METHODS OF TREATMENT BY TARGETING VCAM1 AND MAEA
20200270349 ยท 2020-08-27
Assignee
Inventors
- Paul S. Frenette (New York, NY)
- Sandra Pinho (New York, NY, US)
- Qiaozhi Wei (Bronx, NY, US)
- Sung Kyun Lee (Bronx, NY, US)
Cpc classification
C07K16/2821
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
C07K2317/51
CHEMISTRY; METALLURGY
A61P7/00
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
A61K31/7068
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C07K16/2896
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
Abstract
Antibodies and antibody fragments that inhibit the activity of vascular cell adhesion molecule 1 (VCAM1) and/or macrophage erythroblast attacher (MAEA) are provided, along with formulations and kits comprising these antibodies and antibody fragments and the use of the disclosed compositions, formulations, and kits to treat cancers, sickle cell disease, and Polycythemia Vera.
Claims
1-33. (canceled)
34. An antibody or immunogenic fragment thereof comprising one or more of: (a) a heavy chain comprising SYTMS (SEQ ID NO:54) (CDR1); EISSGGSYTHYAATVTG (SEQ ID NO:56) (CDR2); and GELY (SEQ ID NO:58) (CDR3); (b) a heavy chain comprising SYAMS (SEQ ID NO:82) (CDR1); EISSTGSYTHYPDTVTG (SEQ ID NO:84) (CDR2); and GEAL (SEQ ID NO:86); (c) a light chain comprising KASQSLLDRGGKTFFN (SEQ ID NO:68) (CDR1); LVSKLDS (SEQ ID NO:70) (CDR2); and WQGTHFPWT (SEQ ID NO:72) (CDR3); and (d) KSSHSLLDSYGKTYLN (SEQ ID NO:96) (CDR1); LVSKLDS (SEQ ID NO:98) (CDR2); and WQGTHFPWT (SEQ ID NO:100) (CDR3); wherein said antibody or immunogenic fragment thereof specifically binds vascular cell adhesion molecule 1 (VCAM1).
35. The antibody or immunogenic fragment thereof of claim 34, comprising one or more of: (a) a VH region comprising the amino acid sequence of SEQ ID NO:13; (b) a VH region comprising the amino acid sequence of SEQ ID NO:17; (c) a VL region comprising the amino acid sequence of SEQ ID NO:15; and (d) a VL region comprising the amino acid sequence of SEQ ID NO:19.
36. The antibody or immunogenic fragment thereof of claim 34, comprising: TABLE-US-00004 (a)aheavychaincomprising (CDR1) (SEQIDNO:54) SYTMS; (CDR2) (SEQIDNO:56) EISSGGSYTHYAATVTG; and (CDR3) (SEQIDNO:58) GELY; and (b)alightchaincomprising (CDR1) (SEQIDNO:68) KASQSLLDRGGKTFFN; (CDR2) (SEQIDNO:70) LVSKLDS; and (CDR3) (SEQIDNO:72) WQGTHFPWT.
37. The antibody or immunogenic fragment thereof of claim 36, comprising a VH region comprising the amino acid sequence of SEQ ID NO:13 and a VL region comprising the amino acid sequence of SEQ ID NO:15.
38. The antibody or immunogenic fragment thereof of claim 34, comprising: TABLE-US-00005 (a)aheavychaincomprising (CDR1) (SEQIDNO:82) SYAMS; (CDR2) (SEQIDNO:84) EISSTGSYTHTPDTVTG; and (SEQIDNO:86) GEAL; and (b) (CDR1) (SEQIDNO:96) KSSHSLLDSYGKTYLN; (CDR2) (SEQIDNO:98) LVSKLDS; and (CDR3) (SEQIDNO:100) WQGTHFPWT.
39. The antibody or immunogenic fragment thereof of claim 38, comprising a VH region comprising the amino acid sequence of SEQ ID NO:17 and a VL region comprising the amino acid sequence of SEQ ID NO:19.
40. The antibody or immunogenic fragment thereof of claim 34, wherein the antibody is selected from the group consisting of a monoclonal antibody, a chimeric antibody, a human antibody, and a humanized antibody.
41. A fusion protein comprising the antibody or immunogenic fragment thereof of claim 34.
42. A method of treating cancer in a subject in need thereof comprising administering to the subject the antibody or immunogenic fragment thereof of claim 34.
43. The method of claim 42, wherein said cancer is selected from the group consisting of bladder cancer, breast cancer, brain cancer, colorectal cancer, kidney cancer, esophagus cancer, gastrointestinal tract cancer, liver cancer, lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, stomach cancer, uterine cancer, melanoma, non-Hodgkin lymphoma, myelodysplastic syndrome (MDS), a hematologic malignancy, a myeloproliferative syndrome, polycythemia vera (PV), essential thrombocythemia, lymphoma, lymphocytic leukemia, myeloma, chronic myelogenous leukemia, acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphoblastic leukemia (ALL), and chronic lymphocytic leukemia (CLL).
44. A method of treating sickle cell disease (SCD) in a subject in need thereof comprising administering to the subject the antibody or immunogenic fragment thereof of claim 34.
45. A nucleic acid comprising a nucleotide sequence encoding the antibody or immunogenic fragment thereof of claim 34.
46. An antibody or immunogenic fragment thereof comprising one or more of: TABLE-US-00006 (a)aheavychaincomprising (CDR1) (SEQIDNO:28) DYNMD; (CDR2) (SEQIDNO:30) DINPNYDSPTYSQKFKG; and (CDR3) (SEQIDNO:32) GHYYGYGYFDV; and (b)alightchaincomprising (CDR1) (SEQIDNO:42) KASQNVGTNVA; (CDR2) (SEQIDNO:102) SASYRYS; and (CDR3) (SEQIDNO:44) QQYNTYPWT. wherein said antibody or immunogenic fragment specifically binds macrophage-erythroblast attacher (MAEA).
47. The antibody or immunogenic fragment thereof of claim 46, comprising one or more of: (a) a VH region comprising the amino acid sequence of SEQ ID NO:9; and (b) a VL region comprising the amino acid sequence of SEQ ID NO:11.
48. The antibody or immunogenic fragment thereof of claim 46, comprising: TABLE-US-00007 (a)aheavychaincomprising (CDR1) (SEQIDNO:28) DYNMD; (CDR2) (SEQIDNO:30) DINPNYDSPTYSQKFKG; and (CDR3) (SEQIDNO:32) GHYYGYGYFDV; and (b)alightchaincomprising (CDR1) (SEQIDNO:42) KASQNVGTNVA; (CDR2) (SEQIDNO:102) SASYRYRS; and (CDR3) (SEQIDNO:44) QQYNTYPWT.
49. The antibody or immunogenic fragment thereof of claim 48, comprising a VH region comprising the amino acid sequence of SEQ ID NO:9 and a VL region comprising the amino acid sequence of SEQ ID NO:11.
50. The antibody or immunogenic fragment thereof of claim 46, wherein the antibody is selected from the group consisting of a monoclonal antibody, a chimeric antibody, a human antibody, and a humanized antibody.
51. A fusion protein comprising the antibody or immunogenic fragment thereof of claim 46.
52. A method of treating cancer in a subject in need thereof comprising administering to the subject the antibody or immunogenic fragment thereof of claim 46.
53. The method of claim 52, wherein said cancer is selected from the group consisting of bladder cancer, breast cancer, brain cancer, colorectal cancer, kidney cancer, esophagus cancer, gastrointestinal tract cancer, liver cancer, lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, stomach cancer, uterine cancer, melanoma, non-Hodgkin lymphoma, myelodysplastic syndrome (MDS), a hematologic malignancy, a myeloproliferative syndrome, polycythemia vera (PV), essential thrombocythemia, lymphoma, lymphocytic leukemia, myeloma, chronic myelogenous leukemia, acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphoblastic leukemia (ALL), and chronic lymphocytic leukemia (CLL).
54. A nucleic acid comprising a nucleotide sequence encoding the antibody or immunogenic fragment thereof of claim 46.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
DETAILED DESCRIPTION
[0059] The following description of the invention is merely intended to illustrate various embodiments of the invention. As such, the specific modifications discussed are not to be construed as limitations on the scope of the invention. It will be apparent to one skilled in the art that various equivalents, changes, and modifications may be made without departing from the scope of the invention, and it is understood that such equivalent embodiments are to be included herein.
[0060] Haematopoietic stem cells (HSCs) home to the bone marrow (BM) via, in part, the interactions with vascular cell adhesion molecule-1 (VCAM1)..sup.57-59 Upon migrating into the BM, HSCs are vetted by perivascular phagocytes to ensure their self-integrity. As set forth in the experimental results provided herein, VCAM1 is also expressed on healthy HSCs and upregulated on leukemic stem cells (LSCs) where it serves as a quality-control checkpoint for entry into BM by providing don't-eat-me stamping in the context of major histocompatibility complex (MHC) class-I presentation. The results provided herein suggest that VCAM1 engagement regulates a critical immune checkpoint gate in the BM and offers a novel strategy to eliminate cancer cells via modulation of the innate immune tolerance.
[0061] Sickle cell disease (SCD) is characterized by sickle-shaped RBCs, which exhibit increased adherence to other blood cells or to the endothelium, and are prone to undergo premature clearance and hemolysis..sup.48 The RBC alterations lead to a chronic inflammatory state resulting in ischemic tissue damage manifested by severe pain and organ failures. The pathophysiology of VOE and chronic organ damage is complex and involves the interplay of altered blood rheology, endothelial activation, and the secretion of inflammatory cytokines enabling leukocyte adhesion and activation..sup.49 Intravital microscopy analysis of the SCD mouse microcirculation has revealed that RBCs interact with adherent leukocytes in the inflamed vasculature..sup.50 The accumulation of activated neutrophils interacting with RBCs progressively reduces blood flow and produces venular occlusions..sup.51,52 Results provided herein indicate that blocking VCAM1 function may help treat SCD by reducing the number of WBC adhesions, reducing the strength for rolling interactions (increased the number of rolling WBCs), reducing RBC/WBC interactions, increasing centerline velocity, decreasing shear rate, and prolonging survival.
[0062] Macrophage-Erythroblast Attacher (MAEA, also known as EMP) was originally identified as an adhesion molecule required for erythroblastic island formation..sup.7 Germline deletion of MAEA led to severe anemia and perinatal mortality..sup.97 Sequence analysis indicates that MAEA is a highly conserved RING finger domain-containing E3 ubiquitin ligase..sup.98,99 MAEA's functions, however, remain obscure. As shown by results provided herein, MAEA is highly expressed in hematopoietic stem cells (HSCs) where it is required for their maintenance by restricting cytokine receptor signaling and promoting autophagy. Constitutive MAEA deletion produces severe defects in HSC repopulation capacity, B- and T-lymphoid differentiation, and premature death of animals from a myeloproliferative syndrome. Postnatal MAEA deletion leads to transient HSC expansion followed by their depletion. Mechanistically, Applicants found that the surface expression of several hematopoietic cytokine receptors (e.g., MPL, FLT3) is stabilized in absence of MAEA, thereby prolonging their intracellular signaling. Additionally, the autophagy flux in HSCs, but not in mature hematopoietic cells, is markedly impaired. Administration of autophagy-inducing compounds rescued the functional defects of MAEA-deficient HSCs. Further, MAEA is upregulated in various cancers and associated with poor survival of acute myelogenous leukemia (AML), and MLL-AF9-driven AML does not develop in the absence of MAEA. Moreover, treatment of AML-bearing mice with an anti-MAEA antibody significantly improved their survival.
[0063] Antibodies and antibody fragments that inhibit the activity of vascular cell adhesion molecule 1 (VCAM1) and/or macrophage erythroblast attacher (MAEA) are provided, along with formulations and kits comprising these antibodies and antibody fragments. Also provided are methods of treatment using the disclosed compositions, formulations, and kits to treat conditions such as cancers, sickle cell disease (SCD), and Polycythemia Vera. Methods of treating SCD by blocking VCAM1 are provided based on the surprising findings disclosed herein.
[0064] Provided herein are VCAM1 inhibitors and MAEA inhibitors, e.g., VCAM1 or MAEA antibodies, and formulations and kits comprising those inhibitors. Also provided herein are methods for treating Polycthemia Vera (PV) by blocking VCAM1 or MAEA using a VCAM1 inhibitor or MAEA inhibitor, e.g., by using one of the antibodies of the present disclosure. Further provided are methods for treating sickle cell disease (SCD) by blocking VCAM1 using a VCAM inhibitor, e.g., by using one of the antibodies of the present disclosure.
[0065] A VCAM1 inhibitor as used herein refers to any molecule that inhibits the activity of VCAM1, either partially or completely. An MAEA inhibitor as used herein refers to any molecule that inhibits the activity of MAEA, either partially or completely.
[0066] In certain embodiments of the methods, compositions, and kits provided herein, the VCAM1 and/or MAEA inhibitor inhibits VCAM1 and/or MAEA by binding to VCAM1 and/or MAEA. Examples of such VCAM1 and/or MAEA inhibitors include, e.g., antagonistic VCAM1 and/or MAEA antibodies or fusion proteins thereof, inactive forms of a VCAM1 and/or MAEA ligand (e.g., a truncated or otherwise mutated form of a VCAM1 and/or MAEA ligand) or fusion proteins thereof, small molecules, siRNAs, or aptamers.
[0067] In certain preferred embodiments of the methods, compositions, and kits provided herein, the antibody or antibody fragment is an antagonistic or blocking antibody or fragment. The antibody or antibody fragment that specifically inhibits the activity of VCAM1 is preferably a blocking antibody to VCAM1 or an antibody fragment that blocks the activity of VCAM1. The antibody or antibody fragment that specifically inhibits the activity of MAEA is preferably a blocking antibody to MAEA or an antibody fragment that blocks the activity of MAEA. As used herein, the term antibody refers to an intact antibody, i.e., with complete Fc and Fv regions. Antibody fragment refers to any portion of an antibody, or portions of an antibody linked together, such as, in non-limiting examples, a Fab, F(ab).sub.2, a single-chain Fv (scFv), which is less than the whole antibody but which is an antigen-binding portion and which competes with the intact antibody of which it is a fragment for specific binding to the target. As such a fragment can be prepared, for example, by cleaving an intact antibody or by recombinant means. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989), hereby incorporated by reference in its entirety). Antigen-binding fragments may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies or by molecular biology techniques. In some embodiments, a fragment is an Fab, Fab, F(ab)2, Fd, Fv, complementarity determining region (CDR) fragment, single-chain antibody (scFv), (a variable domain light chain (VL) and a variable domain heavy chain (VH) linked via a peptide linker. In an embodiment, the scFv comprises a variable domain framework sequence having a sequence identical to a human variable domain FR1, FR2, FR3 or FR4. In an embodiment, the scFv comprises a linker peptide from 5 to 30 amino acid residues long. In an embodiment, the scFv comprises a linker peptide comprising one or more of glycine, serine and threonine residues.
[0068] The variable region or variable domain of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody. The variable domain of the heavy chain may be referred to as VH. The variable domain of the light chain may be referred to as VL. These domains are generally the most variable parts of an antibody and contain the antigen-binding sites. The term variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions (HVRs) (or CDRs) both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
[0069] The light chains of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa () and lambda (), based on the amino acid sequences of their constant domains.
[0070] Framework or FR residues are those variable domain residues other than the HVR residues as herein defined.
[0071] The term hypervariable region or HVR when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six HVRs; three in the VH (H1, H2, H3) and three in the VL (L1, L2, L3).
[0072] Also provided is an Anti-MAEA mAb 92.25 having the following sequences, where the Signal sequence/peptide is in italics, CDRs 1-3 are underlined, and the framework (FR) regions are not italicized or underlined.
TABLE-US-00001 Heavychain:DNAsequence(417bp) Signalsequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:8) ATGGAATGGAGCTGGATCTTTCTCTTTCTCCTGTCAGGAACTGCAGGTGTCCTCTCTGAG GTCCAGCTGCAACAGTTTGGAGCTGAGCTGGTGAGGCCTGGGGCTTCAGTGAAGATATC CTGCAAGGCTTCTGGCTACACATTCACTGACTACAACATGGACTGGGTGAAGCAGAGCC ATGCAAAGAGACTTGAGTGGATTGGAGATATTAATCCTAACTATGATAGTCCTACCTACA GCCAGAAGTTCAAGGGAAGGGCCACATTGACTGTAGACAACTCCTCCAGCACCGCCTAC ATGGAGCTCCGCAGCCTGACATCTGAGGACACTGCAGTCTATTACTGTGCAAGGGGACA TTACTACGGCTACGGATACTTCGATGTCTGGGGCGCGGGGACCACGGTCACCGTCTCCT CA; HeavychainFR1:DNAsequence (SEQIDNO:20) GTCCAGCTGCAACAGTTTGGAGCTGAGCTGGTGAGGCCTGGGGCTTCAGTGAAGATATC CTGCAAGGCTTCTGGCTACACATTCACT; HeavychainCDR1:DNAsequence (SEQIDNO:21) GACTACAACATGGAC; HeavychainFR2:DNAsequence (SEQIDNO:22) TGGGTGAAGCAGAGCCATGCAAAGAGACTTGAGTGGATTGGA HeavychainCDR2:DNAsequence (SEQIDNO:23) GATATTAATCCTAACTATGATAGTCCTACCTACAGCCAGAAGTTCAAGGGA; HeavychainFR3:DNAsequence (SEQIDNO:24) AGGGCCACATTGACTGTAGACAACTCCTCCAGCACCGCCTACATGGAGCTCCGCAGCCT GACATCTGAGGACACTGCAGTCTATTACTGTGCAAGG; HeavychainCDR3:DNAsequence (SEQIDNO:25) GGACATTACTACGGCTACGGATACTTCGATGTC; HeavychainFR4:DNAsequence (SEQIDNO:26) TGGGGCGCGGGGACCACGGTCACCGTCTCCTCA; Heavychain:Aminoacidsequence(139aa) Signalpeptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:9) MEWSWIFLFLLSGTAGVLSEVQLQQFGAELVRPGASVKISCKASGYTFTDYNMDWVKQSHA KRLEWIGDINPNYDSPTYSQKFKGRATLTVDNSSSTAYMELRSLTSEDTAVYYCARGHYYGY GYFDVWGAGTTVTVSS; HeavychainFR1:Aminoacidsequence (SEQIDNO:27) EVQLQQFGAELVRPGASVKISCKASGYTFT; HeavychainCDR1:Aminoacidsequence (SEQIDNO:28) DYNMD HeavychainFR2:Aminoacidsequence (SEQIDNO:29) WVKQSHAKRLEWIG; HeavychainCDR2:Aminoacidsequence (SEQIDNO:30) DINPNYDSPTYSQKFKG; HeavychainFR3:Aminoacidsequence (SEQIDNO:31) RATLTVDNSSSTAYMELRSLTSEDTAVYYCAR HeavychainCDR3:Aminoacidsequence (SEQIDNO:32) GHYYGYGYFDV; HeavychainFR4:Aminoacidsequence (SEQIDNO:33) WGAGTTVTVSS; Lightchain:DNAsequence(381bp) Signalsequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:10) ATGGAGTCACAGACTCAGGTCTTTGTATACATGTTGCTGTGGTTGTCTGGTGTTGATGGA GACATTGAGATGACCCAGTCTCAAAAATTCATGTCCACAGCAGTAGGAGACAGGGTCAGC GTCACCTGCAAGGCCAGTCAGAATGTGGGTACTAATGTAGCCTGGTATCAACAGAAACC AGGGAAATCTCCTAAAGTACTGATTTACTCGGCATCCTACCGCTACAGTGGAGTCCCTGA TCGCTTCAGAGGCAGTAGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAGTC TGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACACCTATCCGTGGACGTTCGGTG GAGGCACCAAGCTGGAAATCAAA; LightchainFR1:DNAsequence (SEQIDNO:34) GACATTGAGATGACCCAGTCTCAAAAATTCATGTCCACAGCAGTAGGAGACAGGGTCAGC GTCACCTGC; LightchainCDR1:DNAsequence (SEQIDNO:35) AAGGCCAGTCAGAATGTGGGTACTAATGTAGCC LightchainFR2:DNAsequence (SEQIDNO:36) TGGTATCAACAGAAACCAGGGAAATCTCCTAAAGTACTGATTTAC; LightchainCDR2:DNAsequence (SEQIDNO:37) TCGGCATCCTACCGCTACAGT; LightchainFR3:DNAsequence (SEQIDNO:38) GGAGTCCCTGATCGCTTCAGAGGCAGTAGATCTGGGACAGATTTCACTCTCACCATCAGC AATGTGCAGTCTGAAGACTTGGCAGAGTATTTCTGT; LightchainCDR3:DNAsequence (SEQIDNO:39) CAGCAATATAACACCTATCCGTGGACG; LightchainFR4:DNAsequence (SEQIDNO:40) TTCGGTGGAGGCACCAAGCTGGAAATCAAA; Lightchain:Aminoacidsequence(127aa) Signalpeptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:11) MESQTQVFVYMLLWLSGVDGDIEMTQSQKFMSTAVGDRVSVTCKASQNVGTNVAWYQQKP GKSPKVLIYSASYRYSGVPDRFRGSRSGTDFTLTISNVQSEDLAEYFCQQYNTYPWTFGGGT KLEIK. LightchainFR1:Aminoacidsequence (SEQIDNO:41) DIEMTQSQKFMSTAVGDRVSVTC; LightchainCDR1:Aminoacidsequence (SEQIDNO:42) KASQNVGTNVA; LightchainFR2:Aminoacidsequence (SEQIDNO:43) WYQQKPGKSPKVLIY; LightchainCDR2:Aminoacidsequence (SEQIDNO:102) SASYRYS; LightchainFR3:Aminoacidsequence (SEQIDNO:103) GVPDRFRGSRSGTDFTLTISNVQSEDLAEYFC; LightchainCDR3:Aminoacidsequence (SEQIDNO:44) QQYNTYPWT; LightchainFR4:Aminoacidsequence (SEQIDNO:45) FGGGTKLEIK;
[0073] Also provided is an anti-VCAM1 mAb V64-8 having the following sequences, where the Signal sequence/peptide is in italics, CDRs 1-3 are underlined, and the framework (FR) regions are not italicized or underlined.
TABLE-US-00002 Heavychain:DNAsequence(396bp) Signalsequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:12) ATGAACTTCGGGCTCAGCTTGATTTTCCTTGTCCCTATTTTAAAAGGTGTCCAGTGTGAAG TACAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCC TGTGCAGCCTCTGGATTCACTTTCAGTAGTTATACCATGTCTTGGGTTCGCCAGTCTCCA GAGAAGAGGCTGGAGTGGGTCGCAGAGATTAGTAGTGGTGGTAGTTACACCCACTATG CAGCCACTGTGACGGGCCGATTCACCATCTCCAGAGACAATGTCAAGAACACCCTGTAC CTGGAAATGAGCAGTCTGAGGTCTGAGGACACGGCCATGTATTACTGTGCAAGGGGAGA ACTTTACTGCCCCCCAAGGGACTCTGGTCACTGTCTCTGCA; HeavychainFR1:DNAsequence (SEQIDNO:46) GAAGTACAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAGGGTCCCTGAAACT CTCCTGTGCAGCCTCTGGATTCACTTTCAGT; HeavychainCDR1:DNAsequence (SEQIDNO:47) AGTTATACCATGTCT; HeavychainFR2:DNAsequence (SEQIDNO:48) TGGGTTCGCCAGTCTCCAGAGAAGAGGCTGGAGTGGGTCGCA; HeavychainCDR2:DNAsequence (SEQIDNO:49) GAGATTAGTAGTGGTGGTAGTTACACCCACTATGCAGCCACTGTGACGGGC; HeavychainFR3:DNAsequence (SEQIDNO:50) CGATTCACCATCTCCAGAGACAATGTCAAGAACACCCTGTACCTGGAAATGAGCAGTCTG AGGTCTGAGGACACGGCCATGTATTACTGTGCAAGG; HeavychainCDR3:DNAsequence (SEQIDNO:51) GGAGAACTTTAC; HeavychainFR4:DNAsequence (SEQIDNO:52) TGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA; Heavychain:Aminoacidsequence(132aa) Signalpeptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:13) MNFGLSLIFLVPILKGVQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQSPEK RLEWVAEISSGGSYTHYAATVTGRFTISRDNVKNTLYLEMSSLRSEDTAMYYCARGELYWG QGTLVTVSA; HeavychainFR1:Aminoacidsequence (SEQIDNO:53) EVQLVESGGGLVKPGGSLKLSCAASGFTFS; HeavychainCDR1:Aminoacidsequence (SEQIDNO:54) SYTMS; HeavychainFR2:Aminoacidsequence (SEQIDNO:55) WVRQSPEKRLEWVA; HeavychainCDR2:Aminoacidsequence (SEQIDNO:56) EISSGGSYTHYAATVTG HeavychainFR3:Aminoacidsequence (SEQIDNO:57) RQSPEKRLEWVAEISSGGSYTHYAATVTG; HeavychainCDR3:Aminoacidsequence (SEQIDNO:58) GELY; HeavychainFR4:Aminoacidsequence (SEQIDNO:59) WGQGTLVTVSA; Lightchain:DNAsequence(393bp) Signalsequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:14) ATGAGTCCTGCCCAGTTCCTGTTTCTGTTAGTGCTCTGGATTCGGGAAACCAACGGTGAT GTTGTGTTGACCCAGATTCCATCCACTTTGTCGGTTACCTTTGGACAACCAGCCTCCATCT CTTGCAAGGCAAGTCAGAGCCTCTTAGATAGAGGTGGAAAGACATTTTTCAATTGGTTG TTACAGAGGCCAGGCCAGTCTCCAAAGCGCCTAATCTATCTGGTGTCTAAACTGGACTCT GGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGGACAGATTTCACACTGAAAATCAG CAGAGTGGAGGCTGAGGATTTGGGAGTCTATTATTGCTGGCAAGGTACACATTTTCCGT GGACGTTCGGTGGAGGCACCAGACTGGAAATCAAA; LightchainFR1:DNAsequence (SEQIDNO:60) ATGTTGTGTTGACCCAGATTCCATCCACTTTGTCGGTTACCTTTGGACAACCAGCCTCCAT CTCTTGC; LightchainCDR1:DNAsequence (SEQIDNO:61) AAGGCAAGTCAGAGCCTCTTAGATAGAGGTGGAAAGACATTTTTCAAT; LightchainFR2:DNAsequence (SEQIDNO:62) TGGTTGTTACAGAGGCCAGGCCAGTCTCCAAAGCGCCTAATCTAT; LightchainCDR2:DNAsequence (SEQIDNO:63) CTGGTGTCTAAACTGGACTCT; LightchainFR3:DNAsequence (SEQIDNO:64) GGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGGACAGATTTCACACTGAAAATCAG CAGAGTGGAGGCTGAGGATTTGGGAGTCTATTATTGC; LightchainCDR3:DNAsequence (SEQIDNO:65) TGGCAAGGTACACATTTTCCGTGGACG; LightchainFR4:DNAsequence (SEQIDNO:66) TTCGGTGGAGGCACCAGACTGGAAATCAAA; Lightchain:Aminoacidsequence(131aa) Signalpeptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:15) MSPAQFLFLLVLWIRETNGDVVLTQIPSTLSVTFGQPASISCKASQSLLDRGGKTFFNWLLQR PGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPWTFGG GTRLEIK. LightchainFR1:Aminoacidsequence (SEQIDNO:67) DVVLTQIPSTLSVTFGQPASISC; LightchainCDR1:Aminoacidsequence (SEQIDNO:68) KASQSLLDRGGKTFFN; LightchainFR2:Aminoacidsequence (SEQIDNO:69) WLLQRPGQSPKRLIY; LightchainCDR2:Aminoacidsequence (SEQIDNO:70) LVSKLDS; LightchainFR3:Aminoacidsequence (SEQIDNO:71) GVPDRFTGSGSGTDFTLKISRVEAEDLGVYYC; LightchainCDR3:Aminoacidsequence (SEQIDNO:72) WQGTHFPWT; LightchainFR4:Aminoacidsequence (SEQIDNO:73) FGGGTRLEIK;
[0074] Also provided is an Anti-VCAM1 mAb V196-4 having the following sequences, where the Signal sequence/peptide is in italics, CDRs 1-3 are underlined, and the framework (FR) regions are not italicized or underlined.
TABLE-US-00003 Heavychain:DNAsequence(396bp) Signalsequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:16) ATGAACTTCGGGCTCAGCTTGATTTTCCTTGTCCTTATTTTAAAAGGTGTCCATTGTGAAG TGCAGCTGGTGGAGTCTGGGGGAGCCTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCC TGTGTAGCCTCTGGATTCACTTTCAGTAGCTATGCCATGTCTTGGGTTCGCCAGTCTCCA GAGAAGAAGCTGGAGTGGGTCGCAGAAATTAGTAGTACTGGTAGTTACACCCACTATCC CGACACTGTGACGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTGTACC TGGAAATGAGCAGTCTGAGGTCTGAGGACACGGCCATGTATTACTGTGCAAGAGGGGAG GCGCTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA; HeavychainFR1:DNAsequence (SEQIDNO:74) GAAGTGCAGCTGGTGGAGTCTGGGGGAGCCTTAGTGAAGCCTGGAGGGTCCCTGAAACT CTCCTGTGTAGCCTCTGGATTCACTTTCAGT; HeavychainCDR1:DNAsequence (SEQIDNO:75) AGCTATGCCATGTCT; HeavychainFR2:DNAsequence (SEQIDNO:76) TGGGTTCGCCAGTCTCCAGAGAAGAAGCTGGAGTGGGTCGCA; HeavychainCDR2:DNAsequence (SEQIDNO:77) GAAATTAGTAGTACTGGTAGTTACACCCACTATCCCGACACTGTGACGGGC; HeavychainFR3:DNAsequence (SEQIDNO:78) CGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTGTACCTGGAAATGAGCAGTCTG AGGTCTGAGGACACGGCCATGTATTACTGTGCAAGA; HeavychainCDR3:DNAsequence (SEQIDNO:79) GGGGAGGCGCTC; HeavychainFR4:DNAsequence (SEQIDNO:80) TGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA; Heavychain:Aminoacidsequence(132aa) Signalpeptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:17) MNFGLSLIFLVLILKGVHCEVQLVESGGALVKPGGSLKLSCVASGFTFSSYAMSWVRQSPEKK LEWVAEISSTGSYTHYPDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGEALWGQG TSVTVSS; HeavychainFR1:Aminoacidsequence (SEQIDNO:81) EVQLVESGGALVKPGGSLKLSCVASGFTFS; HeavychainCDR1:Aminoacidsequence (SEQIDNO:82) SYAMS; HeavychainFR2:Aminoacidsequence (SEQIDNO:83) WVRQSPEKKLEWVA; HeavychainCDR2:Aminoacidsequence (SEQIDNO:84) EISSTGSYTHYPDTVTG; HeavychainFR3:Aminoacidsequence (SEQIDNO:85) RFTISRDNAKNTLYLEMSSLRSEDTAMYYCAR; HeavychainCDR3:Aminoacidsequence (SEQIDNO:86) GEAL; HeavychainFR4:Aminoacidsequence (SEQIDNO:87) WGQGTSVTVSS; Lightchain:DNAsequence(393bp) Signalsequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:18) ATGAGTCCTGCCCAGTTCCTGTTTCTGTTAGTGCTCTGGATTCGGGAAACCAACGGTGAT GTTGTGATGACCCAGACTCCACTCACTTTGTCGGTTACCGTTGGACAACCAGCCTCCATC TCTTGCAAGTCAAGTCATAGCCTCTTAGATAGTTATGGAAAGACATATTTGAATTGGTTT TTACAGAGGCCAGGCCAGTCTCCAAAGCGCCTAATCTATCTGGTGTCTAAACTGGACTCT GGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGGACAGATTTCACACTGAAAATCAG CAGAGTGGAGGCTGAGGATTTGGGACTTTATTATTGCTGGCAGGGTACACATTTTCCGTG GACGTTCGGTGGAGGCACCAAGCTGGAAATCAAA; LightchainFR1:DNAsequence (SEQIDNO:88) GATGTTGTGATGACCCAGACTCCACTCACTTTGTCGGTTACCGTTGGACAACCAGCCTCC ATCTCTTGC; LightchainCDR1:DNAsequence (SEQIDNO:89) AAGTCAAGTCATAGCCTCTTAGATAGTTATGGAAAGACATATTTGAAT; LightchainFR2:DNAsequence (SEQIDNO:90) TGGTTTTTACAGAGGCCAGGCCAGTCTCCAAAGCGCCTAATCTAT; LightchainCDR2:DNAsequence (SEQIDNO:91) CTGGTGTCTAAACTGGACTC; LightchainFR3:DNAsequence (SEQIDNO:92) TGGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGGACAGATTTCACACTGAAAATCAG CAGAGTGGAGGCTGAGGATTTGGGACTTTATTATTGC; LightchainCDR3:DNAsequence (SEQIDNO:93) TGGCAGGGTACACATTTTCCGTGGACG; LightchainFR4:DNAsequence (SEQIDNO:94) TTCGGTGGAGGCACCAAGCTGGAAATCAAA; Lightchain:Aminoacidsequence(131aa) Signalpeptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQIDNO:19) MSPAQFLFLLVLWIRETNGDVVMTQTPLTLSVTVGQPASISCKSSHSLLDSYGKTYLNWFLQ RPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGLYYCWQGTHFPWTFGG GTKLEIK; LightchainFR1:Aminoacidsequence (SEQIDNO:95) DVVMTQTPLTLSVTVGQPASISC; LightchainCDR1:Aminoacidsequence (SEQIDNO:96) KSSHSLLDSYGKTYLN; LightchainFR2:Aminoacidsequence (SEQIDNO:97) WFLQRPGQSPKRLIY; LightchainCDR2:Aminoacidsequence (SEQIDNO:98) LVSKLDS; LightchainFR3:Aminoacidsequence (SEQIDNO:99) GVPDRFTGSGSGTDFTLKISRVEAEDLGLYYC; LightchainCDR3:Aminoacidsequence (SEQIDNO:100) WQGTHFPWT; LightchainFR4:Aminoacidsequence (SEQIDNO:101) FGGGTKLEIK.
[0075] In other embodiments, a monoclonal antibody to MAEA for use in the present methods, compositions, and kits may be a monoclonal antibody to MAEA available from R&D Systems (MAB7288), and a recombinant mouse monoclonal antibody to human MAEA is available from Creative Biolabs. In other embodiments, a monoclonal antibody to VCAM1 for use in the present methods, compositions, and kits may be a monoclonal monoclonal antibody available from, e.g., Thermo Fisher Scientific, Abcam, Sigma-Aldrich, and Abnova. VCAM1 monoclonal antibodies are also described in US2010/0172902, incorporated herein by reference.
[0076] The antibody can be a human antibody or a humanized antibody or a chimeric antibody. As used herein, a human antibody unless otherwise indicated is one whose sequences correspond to (i.e., are identical in sequence to) an antibody that could be produced by a human and/or has been made using any of the techniques used for making human antibodies, but not one which has been made in a human. Chimeric antibodies are forms of non-human (e.g., murine) antibodies that contain human sequences in the constant domain regions of the antibody in order to eliminate or reduce immunogenic effects. Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that also contain human sequences in the variable domain regions of the antibody and thus contain minimal sequence derived from non-human immunoglobulin. In general, a humanized antibody can comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework regions are those of a human immunoglobulin sequence. In one embodiment, a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a HVR of a non-human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity. For example, the antibody to MAEA could be a human or humanized antibody having the CDRs of MAB7288 (which is a mouse IgG1 Ab). Techniques to humanize a monoclonal antibody are well known and are described in, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; and 6,180,370, the content of each of which is hereby incorporated by reference in its entirety.
[0077] Also provided is a monoclonal antibody to MAEA and a monoclonal antibody to VCAM1. The term monoclonal antibody as used herein refers to an antibody member of a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts. Thus, the modifier monoclonal indicates the character of the antibody as not being a mixture of discrete antibodies. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. In addition to their specificity, monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins. Thus, an identified monoclonal antibody can be produced by non-hybridoma techniques, e.g., by appropriate recombinant means once the sequence thereof is identified.
[0078] In certain embodiments, the antibody is a monoclonal antibody. Antibodies for use in the present methods, compositions, and kits may include natural antibodies, synthetic antibodies, monoclonal antibodies, polyclonal antibodies, chimeric antibodies, humanized antibodies, multispecific antibodies, bispecific antibodies, dual-specific antibodies, anti-idiotypic antibodies, or fragments thereof that retain the ability to bind a specific antigen, for example, VCAM1 or MAEA.
[0079] Compositions comprising the antibodies provided herein can additionally comprise stabilizers to prevent loss of activity or structural integrity of the protein due to the effects of denaturation, oxidation, or aggregation over a period of time during storage and transportation prior to use. The compositions can comprise one or more of any combination of salts, surfactants, pH and tonicity agents such as sugars can contribute to overcoming aggregation problems. Where a composition of the present disclosure is administered as an injection, it is desirable to have a pH value in an approximately neutral pH range, it is also advantageous to minimize surfactant levels to avoid bubbles in the formulation which are detrimental for injection into subjects. In an embodiment, the compositions can be in liquid form and stably supports high concentrations of bioactive antibody in solution and is suitable for inhalational or parenteral administration. In an embodiment, the composition is suitable for intravenous, intramuscular, intraperitoneal, intradermal and/or subcutaneous injection. In an embodiment, the composition is in liquid form and has minimized risk of bubble formation and anaphylactoid side effects. In an embodiment, the composition is isotonic. In an embodiment, the composition has a pH or 6.8 to 7.4.
[0080] Compositions comprising the antibodies or fragments thereof provided herein can also be lyophilized or provided in any suitable form including, but not limited to, injectable solutions, inhalable solutions, gel forms, or tablet forms.
[0081] Compositions comprising the antibodies or fragments thereof provided herein can be administered to the subject in a pharmaceutical composition comprising the antibody or fragment and a pharmaceutically acceptable carrier. The term carrier is used in accordance with its art-understood meaning, to refer to a material that is included in a pharmaceutical composition but does not abrogate the biological activity of the antibody or antibody fragment included within the composition. Pharmaceutically acceptable carriers include, for example, sterile isotonic saline, phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsions.
[0082] The antibody or antibody fragment can be conjugated with a cytotoxic agent.
[0083] The antibody or antibody fragment can be administered to subjects using routes of administration known in the art, including, but are not limited to, intravenous, intramuscular and intraperitoneal administration.
[0084] Also provided are a blocking antibody to VCAM1, an antibody fragment that blocks the activity of VCAM1, a blocking antibody to MAEA, and an antibody fragment that blocks the activity of MAEA for use as a medicament in treatment of cancer, in inhibiting engraftment of leukemia cells such as AML, CML, PV, ET, ALL, and CLL cells, and in enhancing the efficacy of cytarabine for treatment of cancer, wherein the antibody or antibody fragment is specific for VCAM1 or MAEA. The cancer can be, for example, one or more of bladder, breast, brain, colorectal, kidney, oesophagus, gastrointestinal tract, liver, lung, ovarian, pancreas, prostate, skin, stomach, and uterine cancer, melanoma, myelodysplastic syndrome (MDS) (a pre-leukemia), non-Hodgkin lymphoma, and a hematologic malignancy. Hematologic malignancies can derive from myeloid or lymphoid cell lines. Lymphomas, lymphocytic leukemias, and myeloma are from the lymphoid line, while acute and chronic myelogenous leukemia, myelodysplastic syndromes and myeloproliferative diseases are myeloid in origin. The hematologic malignancy can be a myeloproliferative disease. The hematologic malignancy can be, for example, AML, CML, PV, ET, ALL, or CLL.
[0085] The present disclosure provides a method of treating a condition (e.g., a cancer or sickle cell disease) in a subject comprising administering to the subject an antibody or antibody fragment in an amount effective to inhibit the activity of VCAM1 and/or an antibody or antibody fragment in an amount effective to inhibit the activity MAEA to treat the condition in a subject, wherein the antibody or antibody fragment is specific for VCAM1 or MAEA.
[0086] As used herein, the term treat a cancer means to eradicate the cancer in a subject, or to reduce the size of a cancer or cancer tumor in the subject, or to stabilize a cancer or cancer tumor in the subject so that it does not increase in size, or to prevent or reduce the spread of the cancer in the subject.
[0087] As used herein, the term treat sickle cell disease (SCD) means to reduce the acute (e.g., vaso-occlusion) or chronic (e.g., organ damage) manifestations of SCD.
[0088] A therapeutically effective amount of a composition as used herein is an amount of a composition that produces a desired therapeutic effect in a subject, such as treating cancer, treating SCD, or treating PV. In certain embodiments, the therapeutically effective amount is an amount of the composition that yields maximum therapeutic effect. In other embodiments, the therapeutically effective amount yields a therapeutic effect that is less than the maximum therapeutic effect. For example, a therapeutically effective amount may be an amount that produces a therapeutic effect but that also avoids one or more side effects that is associated with a dosage that yields the maximum therapeutic effect. A therapeutically effective amount for a particular composition will vary based on a variety of factors, including but not limited to the characteristics of the therapeutic composition (e.g., activity, pharmacokinetics, pharmacodynamics, and bioavailability), the physiological condition of the subject (e.g., age, body weight, sex, disease type and stage, medical history, general physical condition, responsiveness to a given dosage, and other present medications), the nature of any pharmaceutically acceptable carriers in the composition, and the route of administration. One skilled in the clinical and pharmacological arts will be able to determine a therapeutically effective amount through routine experimentation, namely by monitoring a subject's response to administration of a composition and adjusting the dosage accordingly. For additional guidance, see, e.g., Remington: The Science and Practice of Pharmacy, 22nd Edition, Pharmaceutical Press, London, 2012, and Goodman & Gilman's The Pharmacological Basis of Therapeutics, 12th Edition, McGraw-Hill, New York, N.Y., 2011, the entire disclosures of which are incorporated by reference herein.
[0089] The cancer can be, for example, one or more of bladder, breast, brain, colorectal, kidney, oesophagus, gastrointestinal tract, liver, lung, ovarian, pancreas, prostate, skin, stomach, and uterine cancer, melanoma, non-Hodgkin lymphoma, myelodysplastic syndrome (MDS) (a pre-leukemia), and a hematologic malignancy. Hematologic malignancies can derive from myeloid or lymphoid cell lines. Lymphomas, lymphocytic leukemias, and myeloma are from the lymphoid line, while acute and chronic myelogenous leukemia, myelodysplastic syndromes and myeloproliferative diseases are myeloid in origin. The hematologic malignancy can be a myeloproliferative disease. The hematologic malignancy can be, for example, acute myeloid leukemia (AML), chronic myeloid leukemia (CML), polycythemia vera (PV), essential thrombocytosis (ET), acute lymphoblastic leukemia (ALL), or chronic lymphocytic leukemia (CLL).
[0090] The treatment can comprise administering to a subject a combination of two or more of:
[0091] a) a blocking antibody to VCAM1 or an antibody fragment that blocks the activity of VCAM1, wherein the antibody or antibody fragment is specific for VCAM1;
[0092] b) a blocking antibody to MAEA or an antibody fragment that blocks the activity of MAEA, wherein the antibody or antibody fragment is specific for MAEA;
[0093] c) one or more chemotherapeutic agents; and
[0094] d) one or more immune system enhancing agents;
[0095] wherein the combination includes at least a) or b).
[0096] The different components of the combination can be administered at the same time, sequentially, or one spaced in time before the other. In certain embodiments of the methods, compositions, and kits provided herein, an VCAM1 inhibitor or MAEA inhibitor, e.g., a VCAM1 or MAEA antibody or antibody fragment, may be administered together as part of the same composition. In other embodiments of the methods provided herein, the MAEA inhibitor and the VCAM1 inhibitor may both be administered separately, i.e., as separate compositions. In these embodiments, the inhibitors may be administered sequentially or simultaneously, and may be administered via the same or different routes. In those embodiments where the inhibitors are administered sequentially, they may be administered at the same or different intervals. For example, one inhibitor may be administered more frequently than the other or may be administered over a longer time course. In certain of these embodiments, one inhibitor may be administered one or more times prior to the first administration of the second inhibitor. When administration of the second inhibitor is initiated, administration of the first inhibitor may either cease or continue for all or part of the course of administration of the second inhibitor. In certain embodiments wherein the MAEA inhibitor or the VCAM1 inhibitor is MAEA antagonist antibody or a VCAM1 antagonist antibody, the antibody may be administered two or more times per day, daily, two or more times per week, weekly, bi-weekly (i.e., every other week), every third week, or monthly. In certain embodiments, the antibody is administered weekly, bi-weekly, or every third week, or monthly. In certain embodiments, the MAEA inhibitor and/or the VCAM1 inhibitor may be administered for a specific time course determined in advance. For example, the MAEA and/or VCAM1 inhibitors may be administered for a time course of 1 day, 2 days, 3, days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, or 10 weeks. In other embodiments, the MAEA and/or VCAM1 inhibitors may be administered indefinitely, or until a specific therapeutic benchmark is reached. For example, the MAEA and/or VCAM1 inhibitors may be administered until tumor growth is arrested or reversed, until one or more tumors are eliminated, or until the number of cancer cells are reduced to a specific level.
[0097] The one or more chemotherapeutic agents can be, for example, but not limited to, cytarabine (cytosine arabinoside or ara-C), an anthracycline drug (such as, e.g., daunorubicin (daunomycin), idarubicin, and/or mitoxantrone), cladribine (2-CdA), fludarabine (Fludara), topotecan, etoposide (VP-16), 6-thioguanine (6-TG), hydroxyurea (Hydrea), a corticosteroid drug (such as, e.g., prednisone or dexamethasone (Decadron)), methotrexate (MTX), 6-mercaptopurine (6-MP), azacitidine (Vidaza), and/or decitabine (Dacogen).
[0098] The one or more immune system enhancing agents can be, for example, but not limited to, an inhibitor of CD47 (also called Cluster of Differentiation 47 and integrin associated protein (IAP)), PD-1 (also called Programmed cell death protein 1)/PD-L1 (also called Programmed death-ligand 1, Cluster of Differentiation 274 (CD274) and B7 homolog 1 (B7-H1)), CTLA-4 (also called cytotoxic T-lymphocyte-associated protein 4 and CD152 (Cluster of Differentiation 152)), CD200 (also called Cluster of Differentiation 200 or OX-2 membrane glycoprotein)/CD200R (CD200 receptor), LAG-3 (also called Lymphocyte-activation gene 3 protein), TIM-3 (also called T-cell immunoglobulin and mucin-domain containing-3), VISTA (also called V-domain Ig suppressor of T cell activation), or TIGIT (also called T cell immunoreceptor with Ig and ITIM domains). The agent that inhibits the activity of, for example, CD47 can be, for example, a blocking antibody to CD47 or an antibody fragment that blocks the activity of CD47, where the antibody or antibody fragment is specific to CD47. Examples of blocking antibodies to CD47 are described in US2016/0137733, US2016/0137734 and US2017/0081407, hereby incorporated by reference. The agent that inhibits the activity of CD47 can also be a construct having a SIRP alpha domain or variant thereof. Such constructs are described, for example, in US2015/0071905, US2015/0329616, US2016/0177276, US2016/0186150, and US20170107270, hereby incorporated by reference.
[0099] Also provided is a method of inhibiting engraftment of leukemia cells in a subject, the method comprising administering to the subject an antibody or antibody fragment in an amount effective to inhibit the activity of vascular cell adhesion molecule 1 (VCAM1) and/or an antibody or antibody fragment in an amount effective to inhibit the activity of macrophage erythroblast attacher (MAEA) to inhibit leukemia cell engraftment in a subject, wherein the antibody or antibody fragment is specific for VCAM1 or MAEA. The leukemia cells can be, for example, acute myeloid leukemia (AML), chronic myeloid leukemia (CML), polycythemia vera (PV), essential thrombocytosis (ET), acute lymphoblastic leukemia (ALL), or chronic lymphocytic leukemia (CLL) cells.
[0100] Still further provided is a method of enhancing the efficacy of cytarabine for treating a cancer in a subject, comprising administering to the subject an antibody or antibody fragment in an amount effective to inhibit the activity of VCAM1 and/or an antibody or antibody fragment in an amount effective to inhibit the activity of MAEA in combination with cytarabine to enhance the efficacy of cytarabine for treating a cancer in a subject, wherein the antibody or antibody fragment is specific for VCAM1 or MAEA. The cancer can be, for example, one or more of AML, CML, PV, ET, ALL, CLL or non-Hodgkin's lymphoma.
[0101] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0102] From the foregoing, it will be appreciated that specific embodiments of the invention have been described herein for purposes of illustration, but that various modifications may be made without deviating from the scope of the invention. Accordingly, the invention is not limited except as by the appended claims.
[0103] The following examples are provided in order to better illustrate the claimed invention and are not to be interpreted as limiting the scope of the invention. To the extent that specific materials are mentioned, they are only mentioned for purposes of illustration and are not intended to limit the invention. One skilled in the art may develop equivalent means or reactants without the exercise of inventive capacity and without departing from the scope of the present invention. It will be understood that many variations can be made in the procedures described herein while still remaining within the bounds of the present invention. The inventors intend such variations to be included within the scope of the invention. One skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXAMPLES
Example 1
Anti-VCAM1 Therapies
[0104] VCAM1 is expressed on hematopoietic stem and progenitor cells (HSPCs,
[0105] To test whether VCAM1 antibody blockade can improve conventional chemotherapy in animals with established disease, AML was established in immunocompetent C57BL/6 recipients and then therapy of moribund leukemic mice was initiated with a daily injection of IgG control, anti-VCAM1, cytarabine, or a combination of anti-VCAM1/cytarabine. Anti-VCAM1 antibody inhibition synergised with conventional chemotherapy to clear leukemic stem cells (LSCs) while sparing healthy HSCs, significantly prolonging mice survival (
[0106] Analysis of a recently published RNA-sequencing dataset of 675 human cancer cell lines indicated that >50% of those lines express VCAM1 (
[0107] These studies demonstrate that VCAM1 is upregulated on malignant hematopoietic cells and that inhibition of binding of VCAM1 to its receptors will promote cancer cell clearance. These studies also indicate that this cell clearance mechanism is likely via a don't-eat-me signal since incubation of VCAM1.sup./ AML cells with macrophages led to enhanced phagocytosis of leukemic cells. This effect did not result from a reduced expression of CD47, since CD47 expression was not altered in VCAM1.sup./ mice. Monoclonal antibodies either alone or in combination with treatment such as cytarabine are an effective treatment for cancer.
Example 2
VCAM1 Confers Innate Immune Tolerance on Hematopoietic and Leukemic Stem Cells
[0108] Haematopoietic stem cells (HSCs) home to the bone marrow (BM) via, in part, the interactions with vascular cell adhesion molecule-1 (VCAM1)..sup.57-59 Upon migrating into the BM, HSCs are vetted by perivascular phagocytes to ensure their self-integrity. In this Example, results show that VCAM1 is also expressed on healthy HSCs and upregulated on leukemic stem cells (LSCs) where it serves as a quality-control checkpoint for entry into BM by providing don't-eat-me stamping in the context of major histocompatibility complex (MHC) class-I presentation. While MHC haplotype-mismatched HSCs can engraft the BM of recipient mice, conditional VCAM1 deletion, in the setting of haplotype mismatch, leads to impaired hematopoietic recovery due to HSC recognition and clearance by phagocytes. Mechanistically, MHC mismatched HSCs are recognized at least in part by paired Ig-like receptor-B (PIR-B) expressed on murine phagocytic myeloid cells. VCAM1 is also used by cancer cells to escape immune detection as its expression is upregulated in multiple cancers, including acute myeloid leukemia (AML), where high expression is significantly associated with poor prognosis. In AML mouse models, VCAM1 promotes disease progression while VCAM1 inhibition or deletion significantly reduces the leukemia burden and extends the survival of mice. These results suggest that VCAM1 engagement regulates a critical immune checkpoint gate in the BM and offers a novel strategy to eliminate cancer cells via modulation of the innate immune tolerance.
[0109] HSCs possess the ability to replenish the haematopoietic system following transplantation into marrow-ablated recipients..sup.60 VCAM1, a vascular endothelial and stromal adhesion molecule, is required for vascular development.sup.61 and known to mediate the entry.sup.62,63 and egress.sup.63-65 of HSCs and progenitors between BM and the blood circulation. Using flow cytometry analysis, Applicants found that VCAM1 was also expressed at high levels on the majority of HSCs (75%) and some progenitors in the BM, and its expression was downregulated in HSCs mobilized in the periphery (spleen and blood;
[0110] To resolve the discrepancy between the dramatic HSC transplantation phenotype and the absence of constitutive HSC phenotype, the fate of injected VCAM1.sup.Csf1r-iCre and VCAM1.sup.fl/fl BM cells was tracked after transplantation. While no difference in homing to BM 3 h after injection in lethally irradiated recipients was found (
[0111] In the course of studies to identify the immunological mechanism underlying the engraftment failure of VCAM1-deficient HSCs, VCAM1.sup.Csf1r-iCre micewhere Csf1r-iCre transgenic mice generated in the FVB background were backcrossed over 10 generations into the C57BL/6 backgroundremained heterozygote for the MHC haplotypes H-2q (from FVB) and H-2b (from C57BL/6) (
[0112] VCAM1 interacts with 41 integrin (also known as VLA-4), which is expressed on most hematopoietic cells..sup.73 The mouse PIR-B receptor, expressed by myeloid phagocytes and B cells.sup.74 provides negative regulation of immune cells upon recognition of MHC-I molecules..sup.75 Accordingly, PIR-B may cooperate in the anti-phagocytic activity of VCAM1 and MHC-I. Flow cytometry analysis of PIR-B expression in BM immune cells shows that the vast majority (>63%) of Gr1high and Gr1low monocytes express both PIR-B and the VCAM1 counterreceptor VLA4 whereas these are expressed in much lower fractions in other immune cells (
[0113] Leukemic cells can upregulate CD47.sup.88,89 or MHC class-I.sup.89 molecules to avoid phagocytosis or aberrantly express pro-phagocytic signals including AML-specific neo-antigens and AML-associated antigens that can elicit anti-leukemia immune responses if the balance between anti-phagocytic and phagocytic signals is perturbed..sup.72 To test the effect of genetic VCAM1 deletion and MHC-mismatch on AML progression, VCAM1.sup.Csf1r-iCre; H-2.sup.b/q and VCAM1.sup.fl/fl; H-2.sup.b/q Lineage.sup. Sca-1.sup.+ c-Kit.sup.+ (LSK) cells were transduced with the pMSCV-MLL-AF9-GFP oncogene. Strikingly, FACS analysis of primary AML recipient mouse BM revealed a marked reduction (>99%) of phenotypic VCAM1.sup.Csf1r-iCre LSCs compared to VCAM1.sup.fl/fl control (
[0114] To investigate the requirements of phagocytic cells in the in vivo clearance of MHC mismatched VCAM1.sup.Csf1r-iCre AML, phagocytes were depleted by injection of clodronate liposomes (or control PBS liposomes) prior to and after transplant of VCAM1.sup.fl/fl and VCAM1.sup.Csf1r-iCre AML cells (
[0115] As high VCAM1 is associated with reduced survival of patients with AML in the TCGA database (
[0116] Next, VCAM1 expression was assessed in highly purified primary human AML stem and progenitor cells relative to healthy age-matched control samples from published data of AML patients with normal karyotype, complex karyotype, and deletion of chromosome 7..sup.90,91 Results from these experiments demonstrated that VCAM1 was significantly overexpressed in short-term repopulating HSCs (ST-HSCs), the compartment most enriched in functional human LSCs, particularly in the group with normal AML karyotype (
[0117] The therapeutic outcomes in AML remain poor, with relapses representing the major cause of treatment failure due to resistant disease. The immune system has emerged as a critical defense for preventing tumor initiation and controlling tumor growth..sup.88,89,90,92,93 Results provided herein reveal a novel function for the HSC niche molecule VCAM1 on hematopoietic and leukemic stem cells by acting cell-autonomously as a don't-eat-me signal in the context of MHC-I presentation. VCAM1 regulates a critical vetting process by resident phagocytes in the BM to allow the entry of healthy or malignant stem cells. This vetting requires parallel checkpoints by VCAM1 and MHC-I on the stem cells and their counter-receptors on phagocytes, where the absence or blockade of VCAM1 combined with MHC mismatch instruct phagocytes to kill (
Example 3
Anti-VCAM1 Therapies
[0118] The VCAM-1 protein mediates the adhesion of lymphocytes, monocytes, neutrophils, eosinophils, basophils, and sickle red blood cells (RBCs) to the vascular endothelium..sup.127 VCAM1 is inducible by inflammatory cytokines such as TNF-alpha and IL1. VCAM-1 also functions in leukocyte-endothelial cell signal transduction and may play a role in the development of atherosclerosis and rheumatoid arthritis (RA)..sup.128 Given VCAM1's role in leukocyte adhesion during inflammation, we reasoned that it may be an important target to protect SCD mice from acute vaso-occlusion.
[0119] To test the effect of an anti-VCAM1 antibody on a murine model for SCD, mice were intravenously injected with 200 g/mice rat IgG1 or anti-mouse VCAM-1 antibody (clone M/K-2.7 from BioxCell) at 16 hours and 2 hours before TNF- challenge (n=5, rat IgG1 antibody 200 g/m ice or VCAM1 antibody 200 g/m ice). These results show that white blood cell (WBC) rolling was significantly increased (p<0.0001) in mice injected with an anti-VCAM1 antibody as compared to mice injected with rat IgG (
[0120] Blood was harvested and total and differential counts were obtained using an Advia cell counter.
[0121] Inventors next investigated if the VCAM1 receptor, the integrin alpha4beta1 (CD49d) was expressed on the surface of neutrophils by flow cytometry.
Example 4
Anti-MAEA Therapies
[0122] Conditional MAEA knockout (MAEA.sup.floxed) mice were generated and macrophage MAEA expression deleted by Csf1r-Cre (
[0123] Unexpectedly, MAEA.sup.Csf1r-Cre mice also exhibited marked reductions in circulating leukocytes (
[0124] It was hypothesized that leukemia cells might hijack the same mechanism for their progression. Indeed, significant association of MAEA amplification mutations was found with many human cancer types (
[0125] These results indicate that MAEA is a novel adverse prognosis factor and drug target expressed on malignant hematopoietic and other cancer cells, and that MAEA is a target to promote cancer cell clearance by the host immune system.
Example 5
Anti-MAEA Antibodies. MAEA Expressed by Macrophages, But Not Erythroblasts, Maintains Postnatal Bone Marrow Erythroblastic Islands
[0126] Red blood cell (RBC) homeostasis is tightly regulated by balanced production and clearance. Bone marrow (BM) erythroid precursors were first observed several decades ago in tight association with a central macrophage in a structure referred to as erythroblastic island (EI)..sup.1 Macrophages regulate both normal and diseased erythropoiesis, including promotion of erythroid precursor survival and proliferation, iron homeostasis and transfer, and terminal maturation and enucleation..sup.2-5 These activities are promoted by direct interactions between the macrophages and erythroblasts.sup.6,7 via several proposed adhesion mechanisms including (macrophage: erythroblast) VCAM1: VLA-4,.sup.8,9 V: Icam4,.sup.10 or MAEA: MAEA,.sup.7 CD163,.sup.11 and Palladin.sup.12. However, the exact role of these adhesion molecules during in vivo adult erythropoiesis has not been determined.
[0127] Among these, MAEA was originally identified as an adhesion molecule expressed by both macrophages and erythroblasts and suggested to mediate EI formation via its homophilic interactions..sup.7,13 Targeted gene inactivation of MAEA caused severe defects in fetal liver erythropoiesis and macrophage development,.sup.14 but the perinatal lethality of MAEA-null embryos has prevented detailed examination of its function in adult hematopoiesis. In this study, a conditional allele of MAEA was generated. MAEA was determined to play a critical role in adult BM macrophage development and EI function. Comparative analysis with VCAM1 deletion shows that MAEA exerts a dominant role in the EI. Selective deletion of MAEA in macrophage or erythroblast shows only disruption of BM erythropoiesis when MAEA is deleted in macrophage, suggesting that MAEA may not interact by homophilic interactions.
Methods
[0128] Animals. MAEA.sup.fl/fl mice were generated as described below. VCAM1.sup.fl/fl mice.sup.15 were kindly provided by Dr. Thalia Papayannopoulou and backcrossed to C57BL/6 strain for at least 10 generations. Csf1r-Cre mice.sup.16 were a gift from Dr. Jeffrey W. Pollard (University of Edinburgh) and also backcrossed onto C57BL/6 background. CD169-Cre knockin mice were previously generated and described.sup.17. Epor-Cre mice.sup.18 were kindly provided by Dr. Ann Mullally (Dana-Farber/Brigham and Women's Hospital). C57BL/6 (CD45.2) and BI6-Ly5.1 (CD45.1) mice were purchased from Charles River Laboratories (Frederick Cancer Research Center, Frederick, Md.)/NCI or the Jackson Laboratories (B6.SJL-Ptprc.sup.a Pepc.sup.b/BoyJ). R26-tdTomato (B6.Cg-Gt(ROSA)26Sor.sup.tm14(CAG-tdTomato)Hze/J) and Mx1-Cre (B6.Cg-Tg(Mx1-cre)1Cgn/J) mice were obtained from Jackson Laboratories. All animals were housed in specific pathogen-free barrier facility. All experimental procedures were approved by the Animal Care and Use Committee of Albert Einstein College of Medicine. All experiments were performed on mice of both genders with littermate controls from the same colony between 6-12 weeks of age.
[0129] Generation of MAEA.sup.fl/fl mice. The EuMMCR targeting vector PG00141_Z_1_G10 was purchased and electroporated into WW6 embryonic stem (ES) cells. After drug selection, resistant ES cell colonies were picked and screened by Southern blot analysis using 5 and 3 external probes. Correctly targeted ES cell clones were injected into C57BL/6 blastocysts and the resulting chimeric mice were bred with C57BL/6 animals to establish the MAEA.sup.targeted line. Once the germline transmission was confirmed, the MAEA.sup.targeted mice were crossed to Rosa26.sup.FLP1 mice (Jax stock #009086) to remove the LacZ/Neo cassette and generate the floxed allele MAEA.sup.fl. Both alleles were then backcrossed onto C57BL/6 background for at least 5 generations before crossing to the various Cre strains for functional studies. Genotyping was done by ear clip genomic DNA PCR using primers F1+R1+R2 and F2+R3+R4. Primer sequences are as follows: F1: gttcagcctcaggattcagg (SEQ ID NO:1); R1: atgagcaggggacctcaac (SEQ ID NO:2); R2: aactgatggcgagctcaga (SEQ ID NO:3); F2: caccagctcaggcagttaca (SEQ ID NO:4); R3: ccacaacgggttcttctgtt (SEQ ID NO:5); R4: cgggaagaagtgggattacc (SEQ ID NO:6).
[0130] Antibodies and flow cytometry. Purified goat anti-MAEA polyclonal antibody (I-20) was purchased from Santa Cruz and used at a 1:100 concentration. Conjugated donkey anti-goat IgG secondary antibodies were from Thermo Fisher and used at a 1:800 concentration. Fluorochrome-conjugated or biotinylated antibodies against mouse Gr-1 (Ly6C/G) (clone RB6-8C5), CD115 (clone AFS98), B220 (clone RA3-6B2), F4/80 (clone BM8), VCAM1 (clone 429), CD11 b (clone M1/70), CD45 (clone 30-F11), Ter119 (clone TER-119), CD71 (clone R17217) and CD44 (clone IM7), CD45.1 (clone A20), CD45.2 (clone 104), were from BioLegend or eBiosciences. DAPI-negative singlets were analyzed for all live samples unless otherwise specified. Stained sample suspensions were acquired on an LSR II (BD) and results were analyzed and visualized by FlowJo (Tree Star). For sorting, samples were processed under sterile conditions and sorted on a BD FACSAria.
[0131] Generation of MAEA monoclonal antibody (mAb). BALB/c mice were immunized with a KLH-conjugated MAEA peptide that is part of the extracellular domain (AAQKN IDRET SHVTM VVAEL EKTLS GCPA (SEQ ID NO:7)) and boosted with the same peptide and recombinant MAEA protein (Novus #NBP2-23208). Hybridomas producing mAbs to human MAEA were generated by standard techniques from splenocytes fused to Ag8.653 or NSO.sup.bcl2 myeloma cells..sup.19 Clone 92 (IgG2a) was firstly selected by ELISA screen as its mAbs recognized MAEA peptide/protein, but not human IgG. Subclone 92.25 was further selected and validated by FACS staining of wild type but not MAEA.sup.Csf1rCre mouse BM cells due to only one amino acid difference between the human and mouse sequence in the antibody target region. mAbs were then concentrated and purified from concentrated hybridoma supernatant by Am icon Ultra-15 100K filters (Millipore) and NAb Protein A/G Spin kits (Thermo Scientific).
[0132] Complete blood count. Mice were bled 25 l into an Eppendorf tube containing 2 l of 0.5 M EDTA (Life Technologies) using heparinized micro-hematocrit capillary tubes (Fisherbrand) under isoflurane anesthesia. Blood was diluted 1:20 in PBS and analyzed on an Advia counter (Siemens).
[0133] In vivo clearance of RBCs. Long-term RBC clearance was assayed as previously described..sup.20 Mice were given a single i.v. NHS sulfo-biotin (Thermo Scientific) injection (100 mg/kg), and the fraction of biotinylated RBCs was determined weekly from 1 l of blood. Short-term clearance was assayed by i.v. injection of 210.sup.8 CFSE-labelled wild-type RBCs and monitored at indicated time points.
[0134] Splenectomy. Mice were splenectomized under 100 mg/kg ketamine and 10 mg/kg xylazine anesthesia as previously described.sup.21 and allowed to recover for 4 weeks before experiments.
[0135] Bone marrow transplantation. All recipient mice were lethally irradiated (600+600 cGy, at least 3 h apart) in a Shepherd Mark 1 irradiator. RBC-lysed bone marrow nucleated cells (110.sup.6, unless otherwise indicated) were then injected retro-orbitally under isoflurane anesthesia.
[0136] Colony-forming assays. Spleen BFU-E was assayed by plating 510.sup.5 RBC-lysed splenocytes in MethoCult M3436 (Stem Cell Technologies) according to the manufacturer's instructions and colonies were enumerated on day 10 of culture.
[0137] In vivo treatment. For hemolytic anemia induction, mice were injected i.p. with 40 mg/kg body weight PHZ (Sigma #114715) on day 0 and 1 of the experiment. For 5-FU challenge, a single dose (250 mg/kg body weight) of freshly made 5-FU was given i.v. to each mouse under isoflurane anesthesia. Mx1-Cre was induced by three doses of Polyl:C (Invivogen) injections every other day at 5 mg/kg i.p. For antibody treatment, purified MAEA mAb and control IgG2a (BioXcell) were diluted in PBS and injected i.p. at 100 g daily for 3 weeks.
[0138] Cell culture. In vitro terminal differentiation and enucleation of sorted polychromatic erythroblasts (EB-III) was done as previously described..sup.22 Briefly, EB-III were FACS sorted and cultured at <10.sup.6/ml in differentiation media composed of IMDM, 10% FBS, 1% BSA, 30 ng/ml Epo (BioLegend), 0.2 mg/ml holo-transferrin (Sigma) and 10 g/ml insulin (ThermoFisher) for 48 hours. At the end of the culture, cells were FACS analyzed by Ter119 and H33342 staining. In vitro phagocytosis assay using bone marrow (BMDMs) or spleen (SPDMs) derived macrophages was slightly modified from previously described..sup.23 BMDMs or SPDMs were isolated by adherence from BM or splenic suspensions in macrophage media (RPMI1640 with 10% FBS, 10 mM HEPES and 10 ng/ml M-CSF) for 7 days..sup.24,25 On day 7, BMDMs, or SPDMs were harvested by gentle scraping and plated at 110.sup.5/well in 12-well plates for 24 hours in full macrophage media. The macrophages were then serum-starved for 2 hours before adding 1010.sup.6 CFSE-labeled RBCs or 410.sup.4 CD45.1 BM cells as target. After 2-3 hours co-incubation, non-adherent cells were washed and macrophages were scraped for FACS analysis.
[0139] Quantification and statistical analysis. In each experiment, each mouse was analyzed as a biological replicate. Data visualization (shown as means.e.m.) and statistical analysis were performed using Graphpad Prism 7. Unpaired Student's t-test was used to assess statistical significance when comparing two samples unless otherwise indicated.
Results
[0140] MAEA is required for adult BM macrophage development and EI niche formation. To examine MAEA function in adult erythropoiesis, mice were generated with a floxed allele of MAEA, which leads to a frame shift and non-sense mediated decay of MAEA mRNA upon Cre-mediated recombination. Flow cytometry analysis using a MAEA-specific polyclonal antibody revealed that in adult BM mononucleated cells (BMNCs), MAEA was highly expressed in the macrophages with minimal expression by monocytes, neutrophils or B cells (gated as previously described.sup.26). MAEA.sup.fl/fl mice were intercrossed with a Csf1r-Cre transgenic line.sup.16 to delete MAEA in the monocytic-macrophage lineage. Csf1r-Cre; MAEA.sup.fl/fl animals (henceforth MAEA.sup.Csf1r-Cre) were born healthy and fertile, and survived into adulthood at expected Mendelian ratios, by contrast to the perinatal lethality reported in MAEA-null mice..sup.14 Efficient MAEA-depletion on BM macrophages was confirmed by FACS analysis. The BM of MAEA.sup.Csf1r-Cre mice exhibited a slight, but significant, reduction in cellularity. Further analysis revealed that their BM macrophage numbers represented 30% of wild-type levels. MAEA.sup.Csf1r-Cre bones also appeared paler than controls, suggesting a reduced erythroid content in the marrow. Indeed, the number of BM erythroblasts was markedly reduced in MAEA.sup.Csf1r-Cre BM compared to littermate controls. This may be due to disruption of EI formation because there was a marked reduction in EIs (30% of control levels) formed in vivo in the MAEA.sup.Csf1r-Cre BM. Profiling of the erythroblast maturation status revealed a partial block of differentiation at the polychromatic (EB-III) stage..sup.27 These results support a critical role of MAEA in adult BM erythroblastic island formation and functions.
[0141] MAEA is dispensable for RBC enucleation. In contrast to the prior report on MAEA-null mice,.sup.14 peripheral blood anemia was not observed in young adult MAEA.sup.Csf1r-Cre mice. Although a role for MAEA in enucleation as also been suggested,.sup.14 blood smears and FACS analyses revealed elevated CD71.sup.+ Ter119.sup.+ reticulocyte counts in MAEA.sup.Csf1r-Cre animals but no nucleated RBCs in circulating blood. To investigate further this issue, polychromatic erythroblasts (EB-III) were sorted from BM of MAEA.sup.Csf1r-Cre and control mice and enucleation rates were evaluated in vitro. Cultured MAEA.sup.Csf1r-Cre-derived erythroblasts enucleated at similar rate as those of controls. These results suggest that MAEA expression is dispensable for postnatal RBC enucleation.
[0142] MAEA regulates RBC dynamics during stress erythropoiesis. Control and MAEA.sup.Csf1r-Cre mice were challenged with hemolytic anemia induced by the hemoglobin-oxidizing reagent phenylhydrazine (PHZ). There was a significant impairment of the reticulocytosis but not RBC or hematocrit recovery in MAEA.sup.Csf1r-Cre mice. Similarly, reticulocytosis in MAEA.sup.Csf1r-Cre mice after a single dose of cytotoxic agent 5-fluorouracil (5-FU) was significantly delayed while RBC and hematocrit showed an attenuated decline before a mild but significant delay in recovery. The attenuated early decline in hematocrit was consistent with previously described macrophage-depleted models,.sup.20 suggesting that MAEA depletion caused macrophage defects were contributing to both the RBC production and clearance. Indeed, the RBC lifespan was significantly prolonged in MAEA.sup.Csf1r-Cre animals. However, no phagocytosis defects in MAEA.sup.Csf1r-Cre macrophages were detected, suggesting the RBC clearance defect likely reflected the overall reduction of macrophage numbers.
[0143] Differential roles of MAEA in spleen and bone marrow macrophages. Interestingly, even though Csf1r-Cre induced similarly efficient MAEA deletion in splenic red pulp macrophages (RPMs), their numbers were not significantly altered. This suggests differential requirements of MAEA in BM and spleen macrophage development or maintenance. Spleen EB numbers were not significantly altered, although profiling of their maturation revealed a similar partial block at the polychromatic stage. However, compensatory stress erythropoiesis was found in the spleen of MAEA.sup.Csf1r-Cre mice as evidenced by splenomegaly and elevated burst-forming unit-erythroid (BFU-E) numbers.
[0144] To further dissect the requirement of MAEA in BM and spleen erythropoiesis, splenectomy was performed on MAEA.sup.Csf1r-Cre and littermate control mice. Splenectomized MAEA.sup.Csf1r-Cre animals developed anemia over the course of 4 weeks while the control group maintained healthy peripheral blood counts, suggesting that in the context of MAEA.sup.Csf1r-Cre animals, the extra-medullary erythropoiesis may mask the phenotype. The splenectomized control and MAEA.sup.Csf1r-Cre mice were challenged with PHZ. A severely impaired recovery response was observed in MAEA.sup.Csf1r-Cre mice. Blood smear again did not reveal any enucleation defect in the RBCs from splenectomized MAEA.sup.Csf1r-Cre mice before or after PHZ treatment. These results further confirmed that MAEA is critical for adult BM erythropoiesis but not RBC enucleation.
[0145] Dominant function of MAEA over VCAM1 in EI niche formation. VCAM1 represents another adhesion molecule implicated in EI..sup.8,9,20 To compare the role of VCAM1 with MAEA, VCAM1 was deleted using Csf1r-Cre. Interestingly, no defects were observed in BM macrophage or erythroblast numbers in steady state VCAM1.sup.Csf1r-Cre mice compared to the control animals, except for a minor trend towards reduced spleen erythroblasts. EB maturation as measured by CD44 expression and cell size also indicated a normal differentiation profile. The peripheral RBC compartment during steady state and after PHZ challenge was also normal, consistent with previous studies..sup.28,29 These data indicate that MAEA plays a dominant role in BM EI niche function while VCAM1 is dispensable for adult erythropoiesis in vivo.
[0146] Selective MAEA deletion in macrophages, but not erythroblasts, impairs bone marrow erythropoiesis. Csf1r-Cre broadly recombines in hematopoietic stem and progenitor cells (HSPCs), and thus may not discriminate between MAEA function in macrophages or erythroblasts that descent from HSPCs. To delete selectively MAEA in macrophages, MAEA.sup.fl/fl was crossed with CD169-Cre,.sup.17 which does not target the erythroid lineage. MAEA.sup.CD169-Cre mice phenotypically mimicked the MAEA.sup.Csf1r-Cre animals, with significant reduction of BM macrophage and erythroblast numbers, but no alterations in BM cellularity or circulating blood parameters. Further analyses revealed a similar defect in in vivo island formation and a partial block in BM EB maturation at the EB-III stage. Interestingly, while CD169-Cre also recombined efficiently in spleen RPMs, no significant change in RPM numbers was observed and EB numbers in the spleen of MAEA.sup.CD169-Cre mice were significantly increased suggesting ongoing extra-medullary erythropoiesis.
[0147] By contrast, when MAEA.sup.fl/fl was crossed with Epor-Cre, which recombines efficiently and selectively in erythroid progenitors,.sup.18 MAEA.sup.Epor-Cre animals showed significant reductions in circulating RBC counts with increased mean corpuscular volume (MCV), but no significant change in BM macrophage and erythroblast numbers or in vivo erythroblast island formation. In addition, MAEA.sup.Epor-Cre EB maturation showed a distinct profile with accumulation of the mature cells in the BM. No enucleation defect was observed in blood smear or in vitro EB-III culture. Analysis of the spleen did not reveal significant difference in macrophage or EB numbers of MAEAE.sup.Epor-Cre mice, despite efficient Epor-Cre recombination in spleen erythroid lineage. These results suggest that MAEA acts in the macrophage, but not erythroblast, to mediate EI formation in adult BM, consistent with the previous report in an in vitro EI reconstitution setting..sup.14 The result also further indicates that MAEA is dispensable for RBC enucleation but may play a cell autonomous function in RBC terminal maturation or egress in adult mice.
[0148] To investigate the role of macrophage or erythroblast conditional MAEA deletion in stress erythropoiesis, the two models were challenged with PHZ-induced anemia. Surprisingly, MAEA.sup.CD169-Cre mice showed no significant difference in hematocrit recovery or reticulocytosis. This may be due to the fact that CD169-Cre recombines at a lower frequency (60%) in BM macrophages, and/or Csf1r-Cre model is indeed a combinatory model of MAEA-deletion in both the macrophages and erythroblasts. Indeed, BM of MAEA.sup.CD169-Cre mice showed constantly milder reduction of macrophage and EB numbers than MAEA.sup.Csf1r-Cre mice at steady state and after PHZ. In contrast, MAEA.sup.Epor-Cre mice showed a faster decline in RBC content during the early days and a weaker reticulocyte output during the later recovery stages. The reduction of RBCs and reticulocytes but normal BM EB numbers after PHZ in MAEA.sup.Epor-Cre mice also further suggests that EB MAEA expression may contribute cell autonomously to RBC terminal maturation or egress, but not in EI formation.
[0149] Postnatal MAEA deletion or inhibition uncovers important functions in adult erythropoissis. To evaluate the role of MAEA in postnatal erythropoiesis and the maintenance of the EI niche, MAEA was deleted using the Mx1-Cre line (MAEA.sup.Mx1-Cre) in which Cre-mediated recombination is inducible by Poly I:C injections. Radiation chimeras were generated by transplantation of the BM from MAEA.sup.Mx1-Cre or littermate controls into wild-type mice to exclude potential complications from the BM microenvironment. Two months after transplantation, Cre recombination were induced by three Poly I:C injections. Three weeks after the first Poly I:C injection, BM macrophage and erythroblast numbers were significantly reduced in MAEA.sup.Mx1-Cre animals, indicating that MAEA is required cell-autonomously for the maintenance of BM macrophages and the EI niche during homeostasis.
[0150] To investigate further the role of MAEA in erythropoiesis, a novel monoclonal antibody was developed by immunization of Balb/c mice with a peptide corresponding to the extracellular domain of human MAEA. Clone 92.25 (IgG2a) was isolated, which interacts specifically with both murine and human MAEA, owing to the highly conserved MAEA amino acid sequence across species (
Discussion
[0151] The critical function of EI niche in erythropoiesis was initially suggested based on in vitro data.sup.6,7 and recently confirmed in vivo..sup.20,30 However, in vivo studies using macrophage depletion cannot distinguish between the EI-dependent and EI-independent functions of the macrophage..sup.20,30 Several adhesion mechanisms have been proposed to mediate EI formation, providing an ideal model for investigations of EI-specific functions..sup.7,8,10-12 However, studies thus far have been largely based on in vitro EI formation assays or germline gene-deletions. Here it is shown that MAEA is critical for adult BM EI formation and homeostatic erythropoiesis via multiple mechanisms. Both constitutive and induced MAEA deletion result in severe reductions of BM macrophage numbers, indicating that MAEA is required for BM macrophage homeostasis. Interestingly, spleen macrophages are not affected by MAEA deletion, in line with recent reports indicating the independence and heterogeneity of tissue resident macrophages under steady state..sup.31-33 Yet, RBC clearance is delayed in MAEA.sup.Csf1r-Cre mice, suggesting a role of macrophages in the BM or other organs that might be affected by MAEA-deletion in RBC clearance. Additionally, antibody inhibition disrupted EI formation in vivo and in vitro confirmed that MAEA also directly mediates the adhesion of erythroblasts to macrophages to form EI..sup.13,14 BM EB number and maturation profile is significantly impaired even when macrophage numbers are not affected (such as after anti-MAEA antibody inhibition), suggesting EI-specific functions of the macrophage in supporting EB differentiation. The macrophage and erythroid lineage-selective MAEA deletion provides genetic evidence that MAEA-mediated adhesion is unlikely the result of a homophilic interaction.
[0152] MAEA appears dispensable for the enucleation of adult erythroblasts. The enucleation process of end-stage erythroid maturation is thought to be coordinated by the sorting and reassembly of nuclear, cytoplasmic and membrane contents among the resulting reticulocytes and pyrenocytes..sup.22,34,35 Previous studies have suggested that MAEA is associated with actin filaments, preferentially segregating into the extruding pyrenocytes and is required for EB enucleation..sup.14,35,36 However, none of the present genetic deletion models have revealed any enucleation defect in vivo or in vitro, under steady state or after stress. One possibility is that the erythroid progenitors in previously reported MAEA null embryos are so poorly differentiated due to defects upstream of the EI that they are not able to reach the enucleation stage..sup.14,36 Alternatively, the residual expression of MAEA in the present conditional knockout models may be masking the phenotype observed in the null embryos. It is also tempting to speculate that the enucleation process of fetal erythrocytes may be different from their adult counterpart, in parallel with their many other differences, such as the globin compositions..sup.37,38
[0153] Results provided herein provide genetic evidence that the contribution of MAEA in BM EI is dominant compared to that of VCAM1, which when deleted using the same Csf1r-Cre, is dispensable for macrophage development, in vivo EI function and erythroid recovery. Although VCAM1-mediated EI formation has commonly been observed in vitro,.sup.8,39,40 its requirement during in vivo erythropoiesis using genetic models has not been described..sup.28,29 Studies using antibody inhibition in whole animals have suggested a contribution of VCAM1 in erythropoiesis,.sup.20 although VCAM1 expression and function outside of the EI, e.g., in endothelial cells.sup.41 or the hematopoietic stem and progenitor cell niche,.sup.42-44 cannot be excluded. Since EI mediates erythropoiesis in health and disease,.sup.20,30 the present study indicates that MAEA is a promising therapeutic target for erythropoietic disorders.
Example 6
MAEA is an E3 Ubiquitin Ligase Promoting Autophagy and Self-Renewal of Hematopoietic Stem Cells
[0154] Macrophage-Erythroblast Attacher (MAEA, also known as EMP) was originally identified as an adhesion molecule required for erythroblastic island formation..sup.7 Germline deletion of MAEA led to severe anemia and perinatal mortality..sup.97 Sequence analysis indicates that MAEA is a highly conserved RING finger domain-containing E3 ubiquitin ligase..sup.98,99 MAEA's functions, however, remain obscure. As shown by results provided herein, MAEA is highly expressed in hematopoietic stem cells (HSCs) where it is required for their maintenance by restricting cytokine receptor signaling and promoting autophagy. Constitutive MAEA deletion produces severe defects in HSC repopulation capacity, B- and T-lymphoid differentiation, and premature death of animals from a myeloproliferative syndrome. Postnatal MAEA deletion leads to transient HSC expansion followed by their depletion. Mechanistically, Applicants found that the surface expression of several hematopoietic cytokine receptors (e.g., MPL, FLT3) is stabilized in absence of MAEA, thereby prolonging their intracellular signaling. Additionally, the autophagy flux in HSCs, but not in mature hematopoietic cells, is markedly impaired. Administration of autophagy-inducing compounds rescued the functional defects of MAEA-deficient HSCs. Further, MAEA is upregulated in various cancers and associated with poor survival of acute myelogenous leukemia (AML), and MLL-AF9-driven AML does not develop in the absence of MAEA. These findings thus identify MAEA as an anti-cancer target and novel E3 ubiquitin ligase, regulating autophagy, and guarding HSC maintenance.
[0155] A conditional MAEA gene deletion recently revealed that MAEA expression on macrophages, but not erythroblasts, was required for postnatal EI formation..sup.100 Of note, MAEA was also expressed at high levels on HSCs, and efficiently deleted using Csf1r-Cre.sup.101 (
[0156] To evaluate further MAEA's function in HSCs, their ability to competitively repopulate the BM of lethally irradiated recipients was examined. Surprisingly, despite a higher frequency of phenotypic HSCs, Applicants observed a marked reduction in long-term repopulation of peripheral blood across all lineages from MAEACsf1r-Cre donor cells compared to MAEA.sup.fl/fl and MAEA.sup.fl/+; Csf1r-Cre.sup.+ control littermates (
[0157] To confirm these results, HSC function was evaluated after MAEA deletion using the conditional Mx1-Cre line and poly I:C administration (
[0158] To ascertain the HSC-intrinsic requirement of MAEA, chimeric mice were generated by transplantation of an equal mixture of wild-type (CD45.1) and MAEA.sup.Mx1-Cre (CD45.2) BM cells into lethally irradiated wild type (CD45.1) recipients and induced MAEA-deletion after stable reconstitution (
[0159] Next, the transcriptome of sorted MAEA.sup.Csf1r-Cre and littermate control HSCs was analyzed to gain mechanistic insight on how MAEA regulated HSC function. Gene Set Enrichment Analysis (GSEA) revealed a striking up-regulation of gene sets involved in cell activation or proliferation in MAEA.sup.Csf1r-Cre HSCs, such as DNA replication, protein synthesis/processing and oxidative phosphorylation, but downregulation of several major cell growth-related pathways, including insulin and mTOR signaling
[0160] Based on these analyses, the functional significance of these enriched pathways were analyzed by treating poly I:C-induced MAEA.sup.Mx1-Cre mice with either a proteasome inhibitor (Carfilzomib, CFZ), an inhibitor of oxidative stress (N-acetylcysteine, NAC), or a mTOR antagonist (rapamycin). Remarkably, while none of the inhibitors significantly altered BM cellularity, rapamycin, but not CFZ or NAC, rescued the HSC numbers after MAEA-deletion (
[0161] Next, experiments were performed to identify how MAEA could interfere with mTOR/intracellular signaling. Although previous studies have suggested that MAEA might be expressed in the nucleus and/or associated with the actin filaments,.sup.97,103,104 immunofluorescence analysis of permeabilized HSCs detected MAEA expression only at the cell surface in localized foci (
[0162] As mTOR inhibitors rescued MAEA-deficient HSCs, experiments were designed to determine if the altered protein ubiquitination may lead to dysregulation of the downstream lysosome-dependent degradation pathways (e.g., autophagy). Autophagy (macroautophagy), a highly conserved mechanism to recycle macromolecules and organelles via lysosomal degradation, was suggested to be critical for HSC quiescence and maintenance..sup.106-109 Indeed, mTOR signaling and activated Akt are reported to inhibit autophagy, and rapamycin is a potent inducer of autophagy..sup.110,111 Applicants observed no significant change in the expression of the core autophagy machinery or pro-autophagy genes in MAEA-deficient and sufficient HSCs (
[0163] Next, the human cancer genome atlas (TCGA) database was analyzed to assess MAEA's function in cancer. These analyses revealed a significant association of MAEA amplification mutations in many human cancer types (
[0164] Autophagy has been increasingly recognized to be critical for HSC quiescence and maintenance by controlling mitochondria homeostasis, metabolic and oxidative stress..sup.109,117 However, there is little available information on the molecular mechanisms that ensure high levels of autophagy activity in HSCs relative to their downstream progeny..sup.106 Ubiquitination of cellular proteins fine-tunes their expression levels, cellular localization and interaction dynamics, thereby influencing many cellular processes..sup.118 Components of the ubiquitin proteasome system, mostly E3 ligases, have been suggested to regulate HSC fate by targeting critical signal transducers and transcription regulators..sup.119 Ubiquitination also plays important roles in autophagy regulation in other cell systems by influencing the stability and interaction of the autophagy core machinery and selective cargo recognition,.sup.120,121 among others. MAEA thus acts as an E3 ubiquitin ligase that guards HSC quiescence by restricting cytokine receptor stability and signaling while ensuring high autophagy flux in HSCs.
Example 7
Anti-MAEA Antibody Therapy Benefits Jak2.SUP.V617F.-Induced Polycythemia Vera (PV)
[0165] In this Example, anti-MAEA monoclonal antibody (92.25) or IgG isotype control were injected at 100 g daily i.p. into control (Ctrl) and Jak2.sup.V617F/V617F (R/R) mice for one week before analysis. Critical blood count (CBC) was then analyzed and demonstrates that 92.25 injections lowered the reticulocytes, red blood cell counts (RBC), and hemoglobin levels (HGB) in the peripheral blood of Jak2.sup.R/R mice without affecting the control mice (
[0166] This is consistent with data presented in Example 5, demonstrating that MAEA is only required in BM macrophages for EB island function, but not in the spleen. As discussed in greater detail above in Example 5, VCAM1 is not required in the BM, however, it may be playing a role in the spleen. Accordingly, a combination therapy may be beneficial to subjects suffering from Jak2.sup.V617F-induced PV.
[0167] Throughout this application various publications are referred to in superscripts. Full citations for these references may be found at the end of the specification before the claims. The disclosures of these publications are hereby incorporated by reference in their entireties into the subject application to more fully describe the art to which the subject application pertains.
[0168] From the foregoing, it will be appreciated that specific embodiments of the invention have been described herein for purposes of illustration, but that various modifications may be made without deviating from the scope of the invention. Accordingly, the invention is not limited except as by the appended claims.
REFERENCES
[0169] 1 Bessis, M. [Erythroblastic island, functional unity of bone marrow]. Rev Hematol 13, 8-11 (1958). [0170] 2 Hom, J., Dulmovits, B. M., Mohandas, N. & Blanc, L. The erythroblastic island as an emerging paradigm in the anemia of inflammation. Immunol Res 63, 75-89, doi:10.1007/s12026-015-8697-2 (2015). [0171] 3 Jacobsen, R. N., Perkins, A. C. & Levesque, J. P. Macrophages and regulation of erythropoiesis. Curr Opin Hematol 22, 212-219, doi:10.1097/MOH.0000000000000131 (2015). [0172] 4 de Back, D. Z., Kostova, E. B., van Kraaij, M., van den Berg, T. K. & van Bruggen, R. Of macrophages and red blood cells; a complex love story. Front Physiol 5, 9, doi:10.3389/fphys.2014.00009 (2014). [0173] 5 Klei, T. R., Meinderts, S. M., van den Berg, T. K. & van Bruggen, R. From the Cradle to the Grave: The Role of Macrophages in Erythropoiesis and Erythrophagocytosis. Front Immunol 8, 73, doi:10.3389/fimmu.2017.00073 (2017). [0174] 6 Rhodes, M. M., Kopsombut, P., Bondurant, M. C., Price, J. O. & Koury, M. J. Adherence to macrophages in erythroblastic islands enhances erythroblast proliferation and increases erythrocyte production by a different mechanism than erythropoietin. Blood 111, 1700-1708, doi:10.1182/blood-2007-06-098178 (2008). [0175] 7 Hanspal, M. & Hanspal, J. S. The association of erythroblasts with macrophages promotes erythroid proliferation and maturation: a 30-kD heparin-binding protein is involved in this contact. Blood 84, 3494-3504 (1994). [0176] 8 Sadahira, Y., Yoshino, T. & Monobe, Y. Very late activation antigen 4-vascular cell adhesion molecule 1 interaction is involved in the formation of erythroblastic islands. J Exp Med 181, 411-415 (1995). [0177] 9 Hamamura, K. et al. A critical role of VLA-4 in erythropoiesis in vivo. Blood 87, 2513-2517 (1996). [0178] 10 Lee, G. et al. Targeted gene deletion demonstrates that the cell adhesion molecule ICAM-4 is critical for erythroblastic island formation. Blood 108, 2064-2071, doi:10.1182/blood-2006-03-006759 (2006). [0179] 11 Fabriek, B. O. et al. The macrophage CD163 surface glycoprotein is an erythroblast adhesion receptor. Blood 109, 5223-5229, doi:10.1182/blood-2006-08-036467 (2007). [0180] 12 Liu, X. S. et al. Disruption of palladin leads to defects in definitive erythropoiesis by interfering with erythroblastic island formation in mouse fetal liver. Blood 110, 870-876, doi:10.1182/blood-2007-01-068528 (2007). [0181] 13 Hanspal, M., Smockova, Y. & Uong, Q. Molecular identification and functional characterization of a novel protein that mediates the attachment of erythroblasts to macrophages. Blood 92, 2940-2950 (1998). [0182] 14 Soni, S. et al. Absence of erythroblast macrophage protein (Emp) leads to failure of erythroblast nuclear extrusion. J Biol Chem 281, 20181-20189, doi:10.1074/jbc.M603226200 (2006). [0183] 15 Koni, P. A. et al. Conditional vascular cell adhesion molecule 1 deletion in mice: impaired lymphocyte migration to bone marrow. J Exp Med 193, 741-754 (2001). [0184] 16 Qian, B. Z. et al. CCL2 recruits inflammatory monocytes to facilitate breast-tumour metastasis. Nature 475, 222-225, doi:10.1038/nature10138 (2011). [0185] 17 Karasawa, K. et al. Vascular-resident CD169-positive monocytes and macrophages control neutrophil accumulation in the kidney with ischemia-reperfusion injury. J Am Soc Nephrol 26, 896-906, doi:10.1681/ASN.2014020195 (2015). [0186] 18 Heinrich, A. C., Pelanda, R. & Klingmuller, U. A mouse model for visualization and conditional mutations in the erythroid lineage. Blood 104, 659-666, doi:10.1182/blood-2003-05-1442 (2004). [0187] 19 Sroubek, J. et al. The use of Bcl-2 over-expression to stabilize hybridomas specific to the HERG potassium channel. J Immunol Methods 375, 215-222, doi:10.1016/j.jim.2011.10.014 (2012). [0188] 20 Chow, A. et al. CD169(+) macrophages provide a niche promoting erythropoiesis under homeostasis and stress. Nat Med 19, 429-436, doi:10.1038/nm.3057 (2013). [0189] 21 Reeves, J. P., Reeves, P. A. & Chin, L. T. Survival surgery: removal of the spleen or thymus. Curr Protoc Immunol Chapter 1, Unit 1 10, doi:10.1002/0471142735.im0110s02 (2001). [0190] 22 Ji, P., Yeh, V., Ramirez, T., Murata-Hori, M. & Lodish, H. F. Histone deacetylase 2 is required for chromatin condensation and subsequent enucleation of cultured mouse fetal erythroblasts. Haematologica 95, 2013-2021, doi:10.3324/haematol.2010.029827 (2010). [0191] 23 Majeti, R. et al. CD47 is an adverse prognostic factor and therapeutic antibody target on human acute myeloid leukemia stem cells. Cell 138, 286-299, doi:10.1016/j.cell.2009.05.045 (2009). [0192] 24 Zhang, X., Goncalves, R. & Mosser, D. M. The isolation and characterization of murine macrophages. Curr Protoc Immunol Chapter 14, Unit 14 11, doi:10.1002/0471142735.im1401s83 (2008). [0193] 25 Davies, J. Q. & Gordon, S. Isolation and culture of murine macrophages. Methods Mol Biol 290, 91-103 (2005). [0194] 26 Chow, A. et al. Bone marrow CD169+ macrophages promote the retention of hematopoietic stem and progenitor cells in the mesenchymal stem cell niche. J Exp Med 208, 261-271, doi:10.1084/jem.20101688 (2011). [0195] 27 Chen, K. et al. Resolving the distinct stages in erythroid differentiation based on dynamic changes in membrane protein expression during erythropoiesis. Proc Natl Acad Sci USA 106, 17413-17418, doi:10.1073/pnas.0909296106 (2009). [0196] 28 Ulyanova, T., Phelps, S. R. & Papayannopoulou, T. The macrophage contribution to stress erythropoiesis: when less is enough. Blood 128, 1756-1765, doi:10.1182/blood-2016-05-714527 (2016). [0197] 29 Ulyanova, T., Jiang, Y., Padilla, S., Nakamoto, B. & Papayannopoulou, T. Combinatorial and distinct roles of alpha(5) and alpha(4) integrins in stress erythropoiesis in mice. Blood 117, 975-985, doi:10.1182/blood-2010-05-283218 (2011). [0198] 30 Ramos, P. et al. Macrophages support pathological erythropoiesis in polycythemia vera and beta-thalassemia. Nat Med 19, 437-445, doi:10.1038/nm.3126 (2013). [0199] 31 Hashimoto, D. et al. Tissue-resident macrophages self-maintain locally throughout adult life with minimal contribution from circulating monocytes. Immunity 38, 792-804, doi:10.1016/j.immuni.2013.04.004 (2013). [0200] 32 Ginhoux, F. & Guilliams, M. Tissue-Resident Macrophage Ontogeny and Homeostasis. Immunity 44, 439-449, doi:10.1016/j.immuni.2016.02.024 (2016). [0201] 33 Hoeffel, G. & Ginhoux, F. Fetal monocytes and the origins of tissue-resident macrophages. Cell Immunol 330, 5-15, doi:10.1016/j.cellimm.2018.01.001 (2018). [0202] 34 Konstantinidis, D. G. et al. Signaling and cytoskeletal requirements in erythroblast enucleation. Blood 119, 6118-6127, doi:10.1182/blood-2011-09-379263 (2012). [0203] 35 Lee, J. C. et al. Mechanism of protein sorting during erythroblast enucleation: role of cytoskeletal connectivity. Blood 103, 1912-1919, doi:10.1182/blood-2003-03-0928 (2004). [0204] 36 Soni, S., Bala, S. & Hanspal, M. Requirement for erythroblast-macrophage protein (Emp) in definitive erythropoiesis. Blood Cells Mol Dis 41, 141-147, doi:10.1016/j.bcmd.2008.03.008 (2008). [0205] 37 Dame, C. & Juul, S. E. The switch from fetal to adult erythropoiesis. Clin Perinatol 27, 507-526 (2000). [0206] 38 Dzierzak, E. & Philipsen, S. Erythropoiesis: development and differentiation. Cold Spring Harb Perspect Med 3, a011601, doi:10.1101/cshperspect.a011601 (2013). [0207] 39 Yanai, N., Sekine, C., Yagita, H. & Obinata, M. Roles for integrin very late activation antigen-4 in stroma-dependent erythropoiesis. Blood 83, 2844-2850 (1994). [0208] 40 Toda, S., Segawa, K. & Nagata, S. MerTK-mediated engulfment of pyrenocytes by central macrophages in erythroblastic islands. Blood 123, 3963-3971, doi:10.1182/blood-2014-01-547976 (2014). [0209] 41 Yamashita, T. et al. The microenvironment for erythropoiesis is regulated by HIF-2alpha through VCAM-1 in endothelial cells. Blood 112, 1482-1492, doi:10.1182/blood-2007-11-122648 (2008). [0210] 42 Sturgeon, C. M. et al. Primitive erythropoiesis is regulated by miR-126 via nonhematopoietic Vcam-1+ cells. Dev Cell 23, 45-57, doi:10.1016/j.devcel.2012.05.021 (2012). [0211] 43 Dutta, P. et al. Macrophages retain hematopoietic stem cells in the spleen via VCAM-1. J Exp Med 212, 497-512, doi:10.1084/jem.20141642 (2015). [0212] 44 Frenette, P. S., Subbarao, S., Mazo, I. B., von Andrian, U. H. & Wagner, D. D. Endothelial selectins and vascular cell adhesion molecule-1 promote hematopoietic progenitor homing to bone marrow. Proc Natl Acad Sci USA 95, 14423-14428 (1998). [0213] 45 Klijn C., et al. A comprehensive transcriptional portrait of human cancer cell lines. Nat Biotechnol. 2015 March; 33(3):306-12, Epub 2014 Dec. 8. [0214] 46 Piel F B, Steinberg M H, and Rees D C. Sickle Cell Disease. N Engl J Med. 2017; 376(16):1561-73. [0215] 47 Ware R E, et al. Sickle cell disease. Lancet. 2017; 390(10091):311-23. [0216] 48 Sundd P, et al. Pathophysiology of Sickle Cell Disease. Annu Rev Pathol. 2019; 14:263-92. [0217] 49 Zhang D, et al. Neutrophils, platelets, and inflammatory pathways at the nexus of sickle cell disease pathophysiology. Blood. 2016; 127(7):801-9. [0218] 50 Turhan A, et al. Primary role for adherent leukocytes in sickle cell vascular occlusion: a new paradigm. Proc Natl Acad Sci USA. 2002; 99(5):3047-51. [0219] 51 Chiang E Y, et al. Imaging receptor microdomains on leukocyte subsets in live mice. Nat Methods. 2007; 4(3):219-22. [0220] 52 Hidalgo A, et al. Heterotypic interactions enabled by polarized neutrophil microdomains mediate thromboinflammatory injury. Nat Med. 2009; 15(4):384-91. [0221] 53 Baxter E J, et al. Acquired mutation of the tyrosine kinase JAK2 in human myeloproliferative disorders. Lancet 365, 1054-1061 (2005). [0222] 54 James C, et al. A unique clonal JAK2 mutation leading to constitutive signaling causes polycythaemia vera. Nature 434, 1144-1148 (2005). [0223] 55 Kralovics R. et al. A gain-of-function mutation of JAK2 in myeloproliferative disorders. N. Engl. J. Med. 352, 1779-1790 (2005). [0224] 56 Levine R L et al. Activating mutation in the tyrosine kinase JAK2 in polycythemia vera, essential thrombocythemia, and myeloid metaplasia with myelofibrosis. Cancer Cell 7, 387-397 (2005). [0225] 57 Miyake, K. et al. A VCAM-like adhesion molecule on murine bone marrow stromal cells mediates binding of lymphocyte precursors in culture. J Cell Biol 114, 557-565 (1991). [0226] 58 Simmons, P. J. et al. Vascular cell adhesion molecule-1 expressed by bone marrow stromal cells mediates the binding of hematopoietic progenitor cells. Blood 80, 388-395 (1992). [0227] 59 Ulyanova, T. et al. VCAM-1 expression in adult hematopoietic and nonhematopoietic cells is controlled by tissue-inductive signals and reflects their developmental origin. Blood 106, 86-94 (2005). [0228] 60 Pinho, S. & Frenette, P. S. Haematopoietic stem cell activity and interactions with the niche. Nat Rev Mol Cell Biol 20, 303-320, doi:10.1038/s41580-019-0103-9 (2019). [0229] 61 Gurtner, G. C. et al. Targeted disruption of the murine VCAM1 gene: essential role of VCAM-1 in chorioallantoic fusion and placentation. Genes & development 9, 1-14 (1995). [0230] 62 Frenette, P. S., et al. Endothelial selectins and vascular cell adhesion molecule-1 promote hematopoietic progenitor homing to bone marrow. Proceedings of the National Academy of Sciences of the United States of America 95, 14423-14428 (1998). [0231] 63 Papayannopoulou, T., et al. The VLA4/VCAM-1 adhesion pathway defines contrasting mechanisms of lodgement of transplanted murine hemopoietic progenitors between bone marrow and spleen. Proceedings of the National Academy of Sciences of the United States of America 92, 9647-9651 (1995). [0232] 64 Craddock, C. F., et al. Antibodies to VLA4 integrin mobilize long-term repopulating cells and augment cytokine-induced mobilization in primates and mice. Blood 90, 4779-4788 (1997). [0233] 65 Papayannopoulou, T., Priestley, G. V. & Nakamoto, B. Anti-VLA4/VCAM-1-induced mobilization requires cooperative signaling through the kit/mkit ligand pathway. Blood 91, 2231-2239 (1998). [0234] 66 Koni, P. A. et al. Conditional vascular cell adhesion molecule 1 deletion in mice: impaired lymphocyte migration to bone marrow. The Journal of experimental medicine 193, 741-754 (2001). [0235] 67 Deng, L. et al. A novel mouse model of inflammatory bowel disease links mammalian target of rapamycin-dependent hyperproliferation of colonic epithelium to inflammation associated tumorigenesis. Am J Pathol 176, 952-967, doi:10.2353/ajpath.2010.090622 (2010). [0236] 68 Wei, Q. et al. MAEA expressed by macrophages, but not erythroblasts, maintains postnatal murine bone marrow erythroblastic islands. Blood 133, 1222-1232, doi:10.1182/blood-2018-11-888180 (2019). [0237] 69 Miyamoto, T. et al. Myeloid or lymphoid promiscuity as a critical step in hematopoietic lineage commitment. Dev Cell 3, 137-147 (2002). [0238] 70 Sarrazin, S. et al. MafB restricts M-CSF-dependent myeloid commitment divisions of hematopoietic stem cells. Cell 138, 300-313, doi:10.1016/j.cell.2009.04.057 (2009). [0239] 71 Dutta, P. et al. Macrophages retain hematopoietic stem cells in the spleen via VCAM-1. The Journal of experimental medicine 212, 497-512, doi:10.1084/jem.20141642 (2015). [0240] 72 Austin, R., et al. Harnessing the immune system in acute myeloid leukaemia. Crit Rev Oncol Hematol 103, 62-77, doi:10.1016/j.critrevonc.2016.04.020 (2016). [0241] 73 Imai, Y et al. Essential roles of VLA-4 in the hematopoietic system. Int J Hematol 91, 569-575, doi:10.1007/s12185-010-0555-3 (2010). [0242] 74 Kubagawa, H. et al. Biochemical nature and cellular distribution of the paired immunoglobulin-like receptors, PIR-A and PIR-B. The Journal of experimental medicine 189, 309-318 (1999). [0243] 75 Takai, T. Paired immunoglobulin-like receptors and their MHC class I recognition. Immunology 115, 433-440, doi:10.1111/j.1365-2567.2005.02177.x (2005). [0244] 76 Ujike, A. et al. Impaired dendritic cell maturation and increased T(H)2 responses in PIR472 B(/) mice. Nature immunology 3, 542-548, doi:10.1038/ni801 (2002). [0245] 77 Ding, Y. B. et al. Association of VCAM-1 overexpression with oncogenesis, tumor angiogenesis and metastasis of gastric carcinoma. World J Gastroenterol 9, 1409-1414 (2003). [0246] 78 Lin, K. Y. et al. Ectopic expression of vascular cell adhesion molecule-1 as a new mechanism for tumor immune evasion. Cancer Res 67, 1832-1841, doi: 10.1158/0008-5472. CAN-06-3014 (2007). [0247] 79 Huang, J. et al. Exome sequencing of hepatitis B virus-associated hepatocellular carcinoma. Nat Genet 44, 1117-1121, doi:10.1038/ng.2391 (2012). [0248] 80 Yuan, W. et al. Commonly dysregulated genes in murine APL cells. Blood 109, 961-970, doi:10.1182/blood-2006-07-036640 (2007). [0249] 81 Chen, Q., Zhang, X. H. & Massague, J. Macrophage binding to receptor VCAM-1 transmits survival signals in breast cancer cells that invade the lungs. Cancer Cell 20, 538-549, doi:10.1016/j.ccr.2011.08.025 (2011). [0250] 82 Lu, X. et al. VCAM-1 promotes osteolytic expansion of indolent bone micrometastasis of breast cancer by engaging alpha4beta1-positive osteoclast progenitors. Cancer Cell 20, 701-714, doi:10.1016/j.ccr.2011.11.002 (2011). [0251] 83 Damiano, et al. Cell adhesion mediated drug resistance (CAM-DR): role of integrins and resistance to apoptosis in human myeloma cell lines. Blood 93, 1658-1667 (1999). [0252] 84 Jacamo, R. et al. Reciprocal leukemia-stroma VCAM-1/VLA-4-dependent activation of NF-kappaB mediates chemoresistance. Blood 123, 2691-2702, doi:10.1182/blood-2013-06-511527 (2014). [0253] 85 Matsunaga, T. et al. Interaction between leukemic-cell VLA-4 and stromal fibronectin is a decisive factor for minimal residual disease of acute myelogenous leukemia. Nature medicine 9, 1158-1165, doi:10.1038/nm909 (2003). [0254] 86 Carlson, P. et al. Targeting the perivascular niche sensitizes disseminated tumour cells to chemotherapy. Nat Cell Biol 21, 238-250, doi:10.1038/s41556-018-0267-0 (2019). [0255] 87 Krivtsov, A. V. et al. Transformation from committed progenitor to leukaemia stem cell initiated by MLL-AF9. Nature 442, 818-822, doi:10.1038/nature04980 (2006). [0256] 88 Jaiswal, S. et al. CD47 is upregulated on circulating hematopoietic stem cells and leukemia cells to avoid phagocytosis. Cell 138, 271-285, doi:10.1016/j.cell.2009.05.046 (2009). [0257] 89 Majeti, R. et al. CD47 is an adverse prognostic factor and therapeutic antibody target on human acute myeloid leukemia stem cells. Cell 138, 286-299, doi:10.1016/j.cell.2009.05.045 (2009). [0258] 90 Barkal, A. A. et al. Engagement of MHC class I by the inhibitory receptor LILRB1 suppresses macrophages and is a target of cancer immunotherapy. Nature immunology 19, 76-84, doi:10.1038/s41590-017-0004-z (2018). [0259] 91 Barreyro, L. et al. Overexpression of IL-1 receptor accessory protein in stem and progenitor cells and outcome correlation in AML and MDS. Blood 120, 1290-1298, doi:10.1182/blood-2012-01-404699 (2012). [0260] 92 Schinke, C. et al. IL8-CXCR2 pathway inhibition as a therapeutic strategy against MDS and AML stem cells. Blood 125, 3144-3152, doi:10.1182/blood-2015-01-621631 (2015). [0261] 93 Havel, J. J., Chowell, D. & Chan, T. A. The evolving landscape of biomarkers for checkpoint inhibitor immunotherapy. Nat Rev Cancer 19, 133-150, doi:10.1038/s41568-019-0116-x (2019). [0262] 94 Woo, S. R., Corrales, L. & Gajewski, T. F. Innate immune recognition of cancer. Annual review of immunology 33, 445-474, doi:10.1146/annurev-immunol-032414-112043 (2015). [0263] 95 An, N. & Kang, Y. Using quantitative real-time PCR to determine donor cell engraftment in a competitive murine bone marrow transplantation model. J Vis Exp, e50193, doi:10.3791/50193 (2013). [0264] 96 Pinho, S. et al. Lineage-Biased Hematopoietic Stem Cells Are Regulated by Distinct Niches. Dev Cell 44, 634-641 e634, doi:10.1016/j.devcel.2018.01.016 (2018). [0265] 97 1 Hanspal, M. & Hanspal, J. S. The association of erythroblasts with macrophages promotes erythroid proliferation and maturation: a 30-kD heparin-binding protein is involved in this contact. Blood 84, 3494-3504 (1994). [0266] 98 Soni, S. et al. Absence of erythroblast macrophage protein (Emp) leads to failure of erythroblast nuclear extrusion. J Biol Chem 281, 20181-20189, doi: 10.1074/jbc.M603226200 (2006). [0267] 99 Francis, O., Han, F. & Adams, J. C. Molecular phylogeny of a RING E3 ubiquitin ligase, conserved in eukaryotic cells and dominated by homologous components, the muskelin/RanBPM/CTLH complex. PLoS One 8, e75217, doi: 10.1371/journal.pone.0075217 (2013). [0268] 100 Lampert, F. et al. The multi-subunit GID/CTLH E3 ubiquitin ligase promotes cell proliferation and targets the transcription factor Hbp1 for degradation. Elife 7, doi:10.7554/eLife.35528 (2018). [0269] 101 Wei, Q. et al. MAEA expressed by macrophages, but not erythroblasts, maintains postnatal murine bone marrow erythroblastic islands. Blood 133, 1222-1232, doi:10.1182/blood-2018-11-888180 (2019). [0270] 102 Qian, B. Z. et al. CCL2 recruits inflammatory monocytes to facilitate breast-tumour metastasis. Nature 475, 222-225, doi:10.1038/nature10138 (2011). [0271] 103 Rossi, D. J. et al. Cell intrinsic alterations underlie hematopoietic stem cell aging. Proc Natl Acad Sci USA 102, 9194-9199, doi:10.1073/pnas.0503280102 (2005). [0272] 104 Lee, J. C. et al. Mechanism of protein sorting during erythroblast enucleation: role of cytoskeletal connectivity. Blood 103, 1912-1919, doi:10.1182/blood-2003-03-0928 (2004). [0273] 105 Bala, S. et al. Emp is a component of the nuclear matrix of mammalian cells and undergoes dynamic rearrangements during cell division. Biochem Biophys Res Commun 342, 1040-1048, doi:10.1016/j.bbrc.2006.02.060 (2006). [0274] 106 Kirkin, V., et al. A role for ubiquitin in selective autophagy. Mol Cell 34, 259-269, doi:10.1016/j.molcel.2009.04.026 (2009). [0275] 107 Warr, M. R. et al. FOXO3A directs a protective autophagy program in haematopoietic stem cells. Nature 494, 323-327, doi:10.1038/nature11895 (2013). [0276] 108 Mortensen, M. et al. The autophagy protein Atg7 is essential for hematopoietic stem cell maintenance. J Exp Med 208, 455-467, doi:10.1084/jem.20101145 (2011). [0277] 109 Liu, F. et al. FIP200 is required for the cell-autonomous maintenance of fetal hematopoietic stem cells. Blood 116, 4806-4814, doi:10.1182/blood-2010-06-288589 (2010). [0278] 110 Riffelmacher, T. & Simon, A. K. Mechanistic roles of autophagy in hematopoietic differentiation. FEBS J 284, 1008-1020, doi:10.1111/febs.13962 (2017). [0279] 111 Shimobayashi, M. & Hall, M. N. Making new contacts: the mTOR network in metabolism and signalling crosstalk. Nat Rev Mol Cell Biol 15, 155-162, doi:10.1038/nrm3757 (2014). [0280] 112 Chang, Y. Y. et al. Nutrient-dependent regulation of autophagy through the target of rapamycin pathway. Biochem Soc Trans 37, 232-236, doi:10.1042/BST0370232 (2009). [0281] 113 Reggiori, F. & Ungermann, C. Autophagosome Maturation and Fusion. J Mol Biol 429, 486-496, doi:10.1016/j.jmb.2017.01.002 (2017). [0282] 114 Eskelinen, E. L. Maturation of autophagic vacuoles in Mammalian cells. Autophagy 1, 1-10 (2005). [0283] 115 Levine, B. & Kroemer, G. Autophagy in the pathogenesis of disease. Cell 132, 27-42, doi:10.1016/j.cell.2007.12.018 (2008). [0284] 116 Sarkar, S. et al. Lithium induces autophagy by inhibiting inositol monophosphatase. J Cell Biol 170, 1101-1111, doi:10.1083/jcb.200504035 (2005). [0285] 117 Park, H. W. et al. Pharmacological correction of obesity-induced autophagy arrest using calcium channel blockers. Nat Commun 5, 4834, doi:10.1038/ncomms5834 (2014). [0286] 118 Ianniciello, A., et al. The Ins and Outs of Autophagy and Metabolism in Hematopoietic and Leukemic Stem Cells: Food for Thought. Front Cell Dev Biol 6, 120, doi:10.3389/fcell.2018.00120 (2018). [0287] 119 Lee, M. J. & Yaffe, M. B. Protein Regulation in Signal Transduction. Cold Spring Harb Perspect Biol 8, doi:10.1101/cshperspect.a005918 (2016). [0288] 120 Moran-Crusio, K. et al. Regulation of hematopoietic stem cell fate by the ubiquitin proteasome system. Trends Immunol 33, 357-363, doi:10.1016/j.it.2012.01.009 (2012). [0289] 121 Shaid, S. et al. Ubiquitination and selective autophagy. Cell Death Differ 20, 21-30, doi:10.1038/cdd.2012.72 (2013). [0290] 122 Xie, Y. et al. Posttranslational modification of autophagy-related proteins in macroautophagy. Autophagy 11, 28-45, doi: 10.4161/15548627.2014.984267 (2015). [0291] 123 Eaton et al. Sickle cell hemoglobin polymerization. Adv Protein Chem, 40: 63-279 (1990). [0292] 124 Steinberg, M H. Management of sickle cell disease. N Engl J Med 340(13): 1021-1030 (1999). [0293] 125 Ballas, S K & Smith, E D. Red blood cell changes during the evolution of the sickle cell painful crisis. Blood, 79(8) 2154-63 (1992). [0294] 126 Kassim, A A & DeBaun, M R. Sickle cell disease, vasculopathy, and therapeutics. Annu Rev Med, 64: 451-466 (2013). [0295] 127 Telen et al. Developing new pharmacotherapeutic approaches to treating sickle-cell disease. Blood 12(1) 239-247 (2006). [0296] 128 Wang et al., Experimental and Therapeutic Medicine (2015).