination thereof. A variant Fv-GA enzyme according to aspects of the invention retains starch hydrolysis activity but may have an altered property in some specific aspect, e.g., an improved property. For example, a variant Fv-GA enzyme may have an altered pH optimum, improved thermostability, improved hydrolysis of one or more substrates (e.g., DP1 (e.g., glucose), DP3 (e.g., maltotriose, panose), DP4 (e.g., maltotetraose), and/or pullulan) or a combination thereof. In certain embodiments, the variant Fv-GA enzyme contains an amino acid sequence that is at least 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:1, or an enzymatically active fragment thereof.
[0054] Likewise, variant An-GA, variant Afu-GA, variant Hg-GA, variants of Tr-GA variant CS4 and variants of Tr-GA are envisioned having at least 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the respective SEQ ID NOs, or an enzymatically active fragment thereof.
[0055] Combinatorial variants are variants comprising two or more mutations, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more, substitutions, deletions, and/or insertions.
[0056] A parent or parental polynucleotide, polypeptide, or enzyme sequence (e.g., a parent Fv-GA enzyme), or equivalents thereto, as used herein refers to a polynucleotide, polypeptide, or enzyme sequence that was used as a starting point or template for designing a variant polynucleotide, polypeptide, or enzyme. It is further noted that the words parent and parental are used interchangeably in this context. A parent Fv-GA enzyme as used herein means a polypeptide that in its mature form comprises an amino acid sequence which has at least 60% identity with SEQ ID NO:4, including amino acid sequences having at least 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity with SEQ ID NO:1 (which provides the amino acid sequence of the mature form of wild type GA from Fusarium verticillioides) or an allelic variant or a fragment thereof that has starch hydrolysis activity.
[0057] The term wild-type refers to a naturally-occurring polypeptide or nucleic acid sequence, i.e., one that does not include a human-made variation.
[0058] The term heterologous when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not normally found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences, e.g., from unrelated genes, arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source. Similarly, a heterologous polypeptide will often refer to two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion polypeptide).
[0059] The term recombinant when used with reference, e.g., to a cell, or nucleic acid, polypeptide, or vector, indicates that the cell, nucleic acid, polypeptide or vector, has been modified by the introduction of a heterologous nucleic acid or polypeptide or the alteration of a native nucleic acid or polypeptide, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under-expressed or not expressed at all. A recombinant composition requires manipulation by a human and therefore excludes products of nature.
[0060] The terms isolated or purified as used herein refer to a nucleic acid or polynucleotide that is removed from the environment in which it is naturally produced. In general, in an isolated or purified nucleic acid or polypeptide sample, the nucleic acid(s) or polypeptide(s) of interest are present at an increased absolute or relative concentration as compared to the environment in which they are naturally produced. In some instances, an isolated or purified nucleic acid or polynucleotide is synthetically generated.
[0061] The term enriched when describing a component or material in a composition (e.g., a polypeptide or polynucleotide) means that the component or material is present at a relatively increased concentration in that composition as compared to the starting composition from which the enriched composition was generated. For example, an enriched GA composition (or sample) is one in which the relative or absolute concentration of GA is increased as compared to the initial fermentation product from the host organism.
[0062] As used herein, the terms promoter refers to a nucleic acid sequence that functions to direct transcription of a downstream gene. The promoter will generally be appropriate to the host cell in which the target gene is being expressed. The promoter, together with other transcriptional and translational regulatory nucleic acid sequences (also termed control sequences), is necessary to express a given gene. In general, the transcriptional and translational regulatory sequences include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences. A constitutive promoter is a promoter that is active under most environmental and developmental conditions. An inducible promoter is a promoter that is active under environmental or developmental regulation. An example of an inducible promoter useful in the present invention is the T. reesei (H. jecorina) cbh1 promoter which is deposited in GenBank under Accession Number D86235. In another aspect the promoter is a cbh II or xylanase promoter from H. jecorina. Examples of suitable promoters include the promoter from the A. awamori or A. niger glucoamylase genes (Nunberg, J. H. et al. (1984) Mol. Cell. Biol. 4, 2306-2315; Boel, E. et al. (1984) EMBO J. 3, 1581-1585), the Mucor miehei carboxyl protease gene, the Hypocrea jecorina glucoamylase I gene (Shoemaker, S. P. et al. (1984) European Patent Application No. EP00137280A1), the A. nidulans trpC gene (Yelton, M. et al. (1984) Proc. Natl. Acad. Sci. USA 81, 1470-1474; Mullaney, E. J. et al. (1985) Mol. Gen. Genet. 199, 37-45) the A. nidulans alcA gene (Lockington, R. A. et al. (1986) Gene 33, 137-149), the A. nidulans tpiA gene (McKnight, G. L. et al. (1986) Cell 46, 143-147), the A. nidulans amdS gene (Hynes, M. J. et al. (1983) Mol. Cell Biol. 3, 1430-1439), the H. jecorina xlnl gene, the H. jecorina cbh2 gene, the H. jecorina eg1 gene, the H. jecorina eg2 gene, the H. jecorina eg3 gene, and higher eukaryotic promoters such as the SV40 early promoter (Barclay, S. L. and E. Meller (1983) Molecular and Cellular Biology 3, 2117-2130).
[0063] A nucleic acid is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA encoding a secretory leader, i.e., a signal peptide, is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice. Thus, the term operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
[0064] The term signal sequence, signal peptide, secretory sequence, secretory peptide, secretory signal sequence, secretory signal peptide and the like denotes a peptide sequence that, as a component of a larger polypeptide, directs the larger polypeptide through a secretory pathway of a cell in which it is synthesized, as well as nucleic acids encoding such peptides. In general, the larger polypeptide (or protein) is commonly cleaved to remove the secretory/signal peptide during transit through the secretory pathway, where the cleaved form of the polypeptide (i.e., the form without the signal/secretory peptide) is often referred to herein as the mature form of the polypeptide. For example, SEQ ID NO:2 provides the amino acid sequence of GA from F. verticilloides (Fv-GA) with the signal peptide (i.e., full length Fv-GA).
[0065] As used herein, the term vector refers to a nucleic acid construct designed for transfer between different host cells. An expression vector refers to a vector that has the ability to incorporate and express heterologous DNA fragments in a foreign cell. Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those having skill in the art.
[0066] Accordingly, an expression cassette or expression vector is a nucleic acid construct generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell. The recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Typically, the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
[0067] As used herein, the term plasmid refers to a circular double-stranded (ds) DNA construct that forms an extrachromosomal self-replicating genetic element when present in many bacteria and some eukaryotes. Plasmids may be employed for any of a number of different purposes, e.g., as cloning vectors, propagation vectors, expression vectors, etc.
[0068] As used herein, the term selectable marker refers to a nucleotide sequence or polypeptide encoded thereby which is capable of expression in cells and where expression of the selectable marker in cells confers the ability to be differentiated from cells that do not express the selectable marker. In certain embodiments, a selectable marker allows a cell expressing it to grow in the presence of a corresponding selective agent, or under corresponding selective growth conditions. In other embodiments, a selectable marker allows a cell expressing it to be identified and/or isolated from cells that do not express it by virtue of a physical characteristic, e.g., by differences in fluorescence, immuno-reactivity, etc.
[0069] In general, nucleic acid molecules which encode the Fv-GA or a variant Fv-GA will hybridize, under moderate to high stringency conditions to the wild type sequence provided herein as SEQ ID NO:2 (native Fv-GA gene). However, in some cases an Fv-GA-encoding nucleotide sequence is employed that possesses a substantially different codon usage, while the enzyme encoded by the Fv-GA-encoding nucleotide sequence has the same or substantially the same amino acid sequence as the native enzyme. For example, the coding sequence may be modified to facilitate faster expression of Fv-GA in a particular prokaryotic or eukaryotic expression system, in accordance with the frequency with which a particular codon is utilized by the host (commonly referred to as codon optimization). Te'o, et al. (2000), for example, describes the optimization of genes for expression in filamentous fungi. Such nucleic acid sequences are sometimes referred to as degenerate or degenerated sequences.
[0070] A nucleic acid sequence is considered to be selectively hybridizable to a reference nucleic acid sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions. Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe. For example, maximum stringency typically occurs at about Tm5 C. (5 below the Tm of the probe); high stringency at about 5-10 below the Tm; moderate or intermediate stringency at about 10-20 below the Tm of the probe; and low stringency at about 20-25 below the Tm. Functionally, maximum stringency conditions may be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while high stringency conditions are used to identify sequences having about 80% or more sequence identity with the probe.
[0071] Moderate and high stringency hybridization conditions are well known in the art (see, for example, Sambrook, et al, 1989, Chapters 9 and 11, and in Ausubel, F. M., et al., 1993, expressly incorporated by reference herein). An example of high stringency conditions includes hybridization at about 42 C. in 50% formamide, 5SSC, 5Denhardt's solution, 0.5% SDS and 100 g/mIdenatured carrier DNA followed by washing two times in 2SSC and 0.5% SDS at room temperature and two additional times in 0.1SSC and 0.5% SDS at 42 C.
[0072] As used herein, the terms transformed, stably transformed or transgenic with reference to a cell means the cell has a non-native (heterologous) nucleic acid sequence integrated into its genome or as an episomal plasmid that is maintained through multiple generations.
[0073] As used herein, the term expression refers to the process by which a polypeptide is produced based on the nucleic acid sequence of a gene. The process generally includes both transcription and translation.
[0074] The term introduced in the context of inserting a nucleic acid sequence into a cell, means transfection, or transformation or transduction and includes reference to the incorporation of a nucleic acid sequence into a eukaryotic or prokaryotic cell where the nucleic acid sequence may be incorporated into the genome of the cell (for example, chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (for example, transfected mRNA).
[0075] By the term host cell is meant a cell that contains a vector and supports the replication, and/or transcription and/or transcription and translation (expression) of the expression construct. Host cells for use in the present invention can be prokaryotic cells, such as E. coli, or eukaryotic cells such as yeast, plant, insect, amphibian, or mammalian cells. In certain embodiments, host cells are filamentous fungi.
[0076] When an amino acid position (or residue) in a first polypeptide is noted as being equivalent to an amino acid position in a second, related polypeptide, it means that the amino acid position of the first polypeptide corresponds to the position noted in the second, related polypeptide by one or more of (i) primary sequence alignment (see description of sequence alignment and sequence identity below); (ii) structural sequence homology; or (iii) analogous functional property. Thus, an amino acid position in a first GA enzyme (or a variant thereof) can be identified as equivalent (or homologous) to an amino acid position in a second GA enzyme (or even multiple different GA enzymes).
[0077] Primary Sequence Alignment:
[0078] Equivalent amino acid positions can be determined using primary amino acid sequence alignment methodologies, many of which are known in the art. For example, by aligning the primary amino acid sequences of two or more different GA enzymes, it is possible to designate an amino acid position number from one GA enzyme as equivalent to the position number of another one of the aligned GA enzymes. In this manner, the numbering system originating from the amino acid sequence of one GA enzyme (e.g., the Fv-GA enzyme denoted in SEQ ID NO: 1) can be used to identify equivalent (or homologous) amino acid residues in other GA enzymes.
[0079] Structural Sequence Homology:
[0080] In addition to determining equivalent amino acid positions using primary sequence alignment methodologies, equivalent amino acid positions may also be defined by determining homology at the level of secondary and/or tertiary structure. For example, for a glucoamylase whose tertiary structure has been determined by x-ray crystallography, equivalent residues can be defined as those for which the atomic coordinates of two or more of the main chain atoms of a particular amino acid residue of the glucoamylase are within 0.13 nm and preferably 0.1 nm after alignment with Fv-GA (N on N, CA on CA, C on C, and O on O). Alignment is achieved after the best model has been oriented and positioned to give the maximum overlap of atomic coordinates of non-hydrogen protein atoms of the glucoamylase in question to Fv-GA. The best model is the crystallographic model that gives the highest resolution available. Where two or more different models have equal resolution, the model with the lowest R factor for experimental diffraction data, using the equation below, is used.
[0081] Analogous Functional Property:
[0082] Equivalent amino acid residues in a first polypeptide which are functionally analogous to a specific residue of a second related polypeptide (e.g., a first glucoamylase and Fv-GA) are defined as those amino acids in the first polypeptide that adopt a conformation such that they alter, modify, or contribute to polypeptide structure, substrate binding, or catalysis in a manner defined and attributed to a specific residue of the second related polypeptide. When a tertiary structure has been obtained by x-ray crystallography for the first polypeptide, amino acid residues of the first polypeptide that are functionally analogous to the second polypeptide occupy an analogous position to the extent that, although the main chain atoms of the given residue may not satisfy the criteria of equivalence on the basis of occupying a homologous position, the atomic coordinates of at least two of the side chain atoms of the residue lie with 0.13 nm of the corresponding side chain atoms of the second polypeptide.
[0083] The term improved property or improved performance and the like with respect to a variant enzyme (e.g., a GA variant) is defined herein as a characteristic or activity associated with a variant enzyme which is improved as compared to its respective parent enzyme. Improved properties include, but are not limited to, improved thermostability or altered temperature-dependent activity profile, improved activity or stability at a desired pH or pH range, improved substrate specificity, improved product specificity, and improved stability in the presence of a chemical or other component in a starch conversion process step, etc. Improved performance may be determined using a particular assay(s) including, but not limited to: (a) expression, (b) hydrolytic activity on DP2 substrate, (c) hydrolytic activity on DP7 substrate, (d) hydrolytic activity on panose substrate, (e) hydrolytic activity on pullulan substrate, (f) hydrolytic activity on granular corn starch (CS), (g) thermostability, (h) glucose inhibition, (i) reversion activity, and (j) hydrolytic activity on an amylopectin substrate.
[0084] The term improved thermostability with respect to a variant protein (e.g., a GA variant) is defined herein as a variant enzyme displaying retention of a greater fraction of enzymatic activity after a period of incubation at an elevated temperature relative to the parent enzyme. Such a variant may or may not display an altered thermal activity profile relative to the parent. For example, a variant may have an improved ability to refold following incubation at elevated temperature relative to the parent.
[0085] By improved product specificity is meant a variant enzyme displaying an altered product profile as compared to the parent enzyme, where the altered product profile of the variant is improved in a given application as compared to the parent. A product profile is defined herein as the chemical composition of the reaction products produced by the enzyme of interest.
[0086] By improved substrate specificity is meant a variant enzyme that targets a specific substrate (or class of substrate) for hydrolysis in a manner different than the parent enzyme, such that the variant has improved performance in a given application as compared to the parent.
[0087] By improved chemical stability is meant that a variant enzyme displays retention of enzymatic activity after a period of incubation in the presence of a chemical or chemicals that reduce the enzymatic activity of the parent enzyme under the same conditions. Variants with improved chemical stability are better able to catalyze a reaction in the presence of such chemicals as compared to the parent enzyme.
[0088] A pH range, with reference to an enzyme, refers to the range of pH values under which the enzyme exhibits catalytic activity.
[0089] The terms pH stable and pH stability, with reference to an enzyme, relate to the ability of the enzyme to retain activity over a wide range of pH values for a predetermined period of time (e.g., 15 min., 30 min., 1 hour).
[0090] As used herein, starch refers to any material comprised of the complex polysaccharide carbohydrates of plants, comprised of amylose and amylopectin with the formula (C.sub.6H.sub.10O.sub.5).sub.x, wherein X can be any number. In particular, the term refers to any plant-based material including but not limited to grains, grasses, tubers and roots and more specifically wheat, barley, corn, rye, rice, sorghum, brans, cassava, millet, potato, sweet potato, and tapioca. Granular starch refers to uncooked (raw) starch, which has not been subject to gelatinization, where starch gelatinization means solubilization of a starch molecule to form a viscous suspension.
[0091] Degree of polymerization (DP) refers to the number (n) of anhydroglucopyranose units in a given saccharide. Examples of DP1 are the monosaccharides, such as glucose and fructose. Examples of DP2 are the disaccharides, such as maltose and sucrose. DP7 denotes polymers with seven anhydroglucopyranose units.
[0092] As used herein, hydrolysis of starch and the like refers to the cleavage of glucosidic bonds with the addition of water molecules. Thus, enzymes having starch hydrolysis activity catalyze the cleavage of glucosidic bonds with the addition of water molecules
[0093] As used herein, fermentable sugars refer to saccharides that are capable of being metabolized under fermentation conditions. These sugars typically refer to glucose, maltose, and maltotriose (DP1, DP2, and DP3).
[0094] As used herein, total sugar content refers to the total sugar content present in a starch composition.
[0095] Percent sequence identity or grammatical equivalents means that a particular sequence has at least a certain percentage of amino acid residues identical to those in a specified reference sequence using an alignment algorithm. An example of an algorithm that is suitable for determining sequence similarity is the BLAST algorithm, which is described in Altschul, et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (<www(dot)ncbi(dot)nlm(dot)nih(dot)gov>). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence that either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. These initial neighborhood word hits act as starting points to find longer HSPs containing them. The word hits are expanded in both directions along each of the two sequences being compared for as far as the cumulative alignment score can be increased. Extension of the word hits is stopped when: the cumulative alignment score falls off by the quantity X from a maximum achieved value; the cumulative score goes to zero or below;
[0096] or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a word length (W) of 11, the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M5, N-4, and a comparison of both strands.
[0097] The BLAST algorithm then performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, an amino acid sequence is considered similar to a protease if the smallest sum probability in a comparison of the test amino acid sequence to a protease amino acid sequence is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
[0098] Alignment algorithms can also be employed to identify an amino acid residue (or residues) in a first amino acid sequence (e.g., Fv-GA) that correspond to an amino acid residue (or residues) in a second aminbo acid sequence (e.g., homologous GA enzymes from other species, e.g., T. reesei GA).
[0099] When questions of percent sequence identity or corresponding amino acid residues between two sequences arise, alignment using the CLUSTAL W algorithm with default parameters will govern. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are: [0100] Gap opening penalty: 10.0 [0101] Gap extension penalty: 0.05 [0102] Protein weight matrix: BLOSUM series [0103] DNA weight matrix: IUB [0104] Delay divergent sequences %: 40 [0105] Gap separation distance: 8 [0106] DNA transitions weight: 0.50 [0107] List hydrophilic residues: GPSNDQEKR [0108] Use negative matrix: OFF [0109] Toggle Residue specific penalties: ON [0110] Toggle hydrophilic penalties: ON [0111] Toggle end gap separation penalty OFF.
II. Molecular Biology
[0112] Embodiments of the subject invention provide for the expression of a desired glucoamylase enzyme (or combination of glucoamylase enzymes) from glucoamylase-encoding nucleic acids under control of a promoter functional in a host cell of interest, e.g., a filamentous fungus. Therefore, this invention relies on a number of routine techniques in the field of recombinant genetics. Basic texts disclosing examples of suitable recombinant genetics methods are noted above.
[0113] Any method known in the art that can introduce mutations into a parent nucleic acid/polypeptide is contemplated by the present invention.
[0114] The present invention relates to the expression, purification and/or isolation and use of variant GA enzymes. These enzymes may be prepared by recombinant methods utilizing any of a number of glucoamylase genes known in the art (e.g., the F. verticillioides glucoamylase gene comprising SEQ ID NO:2). Any convenient method for introducing mutations may be employed, including site directed mutagenesis. As indicated above, mutations (or variations) include substitutions, additions, deletions or truncations that will correspond to one or more amino acid changes in the expressed GA variant. Again, site directed mutagenesis and other methods of incorporating amino acid changes in expressed proteins at the DNA level can be found in numerous references, e.g., Green and Sambrook, et al. 2012 and Ausubel, et al.
[0115] DNA encoding an amino acid sequence variant of a parent GA is prepared by a variety of methods known in the art. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide-mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared DNA encoding the parent GA enzyme.
[0116] Site-directed mutagenesis is one method that can be employed in preparing substitution variants. This technique is well known in the art (see, e.g., Carter et al. Nucleic Acids Res. 13:4431-4443 (1985) and Kunkel et al., Proc. Natl. Acad. Sci. USA 82:488 (1987)). Briefly, in carrying out site-directed mutagenesis of DNA, the starting DNA is altered by first hybridizing an oligonucleotide encoding the desired mutation to a single strand of such starting DNA. After hybridization, a DNA polymerase is used to synthesize an entire second strand, using the hybridized oligonucleotide as a primer, and using the single strand of the starting DNA as a template. Thus, the oligonucleotide encoding the desired mutation is incorporated in the resulting double-stranded DNA.
[0117] PCR mutagenesis is also suitable for making amino acid sequence variants of the parent GA. See Higuchi, in PCR Protocols, pp. 177-183 (Academic Press, 1990); and Vallette et al., Nuc. Acids Res. 17:723-733 (1989). Briefly, when small amounts of template DNA are used as starting material in a PCR, primers that differ slightly in sequence from the corresponding region in a template DNA can be used to generate relatively large quantities of a specific DNA fragment that differs from the template sequence only at the positions where the primers differ from the template.
[0118] Another method for preparing variants, cassette mutagenesis, is based on the technique described by Wells et al., Gene 34:315-323 (1985). The starting material is the plasmid (or other vector) comprising the starting polypeptide DNA to be mutated. The codon(s) in the starting DNA to be mutated are identified. There must be a unique restriction endonuclease site on each side of the identified mutation site(s). If no such restriction sites exist, they may be generated using the above-described oligonucleotide-mediated mutagenesis method to introduce them at appropriate locations in the starting polypeptide DNA. The plasmid DNA is cut at these sites to linearize it. A double-stranded oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the desired mutation(s) is synthesized using standard procedures, wherein the two strands of the oligonucleotide are synthesized separately and then hybridized together using standard techniques. This double-stranded oligonucleotide is referred to as the cassette. This cassette is designed to have 5 and 3 ends that are compatible with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid. This plasmid now contains the mutated DNA sequence.
[0119] Alternatively, or additionally, the desired amino acid sequence encoding a desired glucoamylase can be determined, and a nucleic acid sequence encoding such amino acid sequence variant can be generated synthetically.
[0120] The desired glucoamylase(s) so prepared may be subjected to further modifications, oftentimes depending on the intended use of the glucoamylase. Such modifications may involve further alteration of the amino acid sequence, fusion to heterologous polypeptide(s) and/or covalent modifications.
III. GA and Variant GA Polypeptides and Nucleic Acids Encoding Same
[0121] Glucoamylases (GAs) are produced by numerous strains of bacteria, fungi, yeast and plants. Many fungal glucoamylases are secreted from the cell, for example from strains of Aspergillus (Svensson et al., Carlsberg Res. Commun. 48: 529-544 (1983); Boel et al., EMBO J. 3: 1097-1102 (1984); Hayashida et al., Agric. Biol. Chem. 53: 923-929 (1989); U.S. Pat. Nos. 5,024,941; 4,794,175 and WO 88/09795); Talaromyces (U.S. Pat. Nos. 4,247,637; 6,255,084; and 6,620,924); Rhizopus (Ashikari et al., Agric. Biol. Chem. 50: 957-964 (1986); Ashikari et al., App. Microbio. Biotech. 32: 129-133 (1989) and U.S. Pat. No. 4,863,864); Humicola (WO 05/052148 and U.S. Pat. No. 4,618,579); and Mucor(Houghton-Larsen et al., Appl. Microbiol. Biotechnol. 62: 210-217 (2003)). Many of the genes that code for these enzymes have been cloned and expressed in yeast, fungal and/or bacterial cells.
[0122] Commercially, glucoamylases are very important enzymes and have been used in a wide variety of applications that require the hydrolysis of starch (e.g., for producing glucose and other monosaccharides from starch). Glucoamylases are used to produce high fructose corn sweeteners, which comprise over 50% of the sweetener market in the United States. In general, glucoamylases may be, and commonly are, used with alpha-amylases in starch hydrolyzing processes to hydrolyze starch to dextrins and then glucose. The glucose may be used directly; be converted to fructose by other enzymes (e.g., glucose isomerases); crystallized; or used in fermentations to produce numerous end products (e.g., ethanol, citric acid, succinic acid, ascorbic acid intermediates, glutamic acid, glycerol, 1,3-propanediol and lactic acid).
[0123] Glucoamylases may consist of as many as three distinct structural domains, a catalytic domain of approximately 450 residues that is structurally conserved in all glucoamylases, generally followed by a linker region consisting of between 30 and 80 residues that are connected to a starch binding domain (SBD) of approximately 100 residues (also referred to as a carbohydrate binding domain, or CBD). The structure of the Trichoderma reesei glucoamylase (TrGA) with all three regions intact was determined to 1.8 Angstrom resolution. See WO 2009/048488 and WO 2009/048487, incorporated herein by reference. Using the determined coordinates, the structure was aligned with the coordinates of the catalytic domain of the glucoamylase from Aspergillus awamori strain X100 that was determined previously (Aleshin, A. E., Hoffman, C., Firsov, L. M., and Honzatko, R. B. Refined crystal structures of glucoamylase from Aspergillus awamori var. X100. J. Mol. Biol. 238: 575-591 (1994)). The structure of the catalytic domains of these two glucoamylases overlap very closely, and it is possible to identify equivalent residues based on this structural superposition. It is further believed that all glucoamylases share the basic structure.
[0124] Given the well-known structure and function relationship of glucoamylases, glucoamylase variants having altered properties have been successfully created and characterized. Certain variants display improved properties as compared to the parent glucoamylases. Examples of improved properties include increased thermostability and increased specific activity. Methods for making and characterizing T. reesei GA variants with altered properties have been described in WO 2009/067218 (incorporated herein by reference).
[0125] GA enzyme protein (amino acid) and nucleotide sequences are described herein including:
[0126] Fusarium verticillioides GA (Fv-GA) Protein Sequence (SEQ ID NO: 1)
[0127] Fusarium verticillioides GA (Fv-GA) DNA Nucleotide Sequence (SEQ ID NO: 2)
[0128] Aspergillus fumigatus GA (Afu-GA) Protein Sequence (SEQ ID NO: 3)
[0129] Aspergillus fumigatus GA (Afu-GA) Nucleotide Sequence (SEQ ID NO: 4)
[0130] Humicola grisea GA (Hg-GA) Protein Sequence (SEQ ID NO: 5)
[0131] Humicola grisea GA (Hg-GA) Nucleotide Sequence (SEQ ID NO: 6)
[0132] Aspergillus niger GA (An-GA) Protein Sequence (SEQ ID NO: 7)
[0133] Aspergillus niger GA (An-GA) Nucleotide Sequence (SEQ ID NO: 8)
[0134] Trichoderma reesei GA (Tr-GA) variant CS4 Mature Protein Sequence (SEQ ID NO: 9)
[0135] Trichoderma reesei GA (Tr-GA) Mature Protein Sequence (SEQ ID NO: 10)
[0136] Trichoderma reesei GA (Tr-GA) Parent Protein Sequence (SEQ ID NO: 11)
[0137] Trichoderma reesei GA (Tr-GA) Nucleotide Sequence (SEQ ID NO: 12)
[0138] Variant GA enzymes are also described herein. The variant GA enzymes have one or more mutations, as set forth herein, with respect to a parent GA enzyme, where the parent GA enzyme has at least 60% (i.e., 60% or greater) amino acid sequence identity to SEQ ID NO:4, including at least 61%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, up to and including 100% amino acid sequence identity to SEQ ID NO:4. Variant GA enzymes (i.e., having one or more mutations) may have at least 60% (i.e., 60% or greater) amino acid sequence identity to SEQ ID NO:4, including at least 61%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:4. In certain embodiments, the parent GA is selected from: a Trichoderma strain (e.g., T. reesei, T. longibrachiatum, T. strictipilis, T. asperellum, T. konilangbra, T. citrinoviride, T. pseudokoningii and T. hazianum), an Aspergillus strain (e.g. A. aculeatus, A. niger, A. nidulans, A. kawachi, A. awamori, A. clavatus, A. terreus, A. fumigates, and A. orzyae), a Talaromyces strain (e.g. T. emersonii, T. thermophilus, and T. duponti), a Trametes strain (e.g., Trametes cingulata), a Hypocrea strain (e.g. H. gelatinosa, H. orientalis, H. vinosa, H. jecorina, H. schweinitzii, and H. citrina), a Fusarium strain (e.g., F. oxysporum, and F. roseum), a Humicola strain (e.g., H. grisea, H. insolens and H. lanuginose), a Saccharomycopsis strain (e.g., S. fibuligera), Scytalidium thermophilum, Podospora anderina, or their respective anamorph, teleomorph or holomorph counterpart forms.
[0139] In some cases the parent GA is Fusarium verticillioides GA (Fv-GA). Further, the variant GA enzyme has starch hydrolysis activity (or is a variant GA fragment having starch hydrolysis activity) where, in certain embodiments, the variant GA has an improved property as compared to the parent GA (as detailed herein).
[0140] Aspects of the present invention provide variants of a parent GA enzyme, where the variant has starch hydrolysis activity, has at least 60% (e.g., at least 80%) sequence identity to SEQ ID NO:1, and has at least one improved property over the parent GA enzyme selected from: (a) expression, (b) hydrolytic activity on DP2 substrate, (c) hydrolytic activity on DP7 substrate, (d) hydrolytic activity on panose substrate, (e) hydrolytic activity on pullulan substrate, (f) hydrolytic activity on granular corn starch (CS), (g) thermostability, (h) glucose inhibition, (i) reversion activity, and (j) hydrolytic activity on a amylopectin substrate.
[0141] In certain embodiments, a GA variant has at least two, at least three, at least four, at least five, at least six, at least seven, at least 8, at least 9, or more improved properties (selected from the list above) over the parent GA enzyme. In certain embodiments, a variant GA enzyme comprises an amino acid mutation at one or more amino acid positions in Fv-GA (as denoted in SEQ ID NO:1). Because certain parent GA enzymes according to aspects of the invention may not have the same amino acid as wild type Fv-GA, amino acid positions corresponding to the residues noted above may also be designated either by the position number alone.
[0142] Alignment of amino acid sequences to determine homology can be determined by using a sequence comparison algorithm. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), by visual inspection or MOE by Chemical Computing Group, Montreal Canada. See also the description of percent sequence identity provided in the Definitions section above.
IV. Expression of Recombinant GA
[0143] Aspects of the subject invention include methods and compositions related to the generation nucleic acids encoding GA enzymes and GA enzyme variants, host cells containing such nucleic acids, the production of GA's or GA variants by such host cells, and the isolation, purification and/or use of the GA variants.
[0144] As such, embodiments of the invention provide host cells that have been transduced, transformed or transfected with an expression vector comprising a desired GA or GA variant-encoding nucleic acid sequence. For example, a filamentous fungal cell or yeast cell is transfected with an expression vector having a promoter or biologically active promoter fragment or one or more (e.g., a series) of enhancers which functions in the host cell line, operably linked to a DNA segment encoding a desired GA or GA variant, such that desired GA or GA variant is expressed in the cell line.
[0145] A. Nucleic Acid Constructs/Expression Vectors.
[0146] Natural or synthetic polynucleotide fragments encoding a desired GA or GA variant may be incorporated into heterologous nucleic acid constructs or vectors, capable of introduction into, and replication in, a host cell of interest (e.g., a filamentous fungal or yeast cell). The vectors and methods disclosed herein are suitable for use in host cells for the expression of a desired GA or GA variant. Any vector may be used as long as it meets the desired replication/expression characteristics in the host cell(s) into which it is introduced (such characteristics generally being defined by the user). Large numbers of suitable vectors and promoters are known to those of skill in the art, some of which are commercially available. Cloning and expression vectors are also described in Sambrook et al., 1989, Ausubel F M et al., 1989, and Strathern et al., 1981, each of which is expressly incorporated by reference herein. Appropriate expression vectors for fungi are described in van den Hondel, C. A. M. J. J. et al. (1991) In: Bennett, J. W. and Lasure, L. L. (eds.) More Gene Manipulations in Fungi. Academic Press, pp. 396-428. The appropriate DNA sequence may be inserted into a plasmid or vector (collectively referred to herein as vectors) by a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by standard procedures. Such procedures and related sub-cloning procedures are deemed to be within the scope of knowledge of those skilled in the art.
[0147] Recombinant host cells comprising the coding sequence for a desired GA or GA variant may be produced by introducing a heterologous nucleic acid construct comprising the desired GA or GA variant coding sequence into the desired host cells (e.g., as described in further detail below). For example, a desired GA or GA variant coding sequence may be inserted into a suitable vector according to well-known recombinant techniques and used to transform a filamentous fungus capable of GA expression. As has been noted above, due to the inherent degeneracy of the genetic code, other nucleic acid sequences which encode substantially the same or a functionally equivalent amino acid sequence may be used to clone and express a desired GA or GA variant. Therefore it is appreciated that such substitutions in the coding region fall within the sequence variants covered by the present invention.
[0148] The present invention also includes recombinant nucleic acid constructs comprising one or more of the desired GA's or GA variant-encoding nucleic acid sequences as described above. The constructs comprise a vector, such as a plasmid or viral vector, into which a sequence of the invention has been inserted, in a forward or reverse orientation.
[0149] Heterologous nucleic acid constructs may include the coding sequence for a desired GA or GA variant: (i) in isolation; (ii) in combination with additional coding sequences; such as fusion polypeptide or signal peptide coding sequences, where the desired GA or GA variant coding sequence is the dominant coding sequence; (iii) in combination with non-coding sequences, such as introns and control elements, such as promoter and terminator elements or 5 and/or 3 untranslated regions, effective for expression of the coding sequence in a suitable host; and/or (iv) in a vector or host environment in which the desired GA or GA variant coding sequence is a heterologous gene.
[0150] In one aspect of the present invention, a heterologous nucleic acid construct is employed to transfer a desired GA or GA variant-encoding nucleic acid sequence into a host cell in vitro, e.g., into established filamentous fungal and yeast lines. Long-term production of a desired GA or GA variant can be achieved by generating a host cell that has stable expression of the GA or GA variant. Thus, it follows that any method effective to generate stable transformants may be used in practicing the invention.
[0151] Appropriate vectors are typically equipped with a selectable marker-encoding nucleic acid sequence, insertion sites, and suitable control elements, such as promoter and termination sequences. The vector may comprise regulatory sequences, including, for example, non-coding sequences, such as introns and control elements, i.e., promoter and terminator elements or 5 and/or 3 untranslated regions, effective for expression of the coding sequence in host cells (and/or in a vector or host cell environment in which a modified soluble protein antigen coding sequence is not normally expressed), operably linked to the coding sequence. Large numbers of suitable vectors and promoters are known to those of skill in the art, many of which are commercially available and/or are described in Sambrook, et al., (supra).
[0152] Examples of suitable promoters include both constitutive promoters and inducible promoters, examples of which include a CMV promoter, an SV40 early promoter, an RSV promoter, an EF-1a promoter, a promoter containing the tet responsive element (TRE) in the tet-on or tet-off system as described (ClonTech and BASF), the beta actin promoter and the metallothionine promoter that can upregulated by addition of certain metal salts. A promoter sequence is a DNA sequence which is recognized by the particular host cell for expression purposes. It is operably linked to DNA sequence encoding a GA or variant GA polypeptide. Such linkage comprises positioning of the promoter with respect to the initiation codon of the DNA sequence encoding the GA or variant GA polypeptide in the expression vector such that the promoter can drive transcription/translation of the GA or GA variant-encoding sequence. The promoter sequence contains transcription and translation control sequences which mediate the expression of the GA or variant GA polypeptide. Examples include the promoters from the Aspergillus niger, A awamori or A. oryzae glucoamylase, alpha-amylase, or alpha-glucosidase encoding genes; the A. nidulans gpdA or trpC Genes; the Neurospora crassa cbh1 or trp1 genes; the A. niger or Rhizomucor miehei aspartic proteinase encoding genes; the H. jecorina cbh1, cbh2, egl1, egl2, or other cellulase encoding genes.
[0153] The choice of the proper selectable marker will depend on the host cell, and appropriate markers for different hosts are well known in the art. Typical selectable marker genes include argB from A. nidulans or H. jecorina, amdS from A. nidulans, pyr4 from Neurospora crassa or H. jecorina, pyrG from Aspergillus niger or A. nidulans. Additional examples of suitable selectable markers include, but are not limited to trpc, trp1, oliC31, niaD or leu2, which are included in heterologous nucleic acid constructs used to transform a mutant strain such as trp-, pyr-, leu- and the like.
[0154] Such selectable markers confer to transformants the ability to utilize a metabolite that is usually not metabolized by the filamentous fungi. For example, the amdS gene from H. jecorina, which encodes the enzyme acetamidase, allows transformant cells to grow on acetamide as a nitrogen source. The selectable marker (e.g. pyrG) may restore the ability of an auxotrophic mutant strain to grow on a selective minimal medium or the selectable marker (e.g. olic3l) may confer to transformants the ability to grow in the presence of an inhibitory drug or antibiotic.
[0155] The selectable marker coding sequence is cloned into any suitable plasmid using methods generally employed in the art. Examples of suitable plasmids include pUC18, pBR322, pRAX and pUC100. The pRAX plasmid contains AMA1 sequences from A. nidulans, which make it possible to replicate in A. niger.
[0156] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Sambrook et al., 1989; Freshney, 1987; Ausubel, et al., 1993; and Coligan et al., 1991.
[0157] B. Host Cells and Culture Conditions for GA Enzyme Production
[0158] After DNA sequences that encode the GA or GA variants have been cloned into DNA constructs, the DNA is used to transform microorganisms. The microorganism to be transformed for the purpose of expressing a GA or variant GA according to the present invention can be chosen from a wide variety of host cells. The sections below are provided as examples of host cells/microorganisms and are not meant to limit the scope of host cells that can be employed in practicing aspects of the present invention.
[0159] (i) Filamentous Fungi
[0160] Aspects of the present invention include filamentous fungi which have been modified, selected and cultured in a manner effective to result in desired GA or GA variant production or expression relative to the corresponding non-transformed parental filamentous fungi.
[0161] Examples of species of parental filamentous fungi that may be treated and/or modified for desired glucoamylase expression include, but are not limited to Trichoderma, Penicillium sp., Humicola sp., including Humicola insolens; Aspergillus sp., including Aspergillus niger, Chrysosporium sp., Myceliophthora sp., Fusarium sp., Hypocrea sp., and Emericella sp.
[0162] Cells expressing a desired GA or GA variant are cultured under conditions typically employed to culture the parental fungal line. Generally, cells are cultured in a standard medium containing physiological salts and nutrients, such as described in Pourquie, J. et al., Biochemistry and Genetics of Cellulose Degradation, eds. Aubert, J. P. et al., Academic Press, pp. 71-86, 1988 and Ilmen, M. et al., Appl. Environ. Microbiol. 63:1298-1306, 1997. Standard culture conditions are known in the art, e.g., cultures are incubated at 28 C. in shaker cultures or fermenters until desired levels of desired GA variant expression are achieved.
[0163] Culture conditions for a given filamentous fungus can be found, for example, in the scientific literature and/or from the source of the fungi such as the American Type Culture Collection (ATCC). After fungal growth has been established, the cells are exposed to conditions effective to cause or permit the expression of a desired GA or GA variant.
[0164] In cases where a desired GA or GA variant coding sequence is under the control of an inducible promoter, the inducing agent, e.g., a sugar, metal salt or antibiotic, is added to the medium at a concentration effective to induce expression of the desired GA or GA variant.
[0165] In one embodiment, the strain is an Aspergillus niger strain, which is a useful strain for obtaining overexpressed protein. For example A. niger var awamori dgr246 is known to secrete elevated amounts of secreted cellulases (Goedegebuur et al, Curr. Genet (2002) 41: 89-98). Other strains of Aspergillus niger var awamori such as GCDAP3, GCDAP4 and GAPS-4 are known (Ward et al, 1993, Appl. Microbiol. Biotechnol. 39:738-743).
[0166] In another embodiment, the strain is a Trichoderma reesei strain, which is a useful strain for obtaining overexpressed protein. For example, RL-P37, described by Sheir-Neiss, et al., Appl. Microbiol. Biotechnol. 20:46-53 (1984) is known to secrete elevated amounts of cellulase enzymes. Functional equivalents of RL-P37 include Trichoderma reesei strain RUT-C30 (ATCC No. 56765) and strain QM9414 (ATCC No. 26921). It is contemplated that these strains would also be useful in over-expressing GA or variant GA.
[0167] Where it is desired to obtain a GA or GA variant in the absence of potentially detrimental native glucoamylase activity, it is useful to obtain a host cell strain which has had one or more glucoamylase genes deleted prior to introduction of a DNA construct or plasmid containing the DNA fragment encoding the desired GA or GA variant. Such strains may be prepared in any convenient manner, for example by the method disclosed in U.S. Pat. No. 5,246,853 and WO 92/06209, which disclosures are hereby incorporated by reference. By expressing a desired GA or GA variant in a host microorganism that is missing one or more glucoamylase genes (e.g., the endogenous glucoamylase gene of a host cell), identification and subsequent purification procedures, where desired, are simplified.
[0168] Gene deletion may be accomplished by inserting a form of the desired gene to be deleted or disrupted into a plasmid by methods known in the art. The deletion plasmid is then cut at an appropriate restriction enzyme site(s), internal to the desired gene coding region, and the gene coding sequence or part thereof replaced with a selectable marker. Flanking DNA sequences from the locus of the gene to be deleted or disrupted, for example from about 0.5 to about 2.0 kb, may remain on either side of the selectable marker gene. An appropriate deletion plasmid will generally have unique restriction enzyme sites present therein to enable the fragment containing the deleted gene, including flanking DNA sequences, and the selectable marker gene to be removed as a single linear piece.
[0169] In certain embodiments, more than one copy of DNA encoding a desired GA or GA variant may be present in a host strain to facilitate overexpression of the GA or GA variant. For example, a host cell may have multiple copies of a desired GA or GA variant integrated into the genome or, alternatively, include a plasmid vector that is capable of replicating autonomously in the host organism.
[0170] (ii) Yeast
[0171] The present invention also contemplates the use of yeast as a host cell for desired one or more GA production. Several other genes encoding hydrolytic enzymes have been expressed in various strains of the yeast S. cerevisiae. These include sequences encoding for two endoglucanases (Penttila et al., 1987), two cellobiohydrolases (Penttila et al., 1988) and one beta-glucosidase from Trichoderma reesei (Cummings and Fowler, 1996), a xylanase from Aureobasidlium pullulans (Li and Ljungdahl, 1996), an alpha-amylase from wheat (Rothstein et al., 1987), etc.
[0172] (iii) Other
[0173] It is further contemplated that in some embodiments, expression systems in host cells other than filamentous fungal cells or yeast cells may be employed, including insect cell or bacterial cell expression systems. Certain of the bacterial host cells can, for example, be one that is also an ethanologen, such as an engineered Zymomonas mobilis, which is not only capable of expressing the enzyme(s)/variant(s) of interest but also capable of metabolizing certain monomeric and other fermentable sugars, turning them into ethanol. The selection of a host cell may be determined by the desires of the user of the GA or GA variants described herein, and thus no limitation in that regard is intended.
[0174] C. Introduction of a Desired GA-Encoding Nucleic Acid Sequence into Host Cells.
[0175] The invention further provides cells and cell compositions which have been genetically modified to comprise an exogenously provided desired GA or GA variant-encoding nucleic acid sequence. A parental cell or cell line may be genetically modified (e.g., transduced, transformed or transfected) with a cloning vector or an expression vector. The vector may be, for example, in the form of a plasmid, a viral particle, a phage, etc., as further described above.
[0176] The methods of transformation of the present invention may result in the stable integration of all or part of the transformation vector into the genome of the host cell. However, transformation resulting in the maintenance of a self-replicating extra-chromosomal transformation vector is also contemplated.
[0177] Any of the well-known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, biolistics, liposomes, microinjection, plasma vectors, viral vectors and any of the other well-known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et al., supra). In essence, the particular genetic engineering procedure used should be capable of successfully introducing a polynucleotide (e.g., an expression vector) into the host cell that is capable of expressing the desired GA or GA variant.
[0178] Many standard transfection methods can be used to produce Trichoderma reesei cell lines that express large quantities of the heterologous polypeptide. Some of the published methods for the introduction of DNA constructs into strains of Trichoderma include: Lorito, Hayes, DiPietro and Harman, 1993, Curr. Genet. 24: 349-356; Goldman, VanMontagu and Herrera-Estrella, 1990, Curr. Genet. 17:169-174; Penttila, Nevalainen, Ratto, Salminen and Knowles, 1987, Gene 6: 155-164; for Aspergillus: Yelton, Hamer and Timberlake, 1984, Proc. Natl. Acad. Sci. USA 81: 1470-1474; for Fusarium: Bajar, Podila and Kolattukudy, 1991, Proc. Natl. Acad. Sci. USA 88: 8202-8212; for Streptomyces: Hopwood et al., 1985, The John Innes Foundation, Norwich, UK and for Bacillus: Brigidi, DeRossi, Bertarini, Riccardi and Matteuzzi, 1990, FEMS Microbiol. Lett. 55: 135-138. An example of a suitable transformation process for Aspergillus sp. can be found in Campbell et al. Improved transformation efficiency of A. niger using homologous niaD gene for nitrate reductase. Curr. Genet. 16:53-56; 1989.
[0179] In addition, heterologous nucleic acid constructs comprising a desired glucoamylase-encoding nucleic acid sequence can be transcribed in vitro, and the resulting RNA introduced into the host cell by well-known methods, e.g., by injection.
[0180] D. Analysis for GA Nucleic Acid Coding Sequences and/or Protein Expression.
[0181] In order to evaluate the expression of a desired GA variant by a cell line that has been transformed with a desired GA variant-encoding nucleic acid construct, assays can be carried out at the protein level, the RNA level or by use of functional bioassays particular to glucoamylase activity and/or production.
[0182] In general, assays employed to analyze the expression of a desired GA variant include, but are not limited to, Northern blotting, dot blotting (DNA or RNA analysis), RT-PCR (reverse transcriptase polymerase chain reaction), or in situ hybridization, using an appropriately labeled probe (based on the nucleic acid coding sequence) and conventional Southern blotting and autoradiography.
[0183] In addition, the production and/or expression of a desired GA variant may be measured in a sample directly, for example, by assays for glucoamylase activity, expression and/or production. Such assays are described, for example, in Becker et al., Biochem J. (2001) 356:19-30 and Mitsuishi et al., FEBS (1990) 275:135-138, each of which is expressly incorporated by reference herein. The ability of a GA to hydrolyze isolated soluble and insoluble substrates can be measured using assays described in Srisodsuk et al., J. Biotech. (1997) 57:49-57 and Nidetzky and Claeyssens, Biotech. Bioeng. (1994) 44:961-966. Substrates useful for assaying glucoamylase include soluble starch, amylopectin, DP7, paranitrophenyl glucoside. In addition, protein expression may be evaluated by immunological methods, such as ELISA, competitive immunoassays, radioimmunoassays, Western blot, indirect immunofluorescent assays, and the like. Certain of these assays can be performed using commercially available reagents and/or kits designed for detecting GA enzymes. Such immunoassays can be used to qualitatively and/or quantitatively evaluate expression of a desired GA or GA variant. The details of such methods are known to those of skill in the art and many reagents for practicing such methods are commercially available. In certain embodiments, an immunological reagent that is specific for a desired GA or variant GA enzyme but not its parent GA may be employed, e.g., an antibody that is specific for a GA substitution or a fusion partner of the GA or GA variant (e.g., an N or C terminal tag sequence, e.g., a hexa-Histidine tag or a FLAG tag). Thus, aspects of the present invention include using a purified form of a desired GA or GA variant to produce either monoclonal or polyclonal antibodies specific to the expressed polypeptide for use in various immunoassays. (See, e.g., Hu et al., 1991).
V. Methods for Enrichment, Isolation and/or Purification of GA or GA Variant Polypeptide
[0184] In general, a desired GA or GA variant polypeptide produced in a host cell culture is secreted into the medium (producing a culture supernatant containing the GA or GA variant) and may be enriched, purified or isolated, e.g., by removing unwanted components from the cell culture medium. However, in some cases, a desired GA or GA variant polypeptide may be produced in a cellular form (e.g., cytoplasmic, periplasmic, or otherwise associated with the cell) necessitating recovery from a cell lysate/homogenate. The desired GA or GA variant polypeptide is harvested from the cells or cell supernatants in which it was produced using techniques routinely employed by those of skill in the art. Examples include, but are not limited to, filtration (e.g., ultra- or micro-filtration), centrifugation, density gradient fractionation (e.g., density gradient ultracentrifugation), affinity chromatography (Tilbeurgh et al., 1984), ion-exchange chromatographic methods (Goya) et al., 1991; Fliess et al., 1983; Bhikhabhai et al., 1984; Ellouz et al., 1987), including ion-exchange using materials with high resolution power (Medve et al., 1998), hydrophobic interaction chromatography (Tomaz and Queiroz, 1999), and two-phase partitioning (Brumbauer, et al., 1999).
[0185] While enriched, isolated or purified GA or GA variant polypeptide is sometimes desired, in some embodiments, a host cell expressing a GA or GA variant polypeptide is employed directly in an process that requires glucoamylase activity. Thus, enrichment, isolation or purification of the desired GA or GA variant polypeptide is not always required to obtain a GA or GA variant polypeptide composition that finds use in a desired assay or process that requires, or would benefit from, glucoamylase activity. In one such example, GA or GA variant-expressing yeast cells may be added directly into a fermentation process such that the yeast cell expresses the GA or variant GA directly into the fermentation broth where its glucoamylase activity converts a non-fermentable substrate into fermentable sugars for the yeast cell to convert directly to a desired product, e.g., into ethanol (see, e.g., Ilmn et al., High level secretion of cellobiohydrolases by Saccharomyces cerevisiae Biotechnology for Biofuels 2011, 4:30).
VI. Compositions
[0186] Compositions that include one or more GA or variant GA as disclosed herein are contemplated. The GAs and variant GAs described herein may be used in enzyme compositions including but not limited to starch hydrolyzing and saccharifying compositions, cleaning and detergent compositions (e.g., laundry detergents, dish washing detergents, and hard surface cleaning compositions), alcohol and/or biochemical fermentation compositions, and in animal feed compositions. Further, the variant glucoamylases may be used in baking applications, such as bread and cake production, brewing, healthcare, textile, food, environmental waste conversion processes, bio pulp processing, and biomass conversion applications.
[0187] In some embodiments, an enzyme composition including one or more GAs or variant GAs encompassed by the disclosure (e.g., obtained in culture media or recovered and purified from the culture medium) will be used in combination with any one or a combination of the following enzymes: alpha amylases, proteases, pullulanases, isoamylases, cellulases, hem icellulases, xylanases, cyclodextrin glycotransferases, lipases, transferases, phytases, laccases, oxidases, redox enzymes, esterases, cutinases, granular starch hydrolyzing enzyme and other glucoamylases.
[0188] In some representative compositions, one or more GA or variant GAs as described herein will be combined with an alpha amylase, such as fungal alpha amylases (e.g., derived from a Trichoderma sp.) or bacterial alpha amylases (e.g., derived from a Bacillus sp.), including variants, chimeras, and hybrids thereof. In certain embodiments the alpha amylase is an acid stable alpha amylase. In certain embodiments, the alpha amylase is a granular starch hydrolyzing enzyme (GSHE). Commercially available alpha amylases contemplated for use in the GA or variant GA compositions as described herein are available (e.g., from Danisco US Inc. or Novozymes).
[0189] In other embodiments, one or more GAs or variant GAs as described herein can be combined with other GAs, either variant or native. In some embodiments, the GAs of the disclosure will be combined with one or more GAs derived from strains of Aspergillus or variants thereof, such as A. oryzae, A. niger, A. kawachi, and A. awamori; glucoamylases derived from strains of Humicola or variants thereof; glucoamylases derived from strains of Talaromyces or variants thereof, particularly T. emersonii, T. stipitatus; glucoamylases derived from strains of Athelia or variants thereof, particularly A. rolfsii; glucoamylases derived from strains of Penicillium or variants thereof, particularly P. chrysogenum; P. oxalicum; Trametes, Thermomyces, Neurospora, Phanerochaete, Ganoderma, Neosartoryia, Schizophyllum, Acremonium, Artomyces, Athelia, Aureobasidium, Byssocorticium, Chrysosporium, Coniochaeta, Disporotrichum, Fusarium, Gibberella, Gloeophillum, Leucopaxillus, Meripilus, Mucor, Myceliophthora, Sporotrichum, Neurospora, Nigrofomes, Pachykytospora, Penicillium, Piromyces, Rhizomucor, Rhizopus, Schizophyllum, Steccherinum, Subulispora, Syncephalastrum, Talaromyces, Thermoascus, Thermomyces, Thielavia, Trametes, Valsaria; and glucoamylases derived from strains of Trichoderma or variants thereof, particularly T. reesei.
VII. Utility of GA and GA Variants
[0190] As detailed above, GAs are very important commercial enzymes used in a wide variety of applications that require the hydrolysis of starch substrates to fermentable sugars (e.g., glucose, maltose, maltotriose, etc.). GAs are used in processes to produce high fructose corn sweeteners, which comprise over 50% of the sweetener market in the United States, as well as in processes for the direct production of glucose. In general, glucoamylases may be, and commonly are, used with alpha-amylases in starch hydrolyzing processes to hydrolyze starch to dextrins and then to glucose. The glucose may be used directly; be converted to fructose by other enzymes (e.g., glucose isomerases); crystallized; or used in fermentations to produce numerous end products (e.g., ethanol, citric acid, succinic acid, ascorbic acid intermediates, glutamic acid, glycerol, 1,3-propanediol and lactic acid).
[0191] The one or more GA or GA variant or combinations thereof, may also be effective in direct hydrolysis of starch for syrup and/or biochemicals (e.g., alcohols, organic acids, amino acids, other biochemicals and biomaterials) where the reaction temperature is below the gelatinization temperature of substrate.
[0192] In addition, the one or more GA or GA variant or combinations thereof can be useful in a one-step enzymatic conversion process, simultaneous liquefaction and saccharification (SLS), to produce high glucose syrup from gelatinized starch using a liquefying alpha-amylase and a saccharifying glucoamylase above the starch gelatinization temperature. Starch concurrently undergoes gelatinization, liquefaction, and saccharification during simultaneous liquefaction and saccharification in the disclosed methods. In contrast, granular starch still maintains crystalline structure during incubation in a no-cook or a direct-starch-to-glucose (DSTG) process. Therefore, due to immediate gelatinization of starch at its operating temperature, SLS significantly reduces the required time for starch solubilization compared to DSTG.
[0193] Given the commercial importance of GAs, it can be appreciated that the desired GA or GA variant-encoding nucleic acids, the desired GA or GA variant polypeptides and compositions comprising the same find utility in a wide variety applications. The improved property or properties of the GAs or GA variants described herein can be exploited in many ways. For example, GAs or GA variants with improved performance under conditions of thermal stress can be used to increase starch hydrolysis activity in processes carried out at high temperatures (e.g., temperatures at which the parent GA would perform poorly), allowing a user to reduce the total amount of GA employed (as compared to using the parent GA). Other improved properties of GA or GA variant polypeptides can be exploited, including GAs or GA variants having altered pH optima, increased stability or activity at a specific pH, increased specific activity for a substrate, and/or high level expression in a host cell of interest.
[0194] A starch hydrolysis composition containing a desired GA or GA variant as described herein finds use in ethanol production. Ethanol from this process can be further used as an octane enhancer or directly as a fuel in lieu of gasoline, which is advantageous, because ethanol as a fuel source is more environmentally friendly than petroleum derived products. It is known that the use of ethanol will improve air quality and possibly reduce local ozone levels and smog. Moreover, utilization of ethanol in lieu of gasoline can be of strategic importance in buffering the impact of sudden shifts in non-renewable energy and petro-chemical supplies.
[0195] Separate saccharification and fermentation is a process whereby starch present in a feedstock, e.g., corn, is converted to glucose and subsequently an ethanologen (e.g., a yeast strain) convert the glucose into ethanol. Simultaneous saccharification and fermentation (SSF) is a process whereby starch present in a feedstock is converted to glucose and, at the same time and in the same reactor, an ethanologen converts the glucose into ethanol. Thus, the GA or GA variants of the invention find use in the both of these processes for the degradation of starch-containing feedstock to generate ethanol.
[0196] In some embodiments, a GA or GA variant as described herein is expressed in an ethanologen whereby the enzymatic activity of the variant GA expressed by the ethanologen generates glucose that can be converted to ethanol by the ethanologen.
[0197] GA or GA variants as described herein find use in generating host cells for producing biochemical products of interest. As such, aspects of the present disclosure include methods of producing a biochemical by obtaining a host cell expressing a GA or GA variant as described herein and culturing the host cell under conditions to produce the biochemical of interest. It is envisioned that such conditions can include, for example pH conditions of pH 3-8 and for example, temperature conditions of 25-95 C. The host cell may include additional modifications to promote production of the desired biochemical, e.g., to express homologous or heterologous genes, additional variant genes, and/or to delete or otherwise inactivate the expression of one or more endogenous genes. Biochemicals of interest include, but are not limited to alcohols (ethanol, methanol, butanol, etc.) and other organic compounds, including volatile organic molecules (e.g., isoprene).
[0198] It is noted that GAs or GA variants with decreased thermostability find use, for example, in areas where the enzyme activity is required to be neutralized at lower temperatures, so that other enzymes that may be present are left unaffected.
[0199] One aspect of the invention relates to the use of the GA or GA variant polypeptide according to the invention in the production of a fermented beverage, such as a beer. As such, aspects of the present disclosure include a method of providing/producing a fermented beverage comprising the step of contacting a mash and/or a wort with a GA or GA variant polypeptide as described herein. A further aspect relates to a method of providing a fermented beverage comprising the steps of: (a) preparing a mash, (b) filtering the mash to obtain a wort, and (c) fermenting the wort to obtain a fermented beverage, such as a beer, wherein a GA or GA variant polypeptide is added to: (i) the mash of step (a) and/or (ii) the wort of step (b) and/or (iii) the wort of step (c).
[0200] According to yet another aspect, a fermented beverage, such as a beer, is produced or provided by a method comprising the step(s) of (1) contacting a mash and/or a wort with a GA or GA variant polypeptide as described herein; and/or (2) (a) preparing a mash, (b) filtering the mash to obtain a wort, and (c) fermenting the wort to obtain a fermented beverage, such as a beer, wherein a GA or GA variant polypeptide is added to: (i) the mash of step (a) and/or (ii) the wort of step (b) and/or (iii) the wort of step (c).
[0201] Aspects of the invention also include a fermented beverage, such as a beer, produced using a GA or GA variant as described above.
[0202] The term beer is meant to include any fermented wort produced by fermentation/brewing of a starch-containing plant material. Often, beer is produced from malt or adjunct, or any combination of malt and adjunct as the starch-containing plant material.
[0203] As used herein the term malt is understood as any malted cereal grain, such as malted barley or wheat.
[0204] As used herein the term adjunct refers to any starch and/or sugar containing plant material which is not malt, such as barley or wheat malt. As examples of adjuncts, mention can be made of materials such as common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, corn (maize), potato, tapioca, cassava and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like may be used as a source of starch.
[0205] As used herein, the term mash refers to an aqueous slurry of any starch and/or sugar containing plant material such as grist, e. g. comprising crushed barley malt, crushed barley, and/or other adjunct or a combination hereof, mixed with water later to be separated into wort and spent grains.
[0206] As used herein, the term wort refers to the unfermented liquor run-off following extracting the grist during mashing.
[0207] In another aspect the invention relates to a method of preparing/producing a fermented beverage such as beer comprising mixing the polypeptide of the invention with malt or adjunct.
[0208] Examples of beers produced according to the uses and methods above (i.e., in which a GA variant as described herein is used) include, but are not limited to, the following: full malted beer, beer brewed under the Reinheitsgebot, ale, India Pale Ale (IPA), lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, non-alcoholic malt liquor and the like, but also alternative cereal and malt beverages such as fruit flavored malt beverages, e. g. citrus flavored, such as lemon-, orange-, lime-, or berry-flavored malt beverages, liquor flavored malt beverages, e. g., vodka-, rum-, or tequila-flavored malt liquor, or coffee flavored malt beverages, such as coffee-flavored malt liquor, and the like.
[0209] As seen from above, GA or GA variant polypeptides (and the nucleic acids encoding them) with improved properties as compared to their parent GA enzymes find use in improving any of a number of assays and processes that employ cellobiohydrolases.
EXAMPLES
[0210] The present invention is described in further detail in the following examples which are not in any way intended to limit the scope of the invention as claimed. The attached Figures are meant to be considered as integral parts of the specification and description of the invention. All references cited are herein specifically incorporated by reference for all that is described therein.
Example 1
[0211] I. Effect of Enzyme Concentration on the Comparison of A. niger-GA (An-GA) and Fusarium verticillioides GA (Fv-GA) During Saccharification
[0212] A series of experiments were performed to determine if the novel blend of glucoamylase (An-GA+Fv-GA) produces higher glucose yield compared to the final glucose yield with individual glucoamylases (An-GA, Fv-GA) under a typical saccharification condition. The experiments were carried out using 33.5% ds corn starch liquefact and the pH of the liquefact was adjusted to pH 4.4 using dilute acid. The starch liquefact was placed in a water bath maintained at 60 C. and enzyme(s) were added. All the treatments with just Fv-GA had 0.32 SSUs of AkAA acid stable alpha amylase to match the acid stable alpha amylase present in the An-GA commercial product. The starch liquefact was maintained at 60 C. for 48 hrs and samples were drawn throughout the incubation to analyze the saccharide profile. The glucoamylase dosages are given in GAUs/g DS corn starch and/or g/g ds and the saccharide profiles at various intervals are given in Tables 1, 2 and 3.
[0213] Table 1 shows the saccharide profile for OPTIMAX L-400 (commercial product name for glucoamylase An-GA from DuPont Industrial Bioscience) at various dosages. It can be observed that at various dosages An-GA is unable to reach >95.5% glucose at the end of 48 hr.
[0214] Table 2 shows the saccharide profile for Fv-GA at various dosages. It can be observed that at various dosages Fv-GA is also unable to reach >95.5% glucose at the end of 48 hr.
[0215] Table 3 shows the saccharide profile for the blends of An-GA (OPTIMAX L-400)+Fv-GA at various blend ratios, an unexpected increase in final glucose yield greater than 95.5% was observed.
TABLE-US-00001 TABLE 1 Saccharide distribution for various An-GA (OPTIMAX L-400) dosages Avg Avg Avg Avg Sample Dos- Time, (% (% (% (% Name age Unit hr DP4+) DP3) DP2) DP1) OPTIMAX 140 g/g 18 6.05 0.5 2.03 91.42 L-400 ds 24 4.05 0.45 2.27 93.23 41 1.83 0.37 2.96 94.84 48 1.29 0.31 3.15 95.25 OPTIMAX 120 g/g 18 8.06 0.55 2.03 89.36 L-400 ds 24 5.18 0.48 2.18 92.17 41 2.31 0.39 2.78 94.52 48 1.62 0.3 2.92 95.16 OPTIMAX 80 g/g 18 11.83 0.64 2.1 85.42 L-400 ds 24 8.4 0.58 1.96 89.06 41 3.97 0.37 2.17 93.48 48 3.35 0.42 2.45 93.77 OPTIMAX 40 g/g 18 21.34 0.51 6.24 71.92 L-400 ds 24 16.98 0.63 3.44 78.96 41 9.89 0.64 2.02 87.45 48 8.29 0.6 2.01 89.1
TABLE-US-00002 TABLE 2 Saccharide distribution for various Fv-GA (Fusarium-GA) dosages Avg Avg Avg Avg Sample Time, (% (% (% (% Name Dosage Unit hr DP4+) DP3) DP2) DP1) Fv-GA 120 g/g ds 16.5 7.87 0.61 4.74 86.77 23 1.79 0.56 3.36 94.28 41.5 0.79 0.5 3.71 95 48 0.71 0.5 3.85 94.94 Fv-GA 80 g/g ds 16.5 13.26 1.03 6.13 79.58 23 4.22 0.63 3.8 91.35 41.5 1.1 0.55 3.03 95.32 48 0.93 0.54 3.07 95.46 Fv-GA 60 g/g ds 16.5 12.92 1.16 6.15 79.78 23 5.92 0.71 4.3 89.08 41.5 1.55 0.62 2.94 94.9 48 1.31 0.6 2.89 95.19
TABLE-US-00003 TABLE 3 Saccharide distribution for various An-GA (OPTIMAX L-400) and Fv-GA (Fusarium verticilloides-GA) dosages blend ratios Avg Avg Avg Avg Time, (% (% (% (% Sample Name Dosage Unit hr DP4+) DP3) DP2) DP1) OPTIMAX 120 + 10 g/g 17 7.11 0.52 2.33 90.04 L400 + Fv-GA ds + 24 4.17 0.56 2.3 92.98 g/g 41 1.11 0.39 2.82 95.68 ds 45 0.97 0.39 2.93 95.72 OPTIMAX 80 + 40 g/g 18 4.06 0.62 2.28 93.04 L400 + Fv-GA ds + 24 1.77 0.49 2.24 95.49 g/g 41 0.73 0.44 2.82 96 ds 48 0.68 0.43 2.91 95.98 OPTIMAX 60 + 60 g/g 18 3.91 0.62 2.39 93.08 L400 + Fv-GA ds + 24 1.69 0.52 2.3 95.49 g/g 41 0.73 0.46 2.76 96.05 ds 48 0.57 0.42 2.8 96.21 OPTIMAX 40 + 80 g/g 18 4.31 0.57 2.38 92.75 L400 + Fv-GA ds + 24 1.83 0.5 2.35 95.31 g/g 41 0.87 0.42 2.67 96.04 ds 48 0.77 0.42 2.8 96.01 OPTIMAX 20 + 100 g/g 18 5.56 0.54 2.56 91.34 L400 + Fv-GA ds + 24 2.59 0.54 2.39 94.47 g/g 41 1.03 0.44 2.47 96.05 ds 48 0.97 0.47 2.6 95.96
[0216] The data shown in Tables 1-3 support a surprising discovery that the blend of An-GA+Fv-GA performed better and produced >95.5% glucose whereas the individually used An-GA and Fv-GA did not produce >95.5% glucose. The discovered enzyme blend is beneficial for the glucose syrup producers as blending of An-GA+Fv-GA resulted in higher glucose yield.
Example 2
[0217] I. Effect of Different Glucoamylases (Purified Glucoamylases from Trichoderma reesei (Tr-GA), Humicola grisea (H-GA), Aspergillus fumigatus (Afu-GA), and Fusarium Verticilloides (Fv-GA)) with an-GA on the Glucose Production During Standard Saccharification
[0218] Experiments were performed to determine the effect of different glucoamylases blend on the glucose production when blended with the An-GA. The experiments were carried out using 33.5% ds starch liquefact and the pH of the liquefact was adjusted to pH 4.4. The starch liquefact was placed in a water bath maintained at 60 C. and enzyme(s) were added. The starch liquefact was maintained at 60 C. for 48 hrs and samples were drawn throughout the incubation to analyze the saccharide profile (shown in Table 4).
[0219] Table 4 shows the saccharide profile for treatments with different glucoamylases added at 10 g/g ds dosage (purified glucoamylase protein) with An-GA (OPTIMAX L-400). Among all the glucoamylases tested, only Fv-GA was effective when blended with An-GA resulting in higher glucose to greater than 95.5% at 48 hr.
TABLE-US-00004 TABLE 4 Saccharide distribution for An-GA (OPTIMAX L-400) blends with various glucoamylase Avg Avg Avg Avg Time, (% (% (% (% Sample Name Dosage Unit hr DP4+) DP3) DP2) DP1) OPTIMAX 120 g/g 24 6.05 0.56 2.16 91.22 L-400 ds 41 2.47 0.44 2.74 94.36 48 2.17 0.43 2.85 94.54 OPTIMAX 120 + 10 g/g 24 5.67 0.54 2.26 91.53 L-400 + An-GA ds + 41 2.16 0.43 2.88 94.52 g/g 48 1.79 0.39 2.95 94.87 ds OPTIMAX 120 + 10 g/g 24 4.23 0.43 2.37 92.97 L-400 + Tr-GA ds + 43 1.66 0.41 3.21 94.72 g/g 46 1.24 0.39 3.41 94.97 ds OPTIMAX 120 + 10 g/g 24 5.19 0.53 2.22 92.06 L-400 + Afu-GA ds + 41 2.05 0.42 2.88 94.65 g/g 48 1.82 0.42 3.01 94.75 ds OPTIMAX 120 + 10 g/g 24 4.65 0.46 2.34 92.55 L-400 + H-GA ds + 43 1.71 0.42 3.09 94.78 g/g 46 1.23 0.36 3.23 95.18 ds OPTIMAX 120 + 10 g/g 24 4.17 0.56 2.3 92.98 L-400 + Fv-GA ds + 41 1.11 0.39 2.82 95.68 g/g 48 0.97 0.39 2.93 95.72 ds
Example 3
[0220] I. Effect of Different Glucoamylases (Purified Glucoamylases from Trichoderma reesei (Tr-GA), Humicola grisea (H-GA), Aspergillus niger (an-GA), and Fusarium Verticilloides (Fv-GA)) with A. fumigatus-GA (Afu-GA) on Glucose Production During Standard Saccharification
[0221] A set of experiments were performed to determine if different glucoamylases show similar effect with Afu-GA as they have shown when blended with An-GA (discussed in Example 2). The experiments were carried out using 33.5% ds starch liquefact and the pH of the liquefact was adjusted to pH 4.4. The starch liquefact was placed in a water bath maintained at 60 C. and enzyme(s) were added. Only purified enzyme proteins were used for these experiments so all the enzyme treatments had 0.32 SSUs of AkAA acid stable alpha amylase to match the commercial An-GA product. The starch liquefact was maintained at 60 C. for 48 hrs and samples were drawn throughout the incubation to analyze the saccharide profile (shown in Table 5).
[0222] Table 5 shows the saccharide profile for the various glucoamylase added with Afu-GA at 10 g/g ds dosage. Similar to the observation made in Example 2 with An-GA, among all the glucoamylases tested only Fv-GA was effective when blended with Afu-GA to increase the glucose to greater than 95.5% at 48 hr. This observation shows that Fv-GA enhances the glucose production when blended with An-GA or Afu-GA, whereas other tested glucoamylases have no significant effect when blended with An-GA and Afu-GA.
TABLE-US-00005 TABLE 5 Saccharide distribution for Afu-GA (A. fumigatus-GA) blends with various glucoamylase. Avg Avg Avg Avg Sample Dosage Time, (% (% (% (% Name (g/gds) Unit hr DP4+) DP3) DP2) DP1) Afu-GA 100 g/g 15.5 11.81 0.58 3.06 84.56 ds 24 6.03 0.48 2.21 91.27 43 2.47 0.43 2.84 94.26 46 1.94 0.4 2.99 94.68 Afu-GA + 100 + 10 g/g 15.5 11.48 0.49 3.26 84.77 Afu-GA ds + 24 5.54 0.51 2.39 91.56 g/g 43 2.17 0.42 3.02 94.39 ds 46 1.68 0.4 3.18 94.73 Afu-GA + 100 + 10 g/g 15.5 10.58 0.53 2.74 86.14 Tr-GA ds + 24 5.21 0.53 2.46 91.79 g/g 43 1.94 0.43 3.17 94.46 ds 46 1.48 0.4 3.35 94.77 Afu-GA + 100 + 10 g/g 15.5 13 0.51 4.05 82.45 An-GA ds + 24 5.99 0.52 2.37 91.12 g/g 43 2.16 0.38 2.9 94.56 ds 46 1.73 0.38 3.11 94.78 Afu-GA + 100 + 10 g/g 15.5 12.64 0.62 4.23 82.51 H-GA ds + 24 5.75 0.49 2.33 91.43 g/g 43 2.28 0.43 2.92 94.37 ds 46 1.64 0.4 3.08 94.87 Afu-GA + 100 + 10 g/g 15.5 11.28 0.53 3.38 84.81 Fv-GA ds + 24 4.84 0.54 2.37 92.26 g/g 43 1.53 0.41 2.88 95.18 ds 46 0.86 0.39 3.04 95.70
Example 4
I. Effect of Afu-GA and Fv-GA Blend on DP1 (% Glucose)
[0223] Experiments were performed with Afu-GA, Fv-GA and a blend of Afu-GA+Fv-GA to determine the effect on % glucose produced under a typical saccharification condition. The experiments were carried out using 33.5% ds starch liquefact and the pH of the liquefact was adjusted to pH 4.4. The starch liquefact was placed in a water bath maintained at 60 C. and enzyme(s) were added. All the enzyme treatments had 0.32 SSUs of AkAA acid stable alpha amylase. The starch liquefact was maintained at 60 C. for 48 hrs and samples were drawn throughout the incubation to analyze the saccharide profile (shown in
[0224]
Example 5
I. Effect of Different Blend Ratios of Afu-GA and Fv-GA
[0225] Experiments were performed with different blend ratios of Afu-GA and Fv-GA to determine the optimum ratio of glucoamylases (proteins) to be used for maximum glucose production under a typical saccharification condition. The experiments were carried out using 33.5% ds starch liquefact and the pH of the liquefact was adjusted to pH 4.4. The starch liquefact was placed in a water bath maintained at 60 C. and enzyme(s) were added. Only purified enzyme proteins were used in this set of experiments so all the enzyme treatments had 0.32 SSUs of AkAA acid stable alpha amylase to match the acid stable alpha present in An-GA commercial product. The starch liquefact was maintained at 60 C. for 48 hrs and samples were drawn throughout the incubation to analyze the saccharide profile (shown in Table 6).
[0226] Table 6 shows the saccharide profile for the novel blend with different protein ratios of Afu-GA and Fv-GA. When the Afu-GA is used alone at 80 g/g ds, it does not reach 95.5% glucose at 48 hrs. But when the Afu-GA is blended with Fv-GA at various ratios (keeping the total protein constant at 80 g/g ds), all the blends reach >95.5% glucose at 48 hrs. Hence the blend of Afu-GA+Fv-GA at equal total glucoamylase protein resulted in the highest level of glucose production compared to Afu-GA by itself.
TABLE-US-00006 TABLE 6 Saccharide distribution for Afu-GA and Fv-GA blends at various protein ratios. Avg Avg Avg Avg Sample Time, (% (% (% (% Name Dosage Unit hr DP4+) DP3) DP2) DP1) AfuGA 80 g/g ds 18 10.53 0.57 2.11 86.8 24 7.29 0.54 2.08 90.09 41 3.31 0.39 2.43 93.87 48 2.58 0.37 2.6 94.45 AfuGA + 60 + 20 g/g ds + 18 8.62 0.63 2.58 88.17 Fv-GA g/g ds 24 5.08 0.59 2.22 92.11 41 1.72 0.43 2.37 95.48 48 1.29 0.41 2.5 95.79 AfuGA + 40 + 40 g/g ds + 18 8.1 0.65 3.27 87.99 Fv-GA g/g ds 24 4.13 0.57 2.41 92.88 41 1.44 0.51 2.35 95.7 48 1.07 0.46 2.4 96.07 AfuGA + 20 + 60 g/g ds + 18 6.64 0.64 3.49 89.23 Fv-GA g/g ds 24 3.66 0.66 2.8 92.88 41 1.42 0.59 2.48 95.51 48 1.18 0.57 2.5 95.75
[0227]
Example 6
I. Effect of Different Blend Ratios of Afu-GA and Fv-GA at Various pH Conditions
[0228] A set of experiments were performed with a blend of Afu-GA+Fv-GA and compared to results for a commercial product, OPTIMAX 4060 VHP. The experiments were carried out using 33.5% ds starch liquefact and the pH of the liquefact was adjusted to pH 4.4 and/or 5.5. The starch liquefact was placed in a water bath maintained at 60 C. and enzyme(s) were added. All the enzyme treatments with non-commercial purified enzymes had 0.32 SSUs of AkAA acid stable alpha amylase to match the commercial product. The starch liquefact was maintained at 60 C. for 48 hrs and samples were drawn throughout the incubation to analyze the saccharide profile (shown in
[0229]
Example 7
I. Effect of a De-Branching Enzyme, Pullulanase (PU), on a Range of Blend Ratios of Afu-GA and Fv-GA.
[0230] A set of experiments were performed with the commercial product OPTIMAX 4060 VHP as it already contains a pullulanase de-branching enzyme which helps it in achieving 95.5% glucose. Two different glucoamylases (Afu-GA and Fv-GA) were blended in addition to the standard 0.16 GAUs/g ds dosage of OPTIMAX 4060 VHP. The additional glucoamylases Afu-GA and Fv-GA were added at 10 g/g ds.
[0231] Table 7 shows the saccharide profile for the OPTIMAX 4060 VHP and for the treatments where the additional glucoamylases Afu-GA or Fv-GA are added in addition to the standard OPTIMAX 4060 VHP dosage. The standard dosage of OPTIMAX 4060 VHP reaches the 95.52% glucose in 72 hr. The addition of glucoamylase Afu-GA does not increase the % glucose at the 72 hr saccharification time and reaches 95.6% glucose which is similar to OPTIMAX 4060 VHP standard dosage.
TABLE-US-00007 TABLE 7 Saccharide distribution for OPTIMAX 4060 VHP and additional blending with the glucoamylases Afu-GA or Fv-GA. Avg Avg Avg Avg Time, (% (% (% (% Sample Name Dosage Unit hr DP4+) DP3) DP2) DP1) OPTIMAX 0.16 GAUs/g 18 14.95 0.34 7.73 76.98 4060 VHP ds 24 10.48 0.38 5.21 83.93 41.5 3.13 0.93 2.69 93.26 49 2.13 0.87 2.47 94.53 72 1.29 0.73 2.46 95.52 OPTIMAX 0.16 + GAUs/g 18 12.16 0.72 4.89 82.23 4060 VHP + 10 ds + 24 7.98 0.81 3.38 87.84 AfuGA g/g ds 41.5 2.52 0.81 2.38 94.29 49 1.84 0.74 2.36 95.05 72 1.23 0.62 2.55 95.6 OPTIMAX 0.16 + GAUs/g 18 10.01 0.77 5.12 84.1 4060 VHP + 10 ds + 24 5.93 0.84 3.57 89.66 Fv-GA g/g ds 41.5 1.26 0.8 2.3 95.65 49 0.93 0.73 2.22 96.12 72 0.77 0.61 2.27 96.35
[0232]
[0233] While each test condition achieved >95% glucose after 72 hrs, the combination of OPTIMAX 4060 VHP+Fv-GA has an unexpected improved effect of increased % glucose to 96.35%, which is significantly higher than observed for the OPTIMAX 4060 VHP standard dosage alone or the OPTIMAX 4060 VHP+Afu-GA treatment.
Example 8
I. The Effect of Fv-GA and Additional GA Blend on Simultaneous Saccharification and Fermentation (SSF) in a Corn to Ethanol Process.
[0234] A corn liquefact was obtained from a commercial fuel alcohol producer. The corn liquefact specifications were 32.84% ds and pH 3.5. The pH of the corn liquefact was adjusted to 4.5 with 4N sodium hydroxide. The experimental SSF process was carried out in replicates simultaneously in 250 ml Erlenmeyer flasks using 100 g of the liquefact per flask. The appropriate amounts of enzymes were added to the liquefact along with dry yeast and 600 ppm urea. The dry yeast is allowed to hydrate by about 10 minutes prior to addition to the flasks. The tested enzyme doses were 1) Tr-GA variant CS4 (CS4) at 25 g g ds and Fv-GA at 25 g g ds; 2) CS4 GA at 50 g g ds and 3) Fv-GA at 50 g g ds. The flasks were covered with rubber stoppers and placed in a forced air incubator at 32 C. with shaking at 200 rpm for 54 hrs. The samples were drawn at regular intervals for ethanol measurements.
[0235] The ethanol data provided in Table 8 shows that for the blend of Fv-GA plus CS4 GA the ethanol rates were higher and the final ethanol concentrations were also highest among the compared treatments. The blend of GAs at equal total protein addition was better as compared to individual GA addition at equal total protein loading. This shows a synergistic effect of the Fv-GA with the other GA.
[0236] A similar effect was observed for the DP4+ reduction as the blend of Fv-GA plus CS4 achieved the lowest DP4+ compared to the individual GA additions at equal total protein addition.
[0237] Lower DP4+ and higher ethanol is significant for the commercial ethanol producer as this advantage translates to higher conversion of the substrate to the desired end product, e.g., ethanol.
TABLE-US-00008 TABLE 8 The % w/v ethanol and % w/v DP4+ distribution for the CS4 + Fv-GA blend, CS4 GA and Fv-GA showing lower % w/v DP4+ and higher % w/v ethanol for the GA blend. Avg StdDev Avg StdDev Sample Time, (% w/v (% w/v (% w/v (% w/v Name Dosage Unit hr DP4+) DP4+) Ethanol) Ethanol) CS4 GA + 25 + 25 g 12 9.15 0.14 5.48 0.08 Fv-GA g ds 28 4.34 0.05 10.11 0.02 54 0.74 0.06 11.68 0.06 CS4 GA 50 g 12 8.84 0.06 5.36 0.19 g ds 28 4.79 0.04 9.98 0.08 54 1.03 0.07 11.46 0.03 Fv-GA 50 g 12 10.78 0.12 4.74 0.08 g ds 28 6.21 0.06 8.72 0.02 54 1.09 0.11 11.32 0.03
[0238]
[0239]
Example 9
I. The Effect of Fv-GA and an Additional GA Blend on Saccharification Under Biochemical Fermentation Conditions of pH 7.0 and at 37 C.
[0240] Experiments were performed with Afu-GA, HGA, TrGA, Fv-GA and a blend of HGA+Fv-GA to determine the effect of individual GA enzymes and GA blends on final % glucose. The experiments were carried out using 33.5% ds starch liquefact and the pH of the liquefact was adjusted to pH 7.0. The starch liquefact was placed in a water bath maintained at 37 C. and enzyme(s) were added. The starch liquefact was maintained at 37 C. for 72 hrs and samples were drawn throughout the incubation to analyze the saccharide profile.
[0241] The data in Table 9 shows that the Fv-GA at 80 g/g ds was much faster and achieved highest final % glucose compared to other GAs (also added at 80 g/g ds). Also, Fv-GA added at 80 g/g ds was slightly better compared to HGA at 160 g/g ds.
[0242] The data also shows that the blend of Fv-GA at 40 g/g ds and HGA 160 g/g ds is better when compared to HGA at 320 g/g ds (Table 10). This shows a significant and unexpected synergy between Fv-GA and HGA. The blend of Fv-GA and HGA (total protein addition of 200 g/g ds, with Fv-GA at 40 g/g ds and HGA 160 g/g ds) reaches lower amount of DP4+ and highest amount of % DP1 compared to HGA even at 320 g/g ds.
TABLE-US-00009 TABLE 9 Saccharide distribution for Afu-GA, Fv-GA, HGA, and TrGA at 80 g/g ds protein dosage during saccharification under biochemical fermentation conditions of 37 C. and pH 7.0 Avg Avg Avg Avg Sample Time, (% (% (% (% Name Dosage Unit hr DP4+) DP3) DP2) DP1) AfuGA 80 g/g 20 48.85 4.42 8.46 38.27 ds 50 23.49 0.56 2.03 73.92 72 18.04 0.62 1.4 79.94 Fv-GA 80 g/g 20 33.53 2.27 8.11 56.08 ds 50 13.38 0.61 2.27 83.73 72 6.69 0.63 1.96 90.72 HGA 80 g/g 17 50.61 6.25 8.86 34.28 ds 48 23.18 0.66 4.06 72.09 72 16.62 0.69 1.83 80.86 HGA 160 g/g 20 43.44 3.02 8.14 45.4 ds 42 17.24 0.73 2.12 79.9 72 8.62 0.53 2.14 88.71 TrGA 80 g/g 20 35.17 1.26 7.36 56.2 ds 50 20.99 0.65 1.79 76.57 72 16.7 0.52 2.06 80.73
TABLE-US-00010 TABLE 10 Saccharide distribution for Fv-GA + HGA blend and HGA at higher dosages showing the blend of Fv-GA plus HGA performs better compared to HGA at higher dosage during saccharification under biochemical fermentation conditions of 37 C. and pH 7.0 Avg Avg Avg Avg Sample Time, (% (% (% (% Name Dosage Unit hr DP4+) DP3) DP2) DP1) Fv-GA + 40 + 160 g/g 20 19.4 0.56 3.97 76.07 HGA ds 50 3.57 0.64 2.09 93.7 72 2.43 0.59 2.76 94.22 HGA 160 g/g 20 43.44 3.02 8.14 45.4 ds 50 14.18 0.67 1.76 83.39 72 8.62 0.53 2.14 88.71 HGA 320 g/g 20 27.18 1.43 5.96 65.42 ds 50 5.88 0.44 2.2 91.48 72 3.61 0.45 3.21 92.73
Example 10
I. The Effect of Fv-GA and an Additional GA Blend on the Direct Starch to Glucose (DSTG) Process
[0243] Experiments were performed with Afu-GA, Fv-GA and a blend of Afu-GA+Fv-GA to determine the effect of the enzyme and enzyme blends on final % solubility and % glucose. The experiments were carried out using 32% ds raw tapioca starch and the pH of the tapioca starch slurry was left as is as at pH 5.2. The enzymes were added as such 1) Afu-GA at 80 g/g ds 2) Afu-GA at 40 g/g ds+Fv-GA at 40 g/g ds and 3) Fv-GA at 80 g/g ds. All the treatments also included 10 AAUs of the alpha-amylase product SPEZYME Xtra (DuPont). The slurry was mixed at room temperature to blend the added enzymes. A 35 g aliquot with 2 replications for each treatment was weighed into LABOMAT steel beakers. The metal beakers were fitted back into the LABOMAT for incubation at 60 C for 72 hrs with clockwise and counter-clockwise constant mixing at 60 rpm. Samples were drawn throughout the incubation to analyze the saccharide profile.
[0244] The data in Table 11 shows that the blend of Fv-GA plus Afu-GA achieves % solubility of 96.51 in 72 hrs and the individually added Afu-G or Fv-GA achieve 93.05 and 94.89% solubility, respectively. Also, the % DP1 and % DP4+ values for the blend of Fv-GA and Afu-GA were 96.51% and 0.71%, respectively. This shows that the blend of Fv-GA plus Afu-GA unexpectedly achieved the lowest amount of DP4+ and highest amount of % DP1 compared to the individually added Afu-GA or Fv-GA.
TABLE-US-00011 TABLE 11 Saccharide distribution and % solubility for AfuGA, Fv-GA + Afu-GA blend and Fv-GA showing the blend of Fv-GA plus AfuGA performs better compared to individually added Afu-GA and Fv-GA during DSTG of tapioca starch at 60 C. and pH 5.2 Avg Avg Avg Avg Avg (% Sample Dos- Time, (% (% (% (% Solu- Name age Unit hr DP4+) DP3) DP2) DP1) bility) Afu-GA 80 g/g 24 5.49 2.16 2.55 89.8 83.9 ds 48 3.65 1.87 2.45 92.03 92.14 72 1.95 1.69 2.31 94.06 93.05 Afu-GA + 40 + g/g 24 2.4 1.63 2.49 93.48 86.31 Fv- 40 ds 48 1 1.21 2.21 95.58 95.12 GA 72 0.71 1.07 2.69 95.53 96.51 Fv-GA 80 g/g 24 2.93 1.46 2.66 92.95 85.65 ds 48 1.86 1.14 3.01 93.99 93.74 72 1.36 1.11 3.67 93.85 94.89
TABLE-US-00012 SEQUENCELISTING Fv-GAProteinSequence: SEQIDNO:1 MFTQILYGLTALSALQGQVTASPGGSSLDRFISKEADISIKGVLANIGADGKRAQGAAPGAVVASPSRTD PDYWYTWTRDSALTYKVLVERFIHGDKSLQRKIDEYVSAQAKLQGVTNPSGGPESGGLGEPKFHVNLTAF TGSWGRPQRDGPPLRATALTLYANWLVSHGDRSKAVNKVWPVIEKDLAYTVKFWNRTGYDLWEEVNGSSF FTLSASHRALVEGAALAKKLGKSCSDCATNAPRVLCFMQSFWTGSYIDSNINVNDGRKGLDANSILSSIH TFDPSSKCTDSTFQPCSSRALANHKEVVDSFRSIYGVNKNRGKGKAAAVGRYSEDVYYDGNPWYLATLAA AEQLYAAVYQWNKIGSITVDSVSLPFFSDLVPKVSKGTYRKNSKTYKAIIKAVTSYADGFVAVVQTYTPK DGSLAEQFDKSTGTPKSAVHLTWSYASFVGAAERRTGVVPPAWGESNANKVPAVCEAAPACDTTITFNVK NVDVTSDQKVYIVGGITQLSNWAPADGIALEESTSTKGLWTVKVKIPSDTSFEYKYIKKTSDGTVTWESD PNNSAATGSKCGSSSTINDEWR Fv-GADNANucleotideSequence: SEQIDNO:2 ATGTTTACTCAGATCTTGTATGGCCTCACGGCCTTATCTGCCCTCCAAGGTCAGGTCACTGCATCACCAG GCGGTTCCAGCCTTGATCGCTTCATTTCCAAAGAGGCCGACATCTCCATCAAGGGCGTGCTTGCCAATAT TGGCGCCGATGGCAAGCGAGCCCAAGGCGCTGCACCTGGCGCCGTTGTAGCAAGTCCATCGAGAACAGAT CCAGACTGTAAGTCAATATTCTTGATAGTATCGCAAATGGATGACTGAGACGTTTTCTAGACTGGTACAC ATGGACCCGAGACTCCGCCTTGACATACAAAGTCCTTGTTGAGCGCTTCATTCACGGAGACAAGTCTCTC CAGCGCAAGATCGACGAATATGTCTCTGCCCAAGCCAAGCTCCAGGGCGTCACCAACCCATCTGGCGGCC CCGAGTCAGGCGGCCTTGGGGAACCCAAGTTTCACGTCAACCTCACAGCTTTCACAGGATCCTGGGGTCG TCCTCAACGAGATGGCCCTCCTCTGAGAGCTACTGCATTGACGCTGTACGCCAACTGGCTTGTTTCTCAC GGCGACCGCTCCAAGGCCGTCAACAAGGTTTGGCCTGTCATTGAGAAGGATCTTGCATACACCGTCAAGT TCTGGAACAGAACCGGTTACGATCTTTGGGAGGAGGTTAACGGATCTTCGTTCTTCACCCTCTCTGCTTC ACATCGTGCTCTGGTTGAGGGAGCTGCTCTTGCTAAGAAGCTTGGCAAGTCTTGCTCCGACTGCGCAACC AACGCCCCCCGTGTTCTCTGCTTCATGCAAAGCTTCTGGACCGGCAGCTACATCGACTCGAACATCAATG TCAACGATGGCCGCAAGGGTCTTGATGCCAACTCCATTCTGTCTTCTATTCACACCTTTGATCCTTCTTC GAAGTGCACAGACTCTACCTTCCAGCCTTGTTCTTCAAGGGCTCTTGCGAACCACAAGGAAGTAGTGGAC TCTTTCCGCTCCATCTATGGTGTCAACAAAAACAGAGGTAAAGGTAAAGCTGCTGCTGTCGGTCGATACA GTGAGGATGTGTACTACGACGGTAACCCTTGGTACTTGGCTACTCTTGCTGCTGCCGAGCAACTGTACGC TGCTGTCTATCAATGGAACAAGATCGGTTCCATCACAGTTGATAGTGTGTCGCTCCCCTTTTTCAGTGAC CTTGTACCAAAGGTTTCCAAGGGAACCTATCGCAAGAACAGCAAGACATACAAGGCTATTATCAAGGCTG TCACTTCATACGCTGATGGCTTTGTCGCCGTTGTGCAGACCTATACTCCCAAAGATGGCTCCCTCGCAGA GCAGTTCGATAAGTCTACTGGAACTCCCAAGTCAGCTGTTCACCTAACCTGGTCCTACGCCTCCTTTGTC GGTGCTGCCGAGCGTCGTACTGGCGTCGTTCCTCCAGCTTGGGGCGAGAGCAACGCCAACAAGGTGCCTG CTGTTTGCGAAGCAGCTCCAGCCTGCGACACCACCATCACGTTCAATGTGAAGAACGTTGATGTCACGTC GGACCAGAAGGTTTACATTGTTGGCGGGATCACTCAACTTTCCAACTGGGCCCCTGCTGACGGCATTGCG CTTGAGGAATCCACGAGCACCAAGGGCTTGTGGACTGTGAAGGTCAAGATTCCATCTGATACCAGCTTTG AGTATAAGTATATAAAGAAGACGAGTGATGGAACTGTTACATGGGAGAGTGACCCCAATAACAGTGCGGC GACGGGCAGCAAGTGCGGAAGCAGCAGTACCATCAACGATGAGTGGAGGTAA Afu-GAProteinSequence: SEQIDNO:3 MPRLSYALCALSLGHAAIAAPQLSARATGSLDSWLGTETTVALNGILANIGADGAYAKSAKPGIIIASPS TSEPDYYYTWTRDAALVTKVLVDLFRNGNLGLQKVITEYVNSQAYLQTVSNPSGGLASGGLAEPKYNVDM TAFTGAWGRPQRDGPALRATALIDFGNWLIDNGYSSYAVNNIWPIVRNDLSYVSQYWSQSGFDLWEEVNS MSFFTVAVQHRALVEGSTFAKRVGASCSWCDSQAPQILCYMQSFWTGSYINANTGGGRSGKDANTVLASI HTFDPEAGCDDTTFQPCSPRALANHKVYTDSFRSVYAINSGIPQGAAVSAGRYPEDVYYNGNPWFLTTLA AAEQLYDAIYQWKKIGSISITSTSLAFFKDIYSSAAVGTYASSTSTFTDIINAVKTYADGYVSIVQAHAM NNGSLSEQFDKSSGLSLSARDLTWSYAAFLTANMRRNGVVPAPWGAASANSVPSSCSMGSATGTYSTATA TSWPSTLTSGSPGSTTTVGTTTSTTSGTAAETACATPTAVAVTFNEIATTTYGENVYIVGSISELGNWDT SKAVALSASKYTSSNNLWYVSVTLPAGTTFEYKYIRKESDGSIVWESDPNRSYTVPAACGVSTATENDTW Q Afu-GANucleotideSequence: SEQIDNO:4 atgcctcgcctttcctacgcgctctgtgcgctgtctctcgggcatgctgctattgcagctcctcagttat ccgctcgtgctaccggcagcttggactcctggttgggtactgagaccaccgttgcgctcaatggtattct ggccaacatcggtgccgacggtgcttatgcgaagagcgctaagcctggcataatcattgccagtccgagc accagcgaaccagactgtgagaaccttcctgaactggccctgtccggcagtcattgacctcggtagacta ctatacctggacgagagatgctgctctcgtcacgaaagtcctggtcgacctcttccgcaacggcaacctg ggtctgcagaaagtcattaccgaatacgtcaactctcaggcgtacttgcagaccgtgtctaatccgtcgg gtggtcttgcgagcggaggtctcgcggagcctaagtacaacgtcgacatgacggcctttaccggagcctg gggtcgtcctcagcgtgatggtccggctctgcgggccaccgccctcatcgactttggcaactggctgatt gtatgttctccatacgagccccaggaagcgttgctgacgtctacaggacaacggctactccagctatgct gtcaacaacatctggcccattgtgcgcaacgacttgtcctacgtttctcagtactggagccagagtggct ttggtgagtcccgactctctggaagtttacaacgtgcatcgattactgacaattgagattctacgtgaca gatctctgggaagaagtcaactccatgtccttcttcaccgtcgctgtccagcaccgtgccctcgtggagg gaagcacgttcgctaaacgggtgggagcgtcgtgctcgtggtgtgactcgcaggccccccagatcctctg ctacatgcagagtttctggactggctcgtatatcaacgccaacaccggtggtggccggtccggcaaggat gccaacaccgtcctcgccagcatccataccttcgaccccgaagccggctgcgacgatactactttccagc cctgctctcctcgggcccttgccaaccacaaggtgtacaccgattcgttccgctcggtctacgcgatcaa ctccggcatcccacagggcgctgccgtttccgctggccgctaccccgaggacgtctactacaacggcaac ccttggttcctcaccaccctcgccgctgccgagcagctctacgacgctatctaccagtggaagaagatcg gttccatcagcatcaccagcacctccctcgccttcttcaaggacatctacagctccgccgcggtcggcac ctacgcctctagcacctccaccttcacggacatcatcaacgcggtcaagacctacgcagacggctacgtg agcatcgtccaggcacacgccatgaacaacggctccctttcggagcaattcgacaagtcctctgggctgt ccctctccgcccgcgatctgacctggtcctacgccgctttcctcaccgccaacatgcgtcgtaacggcgt ggtgcctgccccctggggcgccgcctccgccaactccgtcccctcgtcttgctccatgggctcggccacg ggcacctacagcaccgcgacagccacctcctggcccagcacgctgaccagcggctcgccaggcagcacca ccaccgtgggcaccacgaccagtaccacctctggcaccgccgccgagaccgcctgtgcgacccctaccgc cgtggccgtcacctttaacgagatcgccaccaccacctacggcgagaatgtttacattgttgggtccatc tccgagctcgggaactgggataccagcaaagcagtggccctgagtgcgtccaagtatacctccagcaata acctctggtacgtgtccgtcaccctgccggctggcacgacattcgagtacaagtatatccgcaaggaaag cgatggctcgatcgtgtgggagagtgaccccaaccgctcgtatacggtgccggcagcttgtggagtgtct actgcgaccgagaatgatacttggcagtga Hg-GAProteinSequence: SEQIDNO:5 MHTFSKLLVLGSAVQSALGRPHGSSRLQERAAVDTFINTEKPIAWNKLLANIGPNGKAAPGAAAGVVIAS PSRTDPPYFFTWTPDAALVLTGIIESLGHNYNTTLQTVIQNYVASQAKLQQVSNPSGTFADGSGLGEAKF NVDLTAFTGEWGRPQRDGPPLRAIALIQYAKWLIANGYKSTAKSVVWPVVKNDLAYTAQYWNETGFDLWE EVPGSSFFTIASSHRALTEGAYLAAQLDTECPPCTTVAPQVLCFQQAFWNSKGNYVVSTSTAGEYRSGKD ANSILASIHNFDPEAGCDNLTFQPCSERALANHKAYVDSFRNLYAINKGIAQGKAVAVGRYSEDVYYNGN PWYLANFAAAEQLYDAIYVWNKQGSITVTSVSLPFFRDLVSSVSTGTYSKSSSTFTNIVNAVKAYADGFI EVAAKYTPSNGALAEQYDRNTGKPDSAADLTWSYSAFLSAIDRRAGLVPPSWRASVAKSQLPSTCSRIEV AGTYVAATSTSFPSKQTPNPSAAPSPSPYPTACADASEVYVTFNERVSTAWGETIKVVGNVPALGNWDTS KAVTLSASGYKSNDPLWSITVPIKATGSAVQYKYIKVGTNGKITWESDPNRSITLQTASSAGKCAAQTVN DSWR Hg-GANucleotideSequence: SEQIDNO:6 atgcataccttctccaagctcctcgtcctgggctctgccgtccagtctgccctcgggcggcctcacggct cttcgcgtctccaggaacgcgctgccgttgataccttcatcaacaccgagaagcccatcgcatggaacaa gctgctcgccaacatcggccctaacggcaaagccgctcccggtgccgccgccggcgttgtgattgccagc ccttccaggacggaccctccttgtacgtggtggcatggaatggacccaagagactgttttagatgaaaga gagtttctgctaaccgccacacccagacttcttcacctggaccccggatgccgccctggtcctcaccggc atcatcgagtcccttggccacaactacaacaccaccctgcagaccgtcatccagaactacgtcgcgtcgc aggccaagctgcagcaggtctcgaacccctcgggaaccttcgccgacggctcgggtctcggtgaggccaa gttcaatgtcgacctcactgccttcactggcgaatggggtcgccctcagagggacggcccgcccctgcgc gccatcgctctcatccagtacgccaagtggctgatcgccaacggctacaagagcacggccaagagcgtcg tctggcccgtcgtcaagaacgatctcgcctacacggcccagtactggaacgagaccggcttcgatctctg ggaggaggtccccggcagctcgttctttaccatcgccagctctcacaggggtgagtcatttattgttcag tgttttctcattgaataattaccggaatgccactgacgccaaacagctctgactgagggtgcttacctcg ccgctcagctcgacaccgagtgcccgccctgcacgaccgtcgcccctcaggttctgtgcttccagcaggc cttctggaactccaagggcaactatgtcgtctcaacagtaagatccctacaccaacaaaaaaaatcgaaa aggaacgttagctgacccttctagtcaacggcgggcgagtatcgctccggcaaggacgccaactcgatcc tggcgtccatccacaacttcgaccctgaggccggctgcgacaacctgaccttccagccctgcagcgagcg cgccctggccaaccacaaggcctatgtcgactcgttccgcaacctctacgccatcaacaagggcatcgcc cagggcaaggccgttgccgtcggccgctactcggaggatgtctactacaacggcaacccgtggtacctgg ccaactttgccgccgccgagcagctctacgacgccatctacgtgtggaacaagcagggctccatcaccgt gacctcggtctccctgcccttcttccgcgaccttgtctcgtcggtcagcaccggcacctactccaagagc agctcgaccttcaccaacatcgtcaacgccgtcaaggcctacgccgacggcttcatcgaggtggcggcca agtacaccccgtccaacggcgcgctcgccgagcagtacgaccgcaacacgggcaagcccgactcggccgc cgacctgacgtggtcgtactcggccttcctctcggccatcgaccgccgcgcgggtctcgtccccccgagc tggcgggccagcgtggccaagagccagctgccgtccacctgctcgcgcatcgaggtcgccggcacctacg tcgccgccacgagcacctcgttcccgtccaagcagaccccgaacccctccgcggcgccctccccgtcccc ctacccgaccgcctgcgcggacgctagcgaggtgtacgtcaccttcaacgagcgcgtgtcgaccgcgtgg ggcgagaccatcaaggtggtgggcaacgtgccggcgctggggaactgggacacgtccaaggcggtgaccc tgtcggccagcgggtacaagtcgaatgatcccctctggagcatcacggtgcccatcaaggcgacgggctc ggccgtgcagtacaagtatatcaaggtcggcaccaacgggaagattacttgggagtcggaccccaacagg agcattaccctgcagacggcgtcgtctgcgggcaagtgcgccgcgcagacggtgaatgattcgtggcgtt aa An-GAProteinSequence: SEQIDNO:7 MSFRSLLALSGLVCTGLANVISKRATWDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNP DYFYTWTRDSGLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSGDLSSGAGLGEPKFNVDETAY TGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEVNGSSFF TIAVQHRALVEGSAFATAVGSSCSWCDSQAPEILCYLQSFWTGSFILANFDSSRSAKDANTLLLGSIHTF DPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDTYYNGNPWFLCTLAAAE QLYDALYQWDKQGSLEVTDVSLDFFKALYSDATGTYSSSSSTYSSIVDAVKTFADGFVSIVETHAASNGS MSEQYDKSDGEQLSARDLTWSYAALLTANNRRNVVPSASWGETSASSVPGTCAATSAIGTYSSVTVTSWP SIVATGGTTTTATPTGSGSVTSTSKTTATASKTSTSTSSTSCTTPTAVAVTFDLTATTTYGENIYLVGSI SQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTS TATVTDTWR An-GANucleotideSequence: SEQIDNO:8 atgtcgttccgatctctactcgccctgagcggcctcgtctgcacagggttggcaaatgtgatttccaagc gcgcgacctgggattcatggttgagcaacgaagcgaccgtggctcgtactgccatcctgaataacatcgg ggcggacggtgcttgggtgtcgggcgcggactctggcattgtcgttgctagtcccagcacggataacccg gactacttctacacctggactcgcgactctggtctcgtcctcaagaccctcgtcgatctcttccgaaatg gagataccagtctcctctccaccattgagaactacatctccgcccaggcaattgtccagggtatcagtaa cccctctggtgatctgtccagcggcgctggtctcggtgaacccaagttcaatgtcgatgagactgcctac actggttcttggggacggccgcagcgagatggtccggctctgagagcaactgctatgatcggcttcgggc aatggctgcttgacaatggctacaccagcaccgcaacggacattgtttggcccctcgttaggaacgacct gtcgtatgtggctcaatactggaaccagacaggatatgatctctgggaagtcaatggctcgtctttcttt acgattgctgtgcaacaccgcgcccttgtcgaaggtagtgccttcgcgacggccgtcggctcgtcctgct cctggtgtgattctcaggcacccgaaattctctgctacctgcagtccttctggaccggcagcttcattct ggccaacttcgatagcagccgttccgccaaggacgcaaacaccctcctgctgggaagcatccacaccttt gatcctgaggccgcatgcgacgactccaccttccagccctgctccccgcgcgcgctcgccaaccacaagg aggttgtagactctttccgctcaatctataccctcaacgatggtctcagtgacagcgaggctgttgcggt gggtcggtaccctgaggacacgtactacaacggcaacccgtggttcctgtgcaccttggctgccgcagag cagttgtacgatgctctataccagtgggacaagcaggggtcgttggaggtcacagatgtgtcgctggact tcttcaaggcactgtacagcgatgctactggcacctactcttcgtccagttcgacttatagtagcattgt agatgccgtgaagactttcgccgatggcttcgtctctattgtggaaactcacgccgcaagcaacggctcc atgtccgagcaatacgacaagtctgatggcgagcagctttccgctcgcgacctgacctggtcttatgctg ctctgctgaccgccaacaaccgtcgtaacgtcgtgccttccgcttcttggggcgagacctctgccagcag cgtgcccggcacctgtgcggccacatctgccattggtacctacagcagtgtgactgtcacctcgtggccg agtatcgtggctactggcggcaccactacgacggctacccccactggatccggcagcgtgacctcgacca gcaagaccaccgcgactgctagcaagaccagcaccagtacgtcatcaacctcctgtaccactcccaccgc cgtggctgtgactttcgatctgacagctaccaccacctacggcgagaacatctacctggtcggatcgatc tctcagctgggtgactgggaaaccagcgacggcatagctctgagtgctgacaagtacacttccagcgacc cgctctggtatgtcactgtgactctgccggctggtgagtcgtttgagtacaagtttatccgcattgagag cgatgactccgtggagtgggagagtgatcccaaccgagaatacaccgttcctcaggcgtgcggaacgtcg accgcgacggtgactgacacctggcggtag Tr-GAvariantCS4MatureProteinSequence: SEQIDNO:9 SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETY DAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSK WLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSG SAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALS NLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTAT SLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSAVHLT WSYASFLTAAARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLP CATPTSVAVTFHELVSTQFGHTVKVAGNAAALGNWSTSAAVALDAVNYRDNHPLWIGTVNLEAGDVVEYK YIIVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS Tr-GAMatureProteinSequence: SEQIDNO:10 SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETY DAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSK WLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSG SAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALS NLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTAT SLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLT WSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLP CATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYK YINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS Tr-GAParentProteinSequence(632aminoacids): SEQIDNO:11 1MHVLSTAVLLGSVAVQKVLGRPGSSGLSDVTKRSVDDFISTETPIALNNL 51LCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFT 101ETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFT 151GNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVA 201QYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVA 251PQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCD 301AGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYN 351GNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTY 401SSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSAL 451HLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTA 501TSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAG 551NAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQD 601GSVTWESDPNHTYTVPAVACVTQVVKEDTWQS Tr-GANucleotideSequence(1899bp): SEQIDNO:12 1ATGCACGTCCTGTCGACTGCGGTGCTGCTCGGCTCCGTTGCCGTTCAAAA 51GGTCCTGGGAAGACCAGGATCAAGCGGTCTGTCCGACGTCACCAAGAGGT 101CTGTTGACGACTTCATCAGCACCGAGACGCCTATTGCACTGAACAATCTT 151CTTTGCAATGTTGGTCCTGATGGATGCCGTGCATTCGGCACATCAGCTGG 201TGCGGTGATTGCATCTCCCAGCACAATTGACCCGGACTACTATTACATGT 251GGACGCGAGATAGCGCTCTTGTCTTCAAGAACCTCATCGACCGCTTCACC 301GAAACGTACGATGCGGGCCTGCAGCGCCGCATCGAGCAGTACATTACTGC 351CCAGGTCACTCTCCAGGGCCTCTCTAACCCCTCGGGCTCCCTCGCGGACG 401GCTCTGGTCTCGGCGAGCCCAAGTTTGAGTTGACCCTGAAGCCTTTCACC 451GGCAACTGGGGTCGACCGCAGCGGGATGGCCCAGCTCTGCGAGCCATTGC 501CTTGATTGGATACTCAAAGTGGCTCATCAACAACAACTATCAGTCGACTG 551TGTCCAACGTCATCTGGCCTATTGTGCGCAACGACCTCAACTATGTTGCC 601CAGTACTGGAACCAAACCGGCTTTGACCTCTGGGAAGAAGTCAATGGGAG 651CTCATTCTTTACTGTTGCCAACCAGCACCGAGCACTTGTCGAGGGCGCCA 701CTCTTGCTGCCACTCTTGGCCAGTCGGGAAGCGCTTATTCATCTGTTGCT 751CCCCAGGTTTTGTGCTTTCTCCAACGATTCTGGGTGTCGTCTGGTGGATA 801CGTCGACTCCAACATCAACACCAACGAGGGCAGGACTGGCAAGGATGTCA 851ACTCCGTCCTGACTTCCATCCACACCTTCGATCCCAACCTTGGCTGTGAC 901GCAGGCACCTTCCAGCCATGCAGTGACAAAGCGCTCTCCAACCTCAAGGT 951TGTTGTCGACTCCTTCCGCTCCATCTACGGCGTGAACAAGGGCATTCCTG 1001CCGGTGCTGCCGTCGCCATTGGCCGGTATGCAGAGGATGTGTACTACAAC 1051GGCAACCCTTGGTATCTTGCTACATTTGCTGCTGCCGAGCAGCTGTACGA 1101TGCCATCTACGTCTGGAAGAAGACGGGCTCCATCACGGTGACCGCCACCT 1151CCCTGGCCTTCTTCCAGGAGCTTGTTCCTGGCGTGACGGCCGGGACCTAC 1201TCCAGCAGCTCTTCGACCTTTACCAACATCATCAACGCCGTCTCGACATA 1251CGCCGATGGCTTCCTCAGCGAGGCTGCCAAGTACGTCCCCGCCGACGGTT 1301CGCTGGCCGAGCAGTTTGACCGCAACAGCGGCACTCCGCTGTCTGCGCTT 1351CACCTGACGTGGTCGTACGCCTCGTTCTTGACAGCCACGGCCCGTCGGGC 1401TGGCATCGTGCCCCCCTCGTGGGCCAACAGCAGCGCTAGCACGATCCCCT 1451CGACGTGCTCCGGCGCGTCCGTGGTCGGATCCTACTCGCGTCCCACCGCC 1501ACGTCATTCCCTCCGTCGCAGACGCCCAAGCCTGGCGTGCCTTCCGGTAC 1551TCCCTACACGCCCCTGCCCTGCGCGACCCCAACCTCCGTGGCCGTCACCT 1601TCCACGAGCTCGTGTCGACACAGTTTGGCCAGACGGTCAAGGTGGCGGGC 1651AACGCCGCGGCCCTGGGCAACTGGAGCACGAGCGCCGCCGTGGCTCTGGA 1701CGCCGTCAACTATGCCGATAACCACCCCCTGTGGATTGGGACGGTCAACC 1751TCGAGGCTGGAGACGTCGTGGAGTACAAGTACATCAATGTGGGCCAAGAT 1801GGCTCCGTGACCTGGGAGAGTGATCCCAACCACACTTACACGGTTCCTGC 1851GGTGGCTTGTGTGACGCAGGTTGTCAAGGAGGACACCTGGCAGTCGTAA