RECOMBINANT VECTOR CARRYING CELLULOSE BINDING DOMAIN AND METHOD FOR ISOLATING AND PURIFYING PROTEIN, USING SAME VECTOR

20200270624 ยท 2020-08-27

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a recombinant vector carrying cellulose-binding domain 3 and a method for separating a target protein using the recombinant vector. The protein isolating method of the present invention can easily separate a fusion protein containing a target protein by using the recombinant vector to bind a transformed plant body to cellulose and can effectively isolate the target protein from a cellulose-binding domain by treating the fusion protein with enterokinase, thus being expected to find industrial applications in various fields.

    Claims

    1. A recombinant vector comprising a base sequence of SEQ ID NO: 1 encoding cellulose-binding module 3 (CBM3).

    2. The recombinant vector, according to claim 1, wherein the recombinant vector comprises cellulose-binding module 3, a linker peptide, an enterokinase-cleavage site, and a target protein-encoding gene, which is sequentially connected.

    3. The recombinant vector, according to claim 2, wherein the target protein-encoding gene comprises of a base sequence of SEQ ID NO: 3.

    4. The recombinant vector according to claim 2, wherein the linker peptide consists of a base sequence of SEQ ID NO: 5.

    5. The recombinant vector, according to claim 2, wherein the enterokinase-cleavage site consists of a base sequence of SEQ ID NO: 6.

    6. The recombinant vector, according to claim 2, wherein a gene encoding a binding immunoglobulin protein (BiP) transferring a target protein to the endoplasmic reticulum in plant cells is further operably linked to the recombinant vector.

    7. The recombinant vector according to claim 6, wherein the gene encoding the BiP consists of a base sequence of SEQ ID NO: 7.

    8. The recombinant vector according to claim 2, wherein a base sequence encoding a His-Asp-Glu-Leu (HDEL) peptide is further operably linked to the recombinant vector.

    9. A method of isolating and purifying a target protein, comprising: preparing a plant body mixed solution by mixing a plant body transformed using the recombinant vector of claim 1 with a protein extraction buffer solution (S1); adsorbing a fusion protein, in which cellulose-binding module 3 and a target protein are fused, to cellulose by injecting the mixed solution of S1 into a column filled with cellulose (S2); and obtaining a suspension by precipitating the fusion protein-adsorbed cellulose in S2 through centrifugation and suspending the precipitate in enterokinase (S3).

    10. The method, according to claim 9, further comprising: removing enterokinase by injecting the suspension into a sepharose column after S3.

    11. The method according to claim 9, wherein the protein extraction buffer solution comprises a 10 to 100 mM Tris buffer, a 100 to 200 mM sodium chloride (NaCl) solution, a 0.01 to 0.5% Triton X-100 and a protease inhibitor.

    12. The method according to claim 9, wherein the transformed plant body is prepared by a method comprising: a) preparing a transformant by introducing the recombinant vector of claim 1 to a strain, and b) transforming a plant body using the transformant.

    13. The method, according to claim 12, wherein the strain is Agrobacterium tumefaciens.

    14. The method, according to claim 9, wherein the plant body is a dicotyledonous plant selected from the group consisting of Arabidopsis thaliana, soybean, tobacco, eggplant, pepper, potato, tomato, Chinese cabbage, radish, cabbage, lettuce, peach, pear, strawberry, watermelon, melon, cucumber, carrot and celery; or a monocotyledonous plant selected from the group consisting of rice, barley, wheat, rye, corn, sugarcane, oat and onion.

    15. The method, according to claim 9, wherein the cellulose is microcrystalline cellulose.

    Description

    DESCRIPTION OF DRAWINGS

    [0026] FIG. 1 illustrates the configuration of a recombinant vector used in the present invention.

    [0027] FIG. 2 illustrates the result obtained by confirming the adsorption of a CBM3 fusion protein (CBM3: Ag85A) to microcrystalline cellulose.

    [0028] FIG. 3 illustrates the result obtained by isolating a target protein (Ag85A) from a CBM3 fusion protein using enterokinase.

    [0029] FIG. 4 illustrates the result obtained by isolating and purifying a target protein (Ag85A) after enterokinase is removed by affinity chromatography.

    MODES OF THE INVENTION

    [0030] The present invention is characterized by providing a recombinant vector comprising a base sequence of SEQ ID NO: 1, which encodes cellulose-binding module 3 (CBM3).

    [0031] As a result of studying a method of rapidly and cheaply isolating a high purity target protein from a plant body in a large amount, the invention was completed. That is, in an exemplary embodiment of the present invention, it was confirmed that a target protein could be isolated by manufacturing a recombinant vector by binding cellulose-binding module 3 (CBM3) consisting of a base sequence of SEQ ID NO: 1 or an amino acid sequence of SEQ ID NO: 2 in the direction of the 3 end of the target protein-encoding gene, preparing a transformed plant body producing the target protein using the recombinant vector, isolating a CBM3 fusion protein using microcrystalline cellulose (MCC), and treating the resulting protein with enterokinase (refer to Examples 1 to 4).

    [0032] From a result of the above, the inventors knew that a target protein could be efficiently purified using cellulose from a plant body expressing the target protein using a recombinant vector carrying cellulose-binding domain.

    [0033] Accordingly, the present invention may provide a method of isolating a target protein using the recombinant vector.

    [0034] Therefore, the present invention provides a method of isolating and purifying a target protein, which comprises the following steps:

    [0035] preparing a plant body mixed solution by mixing a plant body transformed using the recombinant vector with a protein extraction buffer solution (51);

    [0036] adsorbing a fusion protein, in which cellulose-binding module 3 and a target protein are fused, to cellulose by injecting the mixed solution of S1 into a column filled with cellulose (S2); and obtaining a suspension by precipitating the fusion protein-adsorbed cellulose in S2 through centrifugation and suspending the precipitate in enterokinase (S3).

    [0037] More specifically, in the present invention, the cellulose preferably uses MCC. Amorphous cellulose may also be used, but MCC is more preferably used in consideration of isolation efficiency.

    [0038] In the present invention, the recombinant vector consists of cellulose-binding module 3, a linker peptide, an enterokinase-cleavage site, and a target protein-encoding gene, which is sequentially connected, a signal peptide of a binding immunoglobulin protein (BiP) which can transfer a target protein to an endoplasmic reticulum in plant cells is connected to the 3 end of cellulose-binding domain, and His-Asp-Glu-Leu (HDEL) may be connected to a carboxyl end of the target protein-encoding gene so that the connected vector is retained in the endoplasmic reticulum.

    [0039] The cellulose-binding module 3 may be encoded by a base sequence of SEQ ID NO: 1. In a protein produced using the recombinant vector, cellulose-binding module 3 consists of an amino acid sequence of SEQ ID NO: 2.

    [0040] The term target protein (or protein) used herein refers to a protein to be produced by a genetic engineering method according to the present invention, and the present invention is not particularly limited thereto. Preferably, proteins required to be mass-produced may be included since they are used industrially.

    [0041] In an exemplary embodiment of the present invention, although the target protein-encoding gene may be Ag85A encoded by a base sequence of SEQ ID NO: 3, it may be isolated as described above, and vary according to the type of desired protein to be produced. The target protein may consist of an amino acid sequence of SEQ ID NO: 4.

    [0042] In another exemplary embodiment of the present invention, the linker peptide may consist of a base sequence of SEQ ID NO: 5, the enterokinase-cleavage site may consist of a base sequence of SEQ ID NO: 6, and the signal peptide of BiP may consist of a base sequence of SEQ ID NO: 7.

    [0043] The term fusion protein used herein refers to a protein in which cellulose-binding domain and a target protein are fused, and in the fusion protein, the removal of cellulose-binding domain corresponding to a tag from a target protein is critical for isolation and purification of the target protein. Therefore, in the present invention, cellulose-binding domain may be easily isolated by the treatment of enterokinase.

    [0044] In still another exemplary embodiment of the present invention, after the treatment with enterokinase, the enterokinase may be easily removed by being passed through a sepharose column (STI-sepharose affinity chromatography).

    [0045] In yet another exemplary embodiment of the present invention, a protein extraction buffer solution added to prepare a plant body mixed solution may comprise a 10 to 100 mM Tris buffer solution, a 100 to 200 mM sodium chloride (NaCl) solution, a 0.01 to 0.5% Triton X-100, and a protease inhibitor, and 1 to 10 mL, and more preferably, 3 to 8 mL per 1 g of a weight of the plant body is preferably used.

    [0046] In the method of the present invention, a transformed plant body may be prepared by a method comprising: a) preparing a transformant by introducing the recombinant vector to a strain; and b) transforming a plant body using the transformant.

    [0047] The strain may be Agrobacterium tumefaciens, but the present invention is not limited thereto. As the plant body, a dicotyledonous plant selected from the group consisting of Arabidopsis thaliana, soybean, tobacco, eggplant, pepper, potato, tomato, Chinese cabbage, radish, cabbage, lettuce, peach, pear, strawberry, watermelon, melon, cucumber, carrot and celery; or a monocotyledonous plant selected from the group consisting of rice, barley, wheat, rye, corn, sugarcane, oat and onion may be used. Still, the present invention is not limited thereto.

    [0048] Hereinafter, to help in understanding the present invention, exemplary examples will be suggested. However, the following examples are merely provided to more easily understand the present invention and not to limit the present invention.

    EXAMPLES

    Example 1. Preparation of Transformed Plant Body Expressing the CBM3 Fusion Protein

    [0049] A vector for transforming a plant body, which is recombined to express a CBM3 fusion protein in the plant body, as shown in FIG. 1 was manufactured. To transfer the CBM3 fusion protein to the endoplasmic reticulum, a target protein was transferred to the endoplasmic reticulum using a genomic DNA sequence corresponding to a signal peptide of BiP, and His-Asp-Glu-Leu (HDEL) was introduced to a carboxyl end so that a fusion protein was accumulated in the endoplasmic reticulum and retained in the endoplasmic reticulum. CBM3 required for isolation of the fusion protein, a linker peptide (linker), and a sequence recognized and cleaved by enterokinase was connected upstream of a gene encoding the target protein (Ag85A), and inserted into a plant expression vector, i.e., pCAMBIA 1300, thereby preparing a recombinant vector. An Agrobacterium tumefaciens LBA-4404 strain was transformed with the vector. Arabidopsis thaliana was transformed using the modified Agrobacterium strain, thus developing a transformed plant body producing the target protein, and then the transformed plant body stably producing a CBM3 fusion protein was selected. The sequences used in the recombinant vector are shown in Table 1 below.

    TABLE-US-00001 TABLE1 Sequence(5-3) CBM3 gtatcaggtaaccttaaggtggagttttacaactcgaacccttctgatacaactaactc SEQID base aataaacccacagttcaaagbacaaacacaggcagctctgcgatcgatttgtctaaatt NO:1 sequence aaccctcagatactattatacggttgatggacagaaggaccagactttcggtgtgatca tgcagctatcattggttctaacggtagctacaacggaattacatcaaacgtgaagggca ctttcgttaagatgtcctctagcactaacaacgcagacacatatttggagatcagtttt acggggggaacccttgaaccaggtgctcacgtccagattcaaggaagattcgctaaaaa cgactggtcgaactatacccaaagtaatgattacagttttaaatccgcctcacaatttg ttgagtgggatcaggtcactgcttacctgaacggggttctagtgtggggaaaggaacct ggt CBM3 VSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQT SEQID amino FWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHV NO:2 acid QIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPG sequence Ag85A tttagccggcctggcctgcctgtggaatacctgcaggtgcctagccctagcatgggccg SEQID base ggacatcaaagtgcagtttcagagcggcggggctaatagccctgctctgtacctgctcg NO:3 sequence atggcctgcgggctcaggatgattttagcggctgggacatcaacacccctgcttttgaa tggtacgatcagagcggcctgagcgtcgtgatgcctgtgggcgggcagagcagcttcta cagcgattggtatcagcctgcttgcggcaaagctggctgccagacctacaagtgggaaa cctttctgaccagcgaactgcctggctggctgcaggctaatcggcacgtgaaacctacc ggcagcgccgtggtgggcctgagcatggctgctagctccgctctgaccctggctatcta ccaccctcagcagtttgtgtacgctggcgctatgagcggcctgctcgatccctcccagg ctatgggccctaccctgatcgggctcgctatgggggatgctggggggtacaaagctagc gatatgtggggccctaaagaagatcctgcttggcagcggaatgatcctctgctcaacgt gggcaaactgatcgctaataatacccgagtgtgggtgtactgcggcaatggcaaaccta gcgatctgggcgggaacaatctgcctgctaaatttctggaaggcttcgtgcggaccagc aacatcaagtttcaggatgcttacaatgctggcgggggccacaatggcgtatttgattd cctgatagcggcacccacagctgggaatactggggcgctcagctgaatgctatgaaacc tgatctgcagcgggctctgggcgctacccctaataccggccctgctcctcagggcgctg gctccggatctggtagt Ag85A FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINT SEQID amino PAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGW NO:4 acid LQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGP sequence TLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGN GKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEY WGAQLNAMKPDLQRALGATPNTGPAPQGAGSGSGS Linker gaggcagccgctaaggaagctgcagcgaaa SEQID base NO:5 sequence EKbase gatgacgacgataaa SEQID sequence NO:6 BiPbase atggctcgctcgtttggagctaacagtaccgttgtgttggcgatcatcttcttcggtga SEQID sequence gtgattttccgatcttcttctccgatttagatctcctctacattgttgcttaatctcag NO:7 aaccttttttcgttgttcctggatctgaatgtgtttgtttgcaatttcacgatcttaaa aggttagatctcgattggtattgacgattggaatctttacgatttcaggatgtttattt gcgttgtcctctgcaatagaagaggctacgaagtta HDEL His-Asp-Glu-Leu SEQID amino NO:8 acid sequence

    Example 2. Isolation of Protein Using MCC

    [0050] To adsorb the CBM3 fusion protein to MCC, distilled water was added to 1 g of MCC to hydrate. Afterward, the transformed plant body prepared by the method described in Example 1 was cultured in the soil for about 3 weeks and then the plant body excluding the root part was ground in a mortar using liquid nitrogen. 1 g of the ground plant body was transferred to a new tube, 5 mL of a protein extraction buffer solution (50 mM Tris (pH 7.2), 150 mM NaCl, 0.2% Triton X-100, 1 protease inhibitor) was added thereto, and well mixed by vortexing. Plant debris was removed using Miracloth as a filter, 1 g of MCC was added, and then the resulting product was well mixed for 1 hour at 4 , such that the CBM3 fusion protein was adsorbed to MCC. Afterward, proteins that were not bound to the MCC were removed through centrifugation (14,000 rpm, 4 , 10 min), and then the MCC was washed with 5 mL of a washing buffer (50 mM Tris (pH 7.2), 150 mM NaCl) twice. The adsorption of the CBM3 fusion protein to the MCC was confirmed by western blotting using a CBM3 antibody.

    [0051] As a result, as shown in FIG. 2, it can be confirmed that the CBM3 fusion protein expressed in the plant was well adsorbed to the MCC with almost no loss, and the CBM3 fusion protein adsorbed to the MCC was hardly eluted even in the washing process.

    Example 3. Cleavage of Fusion Protein Using Enterokinase

    [0052] Ag85A-containing fusion protein-adsorbed cellulose was precipitated by centrifugation (14,000 rpm, 4 , 10 min), and resuspended in an enterokinase reaction solution (50 mM Tris (pH 7.2), 150 mM NaCl, 1 mM CaCl.sub.2)). As much as 5 units of enterokinase were added to the suspension and reacted at 28 , a suspension was obtained hourly, and SDS-PAGE was performed. The cleavage of the fusion protein according to enterokinase treatment time was confirmed by western blotting using an Ag85A antibody.

    [0053] As a result, as shown in FIG. 3, the cleavage reaction of the fusion protein by the enterokinase treatment was so efficient that 70% of the fusion protein was cleaved 1 hour after the treatment. After 4 hours, the fusion protein was completed cleaved and separated into CBM3 and Ag85A.

    Example 4. Isolation and Purification of Ag85A by Removal of Enterokinase Through Affinity Chromatography

    [0054] The reaction solution containing the enterokinase and the completely-cleaved Ag85A was isolated from the cellulose through centrifugation (14,000 rpm, 4 , 10 min) (left panel of FIG. 4). To remove enterokinase from the reaction solution, affinity chromatography was performed. STI-Sepharose was added to the reaction solution, reacted at 4 for 1 hour, and then put into an empty column to obtain a portion that did not bind to STI-Sepharose. As identified in the right panel of FIG. 4, it can be seen that enterokinase was removed from the reaction solution through STI-Sepharose affinity chromatography, thereby obtaining purified and isolated Ag85A.

    [0055] From the above-described results, it was confirmed that the protein isolation method using a recombinant vector of the present invention might easily isolate enterokinase from a target protein without elution, such that the time to isolate a protein can be ultimately reduced. This means that, when a large amount of proteins is separated, due to the reduction in a sample used herein and time consumed, working efficiency can be maximized.

    [0056] It should be understood by those of ordinary skill in the art that the above descriptions of the present invention are exemplary, and the example embodiments disclosed herein can be easily modified into other specific forms without changing the technical spirit or essential features of the present invention. Therefore, it should be understood that the example embodiments described above are exemplary in all aspects, and are not limitative.

    INDUSTRIAL APPLICABILITY

    [0057] A method of isolating a protein using a recombinant vector according to the present invention can rapidly, cheaply or efficiently separate a large amount of target proteins from a plant body with high purity, and thus is expected to be applied in various industrial fields.