Methods, compositions and cells for preparing surfactant protein D (SP-D)
10752914 · 2020-08-25
Assignee
Inventors
- Jan Susan Rosenbaum (Cincinnati, OH, US)
- Frederick Gyapon Quast (Berlin, DE)
- Matthias Kaup (Berlin, DE)
- Lars Stöckl (Berlin, DE)
Cpc classification
C12N2015/8518
CHEMISTRY; METALLURGY
C12N5/0694
CHEMISTRY; METALLURGY
International classification
C07K14/785
CHEMISTRY; METALLURGY
Abstract
Some embodiments of the methods and compositions provided herein relate to the preparation surfactant protein-D (SP-D). Some embodiments include the expression of human SP-D in certain cell lines, and the purification of human SP-D from such cell lines. Some embodiments include the preparation of certain oligomeric forms of human SP-D.
Claims
1. A method for producing a human surfactant protein D (SP-D) polypeptide composition comprising: (a) introducing a polynucleotide encoding the SP-D polypeptide into a human cell selected from the group consisting of: NM-H9D8, NM-H9D8-E6Q12, NM-H9D8(8B11), and NM-F9; (b) culturing the cell under conditions in which the SP-D polypeptide is expressed; and (c) isolating the expressed SP-D polypeptide from the cell, wherein the expressed SP-D polypeptide comprises a glycosylation pattern substantially similar to a glycosylation pattern of a naturally-occurring human SP-D, wherein the expressed SP-D polypeptide and the naturally-occurring human SP-D each comprise the same percentage of carbohydrate structures comprising: (i) a glycan with 3 sialic acids, (ii) a monoantennary glycan, (iii) a tetraantennary glycan, (iv) a hybrid-type glycan, or (v) a high mannose-type glycan.
2. The method of claim 1, wherein the cell is a NM-H9D8 cell.
3. The method of claim 1, wherein the cell is a NM-H9D8(8B11) cell.
4. The method of claim 1, wherein the polynucleotide encodes a leader polypeptide selected from a wild type SP-D polypeptide leader sequence, and a wild type T-cell receptor (TCR) polypeptide leader sequence.
5. The method of claim 4, wherein the leader polypeptide comprises the amino acid sequence of SEQ ID NO:05 or SEQ ID NO:10.
6. The method of claim 1, wherein the polynucleotide encodes a pre-polypeptide comprising a leader polypeptide and the SP-D polypeptide, the pre-polypeptide having an amino acid sequence comprising SEQ ID NO:04 or SEQ ID NO:09.
7. The method of claim 1, wherein the SP-D polypeptide comprises a residue at a polymorphic position, wherein the residue is selected from the group consisting of Met11/31, Thr160/180, Ser 270/290, and Ala 286/306.
8. The method of claim 1, further comprising isolating a population of the expressed SP-D polypeptides, each expressed SP-D polypeptide comprising a complex-type carbohydrate attached at an N-glycosylation site, wherein the population has a glycosylation pattern comprising the following characteristics: (i) at least 70% of the complex-type carbohydrates include a core fucose; (ii) at least 10% of the complex-type carbohydrates include at least one sialic acid residue; (iii) at least 50% of the complex-type carbohydrates include at least a biantennary carbohydrate structure; (iv) at least 10% of the complex-type carbohydrates include a bisecting N-acetylglucosamine; (v) less than 10% of the carbohydrates are high-mannose type structures; and (vi) a detectable amount of 2,6-coupled sialic acid residues.
9. The method of claim 8, wherein the population has a glycosylation pattern comprising one or more of the following characteristics: (i) at least 20% of the complex-type carbohydrates include a bisecting N-acetylglucosamine; and (iii) at least 85% of the complex-type carbohydrates include a core fucose.
10. The method of claim 1, wherein the polynucleotide encodes a dihydrofolate reductase polypeptide, wherein culturing the cell comprises contacting the cell with an antifolate, and wherein expression of the SP-D polypeptide is increased by increasing the concentration of the antifolate.
11. The method of claim 1, wherein the cell is cultured in a perfusion bioreactor or in a continuous culture.
12. The method of claim 1, wherein culturing the cell comprises maintaining a growth medium having a pH 7.2, dissolved oxygen in a range less than 40% and greater than 20%, and temperature at 37 C.
13. The method of claim 1, wherein the polynucleotide is an expression vector encoding the SP-D polypeptide, wherein the expression vector encodes a leader polypeptide, and a dihydrofolate reductase, wherein the leader polypeptide is selected from a wild type SP-D polypeptide leader sequence or a wild type T-cell receptor (TCR) polypeptide leader sequence.
14. The method of claim 13, wherein the leader polypeptide comprises SEQ ID NO: 05 or SEQ ID NO: 10.
15. The method of claim 13, wherein the expression vector encodes a pre-polypeptide comprising the leader polypeptide and the SP-D polypeptide, the pre-polypeptide having an amino acid sequence comprising SEQ ID NO:04 or SEQ ID NO:09.
16. An immortalized human cell comprising an expression vector encoding a leader polypeptide, a human surfactant protein D (SP-D) polypeptide, and a dihydrofolate reductase, wherein the leader polypeptide is selected from a wild type SP-D polypeptide leader sequence or a wild type T-cell receptor (TCR) polypeptide leader sequence, wherein the cell is selected from the group consisting of NM-H9D8, NM-H9D8-E6Q12, NM-H9D8(8B11), and NM-F9, and wherein the cell is capable of expressing the SP-D polypeptide comprising a glycosylation pattern substantially similar to a glycosylation pattern of a naturally-occurring human SP-D, wherein the expressed SP-D polypeptide and the naturally-occurring human SP-D each comprise the same percentage of carbohydrate structures comprising: (i) a glycan with 3 sialic acids, (ii) a monoantennary glycan, (iii) a tetraantennary glycan, (iv) a hybrid-type glycan, or (v) a high mannose-type glycan.
17. The cell of claim 16, wherein the cell is selected from the group consisting of NM-H9D8, NM-H9D8-E6Q12, and NM-F9.
18. The cell of claim 16, wherein the cell is a NM-H9D8 cell.
19. The cell of claim 16, wherein the cell is a NM-H9D8(8B11) cell.
20. The method of claim 1, wherein the expressed SP-D polypeptide and the naturally-occurring human SP-D each have an antennarity number within a range from 190 to 215.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
DETAILED DESCRIPTION
(13) Surfactant protein D (SP-D) is a C-type (Ca.sup.2+-dependent) lectin that comprises four domains: a cysteine-linked N-terminal region required for the formation of intermolecular disulfide bonds, a triple-helical collagen region, an -helical-coiled-coil trimerizing neck peptide, and a C-terminal calcium-dependent carbohydrate-recognition domain (CRD) (Crouch E. et al. (1994) J Biol Chem, 269:17311-9). Monomers form trimers through folding of the collagenous region into triple helices and the assembly of a coiled-coil bundle of -helices in the neck region (
(14) Human SP-D produced in mammalian Chinese hamster ovary (CHO) cells has been characterized by atomic force microscopy (AFM) and electrophoresis. A solution of rhSP-D can include a diverse population of different SP-D oligomeric forms including: trimers, hexamers, dodecamers, and larger oligomeric species identified as fuzzy balls which comprise more than 4 trimers. It was demonstrated in some embodiments of the present invention that production of SP-D as described herein, especially using the vectors and/or host cells and/or purification methods described herein, results in a higher yield of SP-D protein and a higher amount of SP-D dodecamers and a lower amount of larger oligomeric species compared to production of SP-D in CHO cells. It was demonstrated in some embodiments of the present invention that production of SP-D as described herein, especially using the vectors and/or host cells and/or purification methods described herein, results in a higher yield of SP-D protein and a higher relative amount of SP-D dodecamers and a lower relative amount of larger oligomeric species compared to production of rhSP-D in CHO cells. For example, the yield could be increased by up to about 5-15 fold, the relative amount of SP-D dodecamers in the purified rhSP-D composition as measured by means of SEC HPLC could be enhanced by about 30% or more and the relative amount of larger oligomeric species could be reduced by about 30% or more. The purification of the cell culture supernatant via Q-Sepharose and Superdex 75 columns does not alter the ratio of dodecamers to larger oligomeric species (such as fuzzy balls). Therefore, the relative amounts of the dodecamers and larger oligomeric species in the purified SP-D composition represent those in the cell culture supernatant.
(15) Certain Expression Vectors and Cells
(16) In one aspect, an expression vector comprising a polynucleotide encoding a human SP-D polypeptide is provided. Some embodiments include the preparation of expression vectors comprising a polynucleotide encoding a human SP-D polypeptide. Polymorphisms in the human SP-D polypeptide can include: residue 11, ATG (Met) ->ACG (Thr); residue 25, AGT (Ser) ->AGC (Ser); residue 160, ACA (Thr) ->GCA (Ala); residue 270, TCT (Ser) ->ACT (Thr); and residue 286, GCT (Ala) ->GCC (Ala) in which the positions relate to a position in the mature SP-D polypeptide. In some embodiments, the SP-D polypeptide comprises a certain residue at a polymorphic position in which the residue selected from Met11/31, Thr160/180, Ser 270/290, and Ala 286/306 in which residue positions relate to a position in the mature SP-D polypeptide, and a position in the SP-D polypeptide with its leader polypeptide. In some embodiments, the SP-D polypeptide comprises Met11/31. In some embodiments, the SP-D polypeptide comprises Met11/31, Thr160/180, Ser 270/290, and Ala 286/306. Examples of such sequences are provided in TABLE 1. In some embodiments, the SP-D is encoded by a nucleic acid having at least about 80%, 90%, 95%, 99% and 100%, or any range between any of the foregoing numbers, identity with a polynucleotide selected from SEQ ID NO:02 and SEQ ID NO:07 over the entire length of the polynucleotide. In some embodiments, the SP-D polypeptide has at least about 80%, 90%, 95%, 99% and 100%, or any range between any of the foregoing numbers, homology with a polypeptide selected from SEQ ID NO:04 and SEQ ID NO:09 over the entire length of the polynucleotide. In some embodiments, the SP-D polypeptide comprises the amino acid sequence of positions 22 to 376 of SEQ ID NO:04 or an amino acid sequence which is at least 80%, at least 90%, at least 95% or at least 99% identical thereto over the entire length of the reference sequence.
(17) In some embodiments, the expression vector encodes a leader polypeptide located 5 of the nucleotide sequence encoding the SP-D polypeptide. In some embodiments the leader sequence is a wild type T cell receptor (TCR) leader sequence or a wild type SP-D leader sequence. Examples of such sequences are provided in TABLE 1. In some embodiments, the leader polypeptide is encoded by a nucleic acid having at least about 80%, 90%, 95%, 99% and 100%, or any range between any of the foregoing numbers, identity with a polynucleotide selected from SEQ ID NO:03 and SEQ ID NO:08 over the entire length of the polynucleotide. In some embodiments, the leader polypeptide has at least about 80%, 90%, 95%, 99% and 100%, or any range between any of the foregoing numbers, homology with a polypeptide selected from SEQ ID NO:05 and SEQ ID NO:10 over the entire length of the polynucleotide.
(18) In some embodiments, the expression vector includes a selection gene useful to select for mammalian cells having the selection gene. Examples of such genes include those that encode proteins such as dihydrofolate reductase which provides resistance against antifolate compounds, such as methotrexate.
(19) In one aspect, a cell comprising one or more of expression vectors comprising a polynucleotide encoding a human SP-D polypeptide is provided. Some embodiments include cells comprising one or more of the expression vectors described herein. Examples of such cells include mammalian cells that can modify an expressed SP-D polypeptide with a glycosylation pattern that enhances the activity and/or stability of the expressed SP-D polypeptide. Such cells include immortalized human blood cells, such as cells derived from a human myeloid leukemia. Examples of such cells include NM-H9D8 (DSM ACC 2806); NM-H9D8-E6Q12 (DSM ACC 2856); and NM-F9 (DSM ACC 2606) which have been deposited under the stated ACC code with the DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH in Braunschweig (Germany). NM-F9 was deposited by Nemod Biotherapeutics GmbH & Co. KG, Robert-Rossle-Str. 10, 13125 Berlin (DE) on Aug. 14, 2003, NM-H9D8 was deposited by Glycotope GmbH, Robert-Rssle-Str. 10, 13125 Berlin (DE) on Sep. 15, 2006, and NM-H9D8-E6Q12 was deposited by Glycotope GmbH, Robert-Rssle-Str. 10, 13125 Berlin (DE) on Aug. 8, 2007. More examples of useful cells lines can be found in U.S. Pat. No. 9,051,356, which is incorporated herein by reference in its entirety. In some embodiments, the cell comprising one or more of expression vectors comprising a polynucleotide encoding a human SP-D polypeptide is a cell of the cell line NM-H9D8.
(20) Certain Methods for Producing Human SP-D
(21) In one aspect, a method of producing a human SP-D polypeptide composition is provided. Some embodiments include methods of producing a human SP-D polypeptide composition by (a) introducing a polynucleotide encoding a human SP-D polypeptide into a mammalian cell; (b) culturing the cell under conditions in which the SP-D polypeptide is expressed; and (c) isolating the expressed SP-D polypeptide from the cell. Methods to introduce a polynucleotide encoding the SP-D polypeptide into a mammalian cell are well known in the art and include electroporation, transfection using cationic lipids, calcium phosphate, DEAE-dextran, or infection by virus particles such as adenoviruses or retroviruses or a combination thereof. Some such methods include linearizing an expression vector provided herein, and transfecting the linearized vector into a cell. In some embodiments, the cell and/or expression vector as described herein are used in the method of producing a human SP-D polypeptide composition. In some embodiments, the SP-D polypeptide is secreted by the mammalian cell. In these embodiments, the expressed SP-D polypeptide may be isolated from cell culture medium used for culturing the cell. In some embodiments, isolating the expressed SP-D polypeptide is done as described herein.
(22) In some embodiments, the cell is derived from a human myeloid leukemia cell, such as a NM-H9D8, NM-H9D8-E6Q12, and NM-F9 cell line.
(23) Some embodiments include methods of selecting cells comprising an expression vector. Some such embodiments can include culturing a cell with an antifolate, such as methotrexate. Transfectants can be isolated by methods such as subcloning, and cells which express SP-D can be readily identified by methods well known in the art, such as immunological methods using antibodies against SP-D in combination with ELISA, Western blots, and dot-blots.
(24) In some embodiments, transfected cells which express SP-D at increased concentrations can be selected for by increasing the concentration of an antifolate, such as methotrexate in a culture medium.
(25) Some embodiments include culturing cells that express SP-D in a perfusion bioreactor. Some such embodiments can include culturing cells by continuous fermentation. In perfusion mode, fresh media can be continuously supplied, and cell-free supernatant can be taken from the bioreactor while cells are held back in the fermenter. Cells can be held back by applying different techniques. For example filtration, centrifugation or sedimentation can be used. Example methods can be found in U.S. Pat. No. 9,359,427, which is incorporated by reference herein in its entirety.
(26) Certain Methods for Isolating SP-D from a Culture Medium
(27) In one aspect, a method of isolating human SP-D polypeptides is provided. Some embodiments include isolating expressed SP-D polypeptides from a culture medium. In one embodiment, the isolation is by using chromatography. Examples of chromatographic methods include affinity chromatography using affinity materials such as, Protein A, Protein G, anti-SP-D antibodies, lectin chromatography, antibodies against a certain tag introduced into an SP-D polypeptide such as HIS-tag or myc-tag, or antigen, or by other chromatography media such as, ion exchange chromatography, hydrophobic interaction chromatography, mixed-mode chromatography or size exclusion chromatography.
(28) In some embodiments, a cell supernatant is prepared from a culture medium comprising a SP-D expressing cell. The supernatant can be filter-sterilized. In some embodiments, a cell supernatant comprising a SP-D polypeptide can be applied to column and the resulting eluate can be applied to a second column. In some embodiments, the SP-D polypeptide is isolated using anion exchange chromatography followed by affinity chromatography. In some embodiments, a strong anion exchange chromatography matrix such as Q-Sepharose is used for anion exchange chromatography. In some embodiments, a gel filtration chromatography matrix such as Superdex 75 matrix is used for affinity chromatography. In some embodiments, the cell supernatant is applied to a Q-Sepharose column with an equilibration and running buffer comprising 20 mM TRIS, 50 mM NaCl, pH 7.4. The SP-D can be eluted from the column using an elution buffer comprising 20 mM Tris, 600 mM NaCl, pH 7.4. In some such embodiments, the Q-Sepharose column eluate comprises about 0.2 to about 0.8 mg/ml SP-D.
(29) Some embodiments include applying the fraction of the Q-Sepharose column eluate comprising SP-D to a second column, such as Superdex75 column. In some embodiments, the Q-Sepharose column eluate is diluted with the same volume of a 20 mM Tris buffer pH 7.4 containing 10 mM CaCl.sub.2 and applied to a Superdex75 column with an equilibration and running buffer comprising 20 mM Tris, 300 mM NaCl, 5 mM CaCl.sub.2, pH 7.4. The SP-D can be eluted from the column using an elution buffer comprising 20 mM Tris, 10 mM EDTA 300 mM NaCl, pH 7.4. In some such embodiments, the eluate comprises about 0.5 to about 2 mg/mL SP-D. In some such embodiments, the eluate comprises SP-D having greater than about 90% purity. Some embodiments also include dialyzing the eluate into a 5 mM Histidine buffer containing 200 mM NaCl, 1 mM EDTA, pH 7.0 prior to storage and analysis.
(30) Posttranslational Modification of SP-D
(31) One embodiment includes human SP-D polypeptides having a specific pattern of posttranslational modifications. Some embodiments include a composition comprising human SP-D polypeptides which are glycosylated, in particular N-glycosylated. In some embodiments, the glycosylated human SP-D polypeptides carry a carbohydrate structure at an asparagine corresponding to Asn90 of SEQ ID NO: 4 or 9. Carbohydrate structures at an N-glycosylation site may comprise a core structure of two N-actelyglucosamine (GlcNAc) residues and three mannose residues, wherein the first GlcNAc is attached to the polypeptide backbone, the second GlcNAc is attached to the first GlcNAc, the first mannose is attached to the second GlcNAc, and the second and third mannose are each attached to the first mannose. Further monosaccharide units may be attached to this core structure. In some embodiments, at least 60%, especially at least 70%, at least 75%, at least 80%, at least 85% or in particular at least 90% of the carbohydrate structures at the N-glycosylation site of SP-D in the composition are complex-type carbohydrate structures. Complex-type carbohydrate structures comprise at least one further GlcNAc residue attached to the second or third mannose residue, but do not comprise any further mannose residues.
(32) In some embodiments, the human SP-D polypeptides in the composition have a glycosylation pattern at the N-glycosylation site comprising one or more of the following characteristics:
(33) (i) a relative amount of carbohydrate structures carrying core fucose of at least 70% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(34) (ii) a relative amount of carbohydrate structures carrying at least one sialic acid residue of at least 10% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(35) (iii) a relative amount of at least biantennary carbohydrate structures of at least 50% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition.
(36) In some embodiments, the relative amount of carbohydrate structures carrying core fucose is at least 75% or at least 80% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition. A core fucose residue is attached to the first GlcNAc residue of the core structure. A relative amount of carbohydrate structures according to the invention refers to a specific percentage or percentage range of the carbohydrate structures attached to SP-D in a composition. In particular, the relative amount of carbohydrate structures refers to a specific percentage or percentage range of all carbohydrate structures attached to the SP-D polypeptide chains in a composition. In some embodiments, only the carbohydrate structures attached to the N-glycosylation site of SP-D are considered.
(37) In some embodiments, the relative amount of carbohydrate structures carrying at least one sialic acid residue is at least 15%, at least 20% or at least 25% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition. The relative amount of carbohydrate structures carrying at least one sialic acid residue may be in the range of from 10% to 80%, from 15% to 75% or from 20% to 70%. In some embodiments, the glycosylation pattern of the human SP-D polypeptides in the composition comprises a relative amount of carbohydrate structures carrying two sialic acid residues of at least 0.5%, for example at least 1% or at least 2%, of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition. The relative amount of carbohydrate structures carrying at least two sialic acid residues may be in the range of from 0.5% to 30%, from 1% to 20% or from 1.5% to 15%. The term sialic acid in particular refers to any N- or O-substituted derivatives of neuraminic acid. It may refer to both 5-N-acetylneuraminic acid and 5-N-glycolylneuraminic acid, but preferably only refers to 5-N-acetylneuraminic acid. The sialic acid, in particular the 5-N-acetylneuraminic acid preferably is attached to a carbohydrate chain via a 2,3- or 2,6-linkage. Preferably, in the glycosylation pattern of SP-D described herein both 2,3- as well as 2,6-coupled sialic acids are present.
(38) In some embodiments, the relative amount of at least biantennary carbohydrate structures is at least 60% or at least 70% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition. In some embodiments, the glycosylation pattern of the human SP-D polypeptides in the composition comprises a relative amount of at least triantennary carbohydrate structures of at least 2%, for example at least 3% or at least 4%, of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition. Antennae are branches or one or more monosaccharide units which are attached to the terminal (i.e. the second or third) mannose residues of the core structure. In complex-type carbohydrate structures, an antenna generally comprises a GlcNAc residue, which may further carry a galactose residue and optionally a sialic acid residue. A biantennary complex-type carbohydrate structure comprises two antennae, i.e. to each of the two terminal mannose residues of the core structure at least a GlcNAc residue is attached. In a triantennary complex-type carbohydrate structure, one terminal mannose carries two antennae and the other terminal mannose carries one antenna. In a tetraantennary complex-type carbohydrate structure, both terminal mannoses each carry two antennae. The term at least biantennary includes bi- tri- and tetraantennary carbohydrate structures, while the term at least triantennary includes tri- and tetraantennary carbohydrate structures.
(39) The A-number in glycosylation is a reference number for the antennarity of the glycan structures in a glycosylation pattern. The A-number is calculated by multiplying the relative amount of a specific antennarity with its number of antennae and adding the obtained numbers for each antennarity. In particular, the relative amount of monoantennary glycans is multiplied by 1, the relative amount of biantennary glycans is multiplied by 2, the relative amount of triantennary glycans is multiplied by 3 and the relative amount of tetraantennary glycans is multiplied by 4. The sum of these numbers results in the A-number. In some embodiments, the human SP-D polypeptides in the composition have a glycosylation pattern at the N-glycosylation site having an A-number of at least 185, for example at least 190.
(40) In some embodiments, the human SP-D polypeptides in the composition have a glycosylation pattern at the N-glycosylation site comprising one or more of the following characteristics:
(41) (i) a relative amount of carbohydrate structures carrying bisecting N-acetylglucosamine (bisGlcNAc) of at least 2%, for example at least 5% or at least 8%, of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(42) (ii) a relative amount of carbohydrate structures carrying at least one galactose residue of at least 40%, for example at least 45% or at least 50%, of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(43) (iii) a relative amount of carbohydrate structures carrying at least two galactose residues of at least 15%, for example at least 20% or at least 25%, of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(44) (iv) a relative amount of carbohydrate structures carrying an N-acetylgalactose residue of 30% or less, for example 20% or less or 15% or less, of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(45) (v) a relative amount of hybrid-type carbohydrate structures of 30% or less, for example 25% or less or 20% or less, of the total amount of carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and/or
(46) (vi) a relative amount of high-mannose-type carbohydrate structures of 25% or less, for example 20% or less or 15% or less, of the total amount of carbohydrate structures attached to the N-glycosylation site of SP-D in the composition.
(47) A bisecting N-acetylglucosymine or bisGlcNAc residue is a GlcNAc residue attached to the central (i.e. first) mannose residue of the core structure of the carbohydrate structure. In some embodiments, the relative amount of carbohydrate structures carrying bisGlcNAc is in the range of from 2% to 50%, for example from 5% to 40% or from 8% to 35% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition. A high-mannose-type carbohydrate structure comprises only mannose residues attached to the terminal mannoses of the core structure. A hybrid-type carbohydrate structure comprises mannose residues attached to one terminal mannose of the core structure and an antenna as described for complex-type carbohydrate structures attached to the other terminal mannose of the core structure.
(48) In some embodiments, a population of SP-D polypeptides having a complex-type carbohydrate attached at the N-glycosylation site of the SP-D, can have a glycosylation pattern comprising one or more of the following characteristics:
(49) (i) at least 20% of the complex-type carbohydrates include a bisecting N-acetylglucosamine;
(50) (ii) at least 25% of the complex-type carbohydrates include at least one sialic acid residue;
(51) (iii) at least 85% of the complex-type carbohydrates include a biantennary carbohydrate structure;
(52) (iv) at least 0.5% of the complex-type carbohydrates include at least one GalNAc;
(53) (v) less than 2% of the complex-type carbohydrates include 3 galactoses; and
(54) (vi) less than 2% of the complex-type carbohydrates include a triantennary carbohydrate structure.
(55) In some embodiments, a population of SP-D polypeptides having a complex-type carbohydrate attached at the N-glycosylation site of the SP-D can have a glycosylation pattern that includes any of the following characteristics. In some embodiments, at least 15%, 18%, 19%, 20%, 25%, 30%, 35%, 38%, 40%, 45%, or a percentage in a range between any of the foregoing percentages of the complex-type carbohydrates of the carbohydrate structures attached to the N-glycosylation site of the SP-D of the population include a bisecting N-acetylglucosamine. In some embodiments, at least 75%, 80%, 82%, 85%, 90%, 95%, or a percentage in a range between any of the foregoing percentages of the complex-type carbohydrates of the carbohydrate structures attached to the N-glycosylation site of the SP-D of the population include a biantennary carbohydrate structure. In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 15%, or a percentage in a range between any of the foregoing percentages of the complex-type carbohydrates of the carbohydrate structures attached to the N-glycosylation site of the SP-D of the population include at least one GalNAc. In some embodiments, less than 15%, 10%, 5%, 4%, 3%, 2%, 1%, or a percentage in a range between any of the foregoing percentages of the complex-type carbohydrates of the carbohydrate structures attached to the N-glycosylation site of the SP-D of the population include 3 galactose residues. In some embodiments, less than 15%, 13%, 10%, 5%, 4%, 3%, 2%, 1%, or a percentage in a range between any of the foregoing percentages of the complex-type carbohydrates of the carbohydrate structures attached to the N-glycosylation site of the SP-D of the population include a triantennary carbohydrate structure.
(56) In some embodiments, the human SP-D polypeptides in the composition have a glycosylation pattern at the N-glycosylation site comprising the following characteristics:
(57) (i) a relative amount of carbohydrate structures carrying bisecting GlcNAc of at least 10% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition;
(58) (ii) a relative amount of high-mannose-type carbohydrate structures 10% or less, of the total amount of carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and
(59) (iii) a detectable amount of complex-type carbohydrate structures carrying an 2,6-coupled sialic acid residue.
(60) In further embodiments, the human SP-D polypeptides in the composition have a glycosylation pattern at the N-glycosylation site comprising the following characteristics:
(61) (i) a relative amount of carbohydrate structures carrying core fucose of at least 85% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition;
(62) (ii) a relative amount of carbohydrate structures carrying bisecting GlcNAc of at least 20% of the total amount of complex-type carbohydrate structures attached to the N-glycosylation site of SP-D in the composition;
(63) (iii) a relative amount of high-mannose-type carbohydrate structures 10% or less, of the total amount of carbohydrate structures attached to the N-glycosylation site of SP-D in the composition; and
(64) (iv) a detectable amount of complex-type carbohydrate structures carrying an 2,6-coupled sialic acid residue.
(65) Identification of Oligomeric Species of SP-D
(66) In one aspect, a method of identifying oligomeric species of human SP-D polypeptides is provided. Some embodiments include methods of identifying oligomeric species of SP-D, such as trimers, dodecamers, and oligomeric structures containing more than 4 trimers. Such methods can be useful to identify conditions and components for preparing formulations of SP-D having a certain amount of a certain oligomeric form, such as predominantly a dodecameric form. In some embodiments, methods for identifying oligomeric species of human SP-D polypeptides can include performing an asymmetric flow field-flow fractionation with multi-angle light scattering (AF4-MALS) analysis on a sample of SP-D. In some embodiments, methods can include performing a size exclusion chromatograph HPLC (SEC HPLC) for identifying oligomeric species of human SP-D polypeptides. Example conditions for SEC HPLC include: UHPLC: Dionex UltiMate 3000; column: TSKgel G6000PWXL, phase hydroxylated methacrylate, LI.D. 30 cm7.8 mm, 13 m particle size (#0008024,Tosoh); column oven temperature: 30 C.; sampler temperature: 4 C.; pressure upper limit: 31 bar; UV detection: 280 nm; eluent: TBS, 10 mM EDTA, pH 7,4 (from 10TBS Roti-Stock #1060.1, Carl Roth, EDTA #8040.2, Carl Roth); flow: 0.25 mL/min; samples injection: 20 g or 30 L fix volume; integration limits: HOO 25.0-30.0 min, dodecamer 30.0-34.5 min, LOO 34.5-44.0 min.
(67) In some embodiments, methods of identifying oligomeric species of SP-D can include performing atomic force microscopy (AFM) on a sample of SP-D, identifying, and/or quantifying oligomeric species of SP-D in the AFM images. In some such embodiments, methods can include resolving a mixture of oligomeric species of SP-D by size. Some such methods include contacting a sample of SP-D with an anionic detergent, such as of sodium dodecyl sulfate (SDS); contacting the sample with a crosslinking reagent, such as 1% glutardialdehyde (GA); and resolving by size the species of SP-D, such as by performing polyacrylamide gel electrophoresis (PAGE). In some embodiments, the sample of SP-D is contacted with the anionic detergent prior to contacting the sample with the crosslinking reagent. In other embodiments, the sample of SP-D is contacted with the crosslinking reagent prior to contacting the sample with the anionic detergent. In some embodiments, the sample is contacted with a solution of about 1% GA. In some embodiments, the sample is contacted with a crosslinking reagent for a period between about 1 minute to about 30 minutes. In some embodiments, the PAGE is in the presence of sodium dodecyl sulfate (PAGE-SDS). In other embodiments, the PAGE is native PAGE. In some embodiments, the PAGE comprises a gradient gel. In some embodiments, the gradient gel is a 4-15% polyacrylamide gradient tris-glycine gel. In some embodiments, the PAGE is performed in the absence of a reducing agent. In some embodiments, the reducing agent comprises -mercaptoethanol. Some embodiments also include identifying the species of SP-D, such as performing a Western blot.
(68) Certain Compositions Comprising SP-D
(69) Some embodiments include solutions comprising a population of rhSP-D polypeptides having a certain distribution of oligomeric forms of the SP-D. In some embodiments, the solution can include oligomeric forms of the SP-D in which greater than about 30%, 40%, 50%, 60%, 61%, 62%, 63%, 64%, 65%, 70%, or any range between the foregoing numbers, of the oligomeric forms comprise dodecamers of the SP-D. In some embodiments, a distribution of the oligomeric forms of the SP-D can be measured by methods provided herein, such as an asymmetric flow field-flow fractionation with multi-angle light scattering (AF4-MALS) analysis. In some embodiments, the solution of rhSP-D polypeptides is prepared by a method provided herein. In some embodiments, the method of producing a human SP-D polypeptide composition as described herein produces a solution comprising a population of rhSP-D polypeptides as described herein. In some embodiments, the method of isolating human SP-D polypeptides as described herein produces a solution comprising a population of rhSP-D polypeptides as described herein. In some embodiments of the method of producing a human SP-D polypeptide composition as described herein, the expressed SP-D polypeptide is predominantly in dodecameric form. In some embodiments of the method of isolating human SP-D polypeptides as described herein, the isolated SP-D polypeptide is predominantly in dodecameric form. Predominantly in this respect may in particular refer to a relative amount of at least 30% of all SP-D polypeptides in the composition, such as at least 40%, at least 45%, at least 50% or at least 55% of all SP-D polypeptides in the composition. In some embodiments, predominantly refers to a relative amount of more than 50% of all SP-D polypeptides in the composition.
EXAMPLES
Example 1
Construction of SP-D Expression Vectors
(70) Two expression vectors were developed for expression of human SP-D in human mammalian cells. One vector included a wild-type human SP-D leader/signal sequence; the other vector included a human T-cell receptor (TCR) leader/signal sequence. The TCR leader sequence was selected for one of the expression vectors because the proteins would be expressed in human myeloid leukemia cells which would be expected to secrete proteins with a TCR leader sequence at a high efficiency.
(71) Polynucleotides encoding a human SP-D polypeptide and including either the wild-type human SP-D leader/signal sequence or the human T-cell receptor (TCR) leader/signal sequence were synthesized by GENEART (ThermoFisher Scientific). Each polynucleotide included Xba I (5 end) and Hind III (3 end) restriction sites for cloning purposes, and a Kozak consensus sequence. Each polynucleotide was excised from a GENEART (ThermoFisher Scientific) delivery vector by Hind III/Xba I restriction, and ligated into a cloning vector pHBG1Ddhfr (Glycotope GmbH, Germany) to obtain the expression vectors: pHBG1Ddhfr_WT_SP-D (7228 bp), and pHBG1Ddhfr_TCR_SP-D (7231 bp). See
(72) TABLE-US-00001 TABLE1 SEQIDNO. Sequence SEQIDNO:01 aagcttgccaccatgctgctgtttctgctgagcgccctggtgctgctgacacagcctctgggc Polynucleotideencoding tatctggaagccgagatgaagacctacagccaccggaccatgcccagcgcctgtaccctcg aSP-Dpolypeptidewith tgatgtgcagcagcgtggaaagcggcctgcctggcagagatggcagggatggaagagag anendogenousSP-D ggccccagaggcgagaagggcgatcctggactgcctggcgctgcagggcaggctggaat leadersequence,kozak gcctggacaggctggacctgtgggccccaagggcgataatggctctgtgggagagcctgg sequence(underlined), ccctaagggggatacaggccatctggacctcctggaccacctggcgtgccaggacctgct andXbaI(5 end)and ggaagagaaggacctctgggcaagcagggcaacatcggccctcagggaaagccaggac HindIII(3 end) caaagggcgaggccggacccaaaggcgaagtgggagcacctggcatgcagggaagtgc restrictionsites. cggcgctagaggactggctggcccaaaaggcgaaaggggagtgcctggcgaaagaggc gtgcccggaaatactggcgccgctggatctgctggcgccatgggacctcagggatctccag gcgcaagaggccctccaggcctgaaaggcgacaaaggcatccccggcgataagggcgc taagggcgaatccggcctgccagatgtggccagcctgagacagcaggtggaagctctcca gggccaggtgcagcatctccaggctgccttcagccagtacaagaaggtggaactgttcccc aacggccagagcgtgggcgagaagatctttaagaccgccggatcgtgaagccatcacc gaggctcagctgctgtgtacccaggctggcggacagctggcctctcctagatctgccgccg aaaatgccgctctccagcagctggtggtggccaagaatgaggccgccttcctgagcatgac cgacagcaagaccgagggcaagttcacctaccccaccggcgagtccctggtgtacagcaa ttgggcccctggcgagcccaacgatgatggcggctctgaggactgcgtggaaatcttcacc aacggcaagtggaacgaccgggcctgtggcgagaaaagactggtcgtgtgcgagttctga agggtctaga SEQIDNO:02 gccaccatgctgctgtttctgctgagcgccctggtgctgctgacacagcctctgggctatctg Polynucleotideencoding gaagccgagatgaagacctacagccaccggaccatgcccagcgcctgtaccctcgtgatg aSP-Dpolypeptidewith tgcagcagcgtggaaagcggcctgcctggcagagatggcagggatggaagagagggcc anendogenousSP-D ccagaggcgagaagggcgatcctggactgcctggcgctgcagggcaggctggaatgcct leadersequence. ggacaggctggacctgtgggccccaagggcgataatggctctgtgggagagcctggccct aagggggatacaggccatctggacctcctggaccacctggcgtgccaggacctgctgga agagaaggacctctgggcaagcagggcaacatcggccctcagggaaagccaggaccaa agggcgaggccggacccaaaggcgaagtgggagcacctggcatgcagggaagtgccg gcgctagaggactggctggcccaaaaggcgaaaggggagtgcctggcgaaagaggcgt gcccggaaatactggcgccgctggatctgctggcgccatgggacctcagggatctccagg cgcaagaggccctccaggcctgaaaggcgacaaaggcatccccggcgataagggcgcta agggcgaatccggcctgccagatgtggccagcctgagacagcaggtggaagctctccag ggccaggtgcagcatctccaggctgccttcagccagtacaagaaggtggaactgttcccca acggccagagcgtgggcgagaagatctttaagaccgccggatcgtgaagccatcaccg aggctcagctgctgtgtacccaggctggcggacagctggcctctcctagatctgccgccga aaatgccgctctccagcagctggtggtggccaagaatgaggccgccttcctgagcatgacc gacagcaagaccgagggcaagttcacctaccccaccggcgagtccctggtgtacagcaat tgggcccctggcgagcccaacgatgatggcggctctgaggactgcgtggaaatcttcacca acggcaagtggaacgaccgggcctgtggcgagaaaagactggtcgtgtgcgagttctgaa ggg SEQIDNO:03 atgctgctgtttctgctgagcgccctggtgctgctgacacagcctctgggctatctggaa Thepolynucleotide encodingthe endogenousleader sequenceinSEQID NO:01. SEQIDNO:04 MLLFLLSALVLLTQPLLGYLEAEMKTYSHRTMPSACTLV SP-Dpolypeptide MCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAG encodedbySEQID MPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPG NO:01includinga PAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQG leadersequence SAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQ (underlined)and GSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQV polymorphisms EALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGF (underlined)at: VKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNE Met11/31,Thr160/180, AAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGS Ser270/290,Ala EDCVEIFTNGKWNDRACGEKRLVVCEF 286/306. SEQIDNO:05 MLLFLLSALVLLTQPLLGYLE Theleadersequencein SEQIDNO:04. SEQIDNO:06 aagcttgccaccatggcctgccccggatttctgtgggccctcgtgatcagcacctgtctggaa Polynucleotideencoding ttcagcatggccgccgagatgaagacctacagccaccggacaatgcccagcgcctgcacc aSP-Dpolypeptidewith ctcgtgatgtgcagctctgtggaaagcggcctgcccggcagagatggcagggatggaaga aTCRleadersequence, gagggacccagaggcgagaagggcgatcctggactgcctggcgctgcagggcaggctg kozaksequence gaatgcctggacaggctggacctgtgggccccaagggcgataatggctctgtgggagagc (underlined),andXbaI ctggccctaagggggatacaggcccttctggacctcctggaccacctggcgtgccaggac (5 end)andHindIII(3 ctgctggaagagaaggacctctgggcaagcagggcaacatcggccctcagggaaagcca end)restrictionsites. ggaccaaagggcgaggccggacccaaaggcgaagtgggagcacctggcatgcaggga agtgccggcgctagaggactggctggcccaaaaggcgaaaggggagtgcctggcgaaa gaggcgtgcccggaaatactggcgccgctggatctgctggcgccatgggacctcagggat ctccaggcgcaagaggccctccaggcctgaaaggcgacaaaggcatccccggcgataag ggcgctaagggcgaatccggcctgccagatgtggccagcctgagacagcaggtggaagc tctccagggccaggtgcagcatctccaggctgccttcagccagtacaagaaggtggaactg ttccccaacggccagagcgtgggcgagaagatctttaagaccgccggcttcgtgaagccct tcaccgaggctcagctgctgtgtacccaggctggcggacagctggcctctcctagatctgcc gccgaaaatgccgctctccagcagctggtggtggccaagaatgaggccgccttcctgagc atgaccgacagcaagaccgagggcaagttcacctaccccaccggcgagtccctggtgtac agcaattgggcccctggcgagcccaacgatgatggcggctctgaggactgcgtggaaatct tcaccaacggcaagtggaacgaccgggcctgtggcgagaaaagactggtcgtgtgcgagt tctgaagggtctaga SEQIDNO:07 gccaccatggcctgccccggatttctgtgggccctcgtgatcagcacctgtctggaattcagc Polynucleotideencoding atggccgccgagatgaagacctacagccaccggacaatgcccagcgcctgcaccctcgtg aSP-Dpolypeptidewith atgtgcagctctgtggaaagcggcctgcccggcagagatggcagggatggaagagaggg aTCRleadersequence. acccagaggcgagaagggcgatcctggactgcctggcgctgcagggcaggctggaatgc ctggacaggctggacctgtgggccccaagggcgataatggctctgtgggagagcctggcc ctaagggggatacaggcccttctggacctcctggaccacctggcgtgccaggacctgctgg aagagaaggacctctgggcaagcagggcaacatcggccctcagggaaagccaggacca aagggcgaggccggacccaaaggcgaagtgggagcacctggcatgcagggaagtgcc ggcgctagaggactggctggcccaaaaggcgaaaggggagtgcctggcgaaagaggcg tgcccggaaatactggcgccgctggatctgctggcgccatgggacctcagggatctccagg cgcaagaggccctccaggcctgaaaggcgacaaaggcatccccggcgataagggcgcta agggcgaatccggcctgccagatgtggccagcctgagacagcaggtggaagctctccag ggccaggtgcagcatctccaggctgccttcagccagtacaagaaggtggaactgttcccca acggccagagcgtgggcgagaagatctttaagaccgccggcttcgtgaagcccttcaccg aggctcagctgctgtgtacccaggctggcggacagctggcctctcctagatctgccgccga aaatgccgctctccagcagctggtggtggccaagaatgaggccgccttcctgagcatgacc gacagcaagaccgagggcaagttcacctaccccaccggcgagtccctggtgtacagcaat tgggcccctggcgagcccaacgatgatggcggctctgaggactgcgtggaaatcttcacca acggcaagtggaacgaccgggcctgtggcgagaaaagactggtcgtgtgcgagttctgaa ggg SEQIDNO:08 atggcctgccccggatttctgtgggccctcgtgatcagcacctgtctggaattcagcatggcc Thepolynucleotide encodingtheleader sequenceinSEQID NO:06. SEQIDNO:09 MACPGFLWALVISTCLEFSMAAEMKTYSHRTMPSACTLV SP-Dpolypeptide MCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAG encodedbySEQID MPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPG NO:06includingaTCR PAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQG leadersequence SAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQ (underlined)and GSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQV polymorphisms EALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGF (underlined)at: VKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNE Met11/31,Thr160/180, AAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGS Ser270/290,Ala EDCVEIFTNGKWNDRACGEKRLVVCEF 286/306. SEQIDNO:10 MACPGFLWALVISTCLEFSMA Theleadersequencein SEQIDNO:09.
Example 2
Expression of SP-D in Mammalian Cell Lines
(73) Prior to transfection, expression vectors were linearized with Pvu I and purified with phenol/chloroform, and trichlormethan/chloroform. Cell lines were transfected with 7-8 g of a linearized expression vector using NUCLEOFECTION according to the manufacturer's instructions (AMAXA NUCLEOFECTOR TECHNOLOGY; Lonza, Cologne, Germany). The following cell lines were transfected with expression vectors: NM-H9D8 (DSM ACC 2806); NM-H9D8-E6Q12 (DSM ACC 2856); and NM-F9 (DSM ACC2606).
(74) Pools of cells expressing SP-D were selected using 25 nM methotrexate (MTX) and increasing the concentration to 50 nM MTX. To obtain cells with increasing levels of SP-D expression, the concentration of MTX was increased in steps from 100 nM to 200 nM to 400 nM MTX. The productivity of SP-D producing cells was determined by SP-D specific ELISA (BioVendor GmbH, Germany, Cat# RD194059101) according to the manufacturer's instructions, and/or Dot-Blot analysis using SP-D specific antibodies (Seven Hills Bioreagents, Cincinnati Ohio, Cat# WMAB-2D12A88 and Cat# WMAB-1A10A9). The specific production rate (SPR) was calculated using the following equations:
(75)
(76) Doubling time was calculated by following equation:
g=log 2(hours in culture)/log (final cell number/initial cell number)
(77) SP-D expressing clones were isolated from cell pools by means of the ClonePix (Molecular Devices) technology and assessed for productivity. Selected clones were further subcloned to obtain final clones. Clones with a productivity >100 picogram/cell/day (pcd) were obtained.
Example 3
Culturing SP-D Expressing Cell Lines
(78) Cells were cultured in a serum-free chemically defined gene therapy medium (GTM) (Glycotope GmbH, Germany). See e.g., U.S. Pat. No. 9,359,427 which is incorporated by reference in its entirety for a description of the GTM culture media. Perfusion process cultures were initiated with 1GTM, and then modified to 2GTM. Cells were maintained in exponential growth phase by splitting every 2 to 3 days to a cell concentration of 110.sup.5 to 310.sup.5 cells/mL in T flasks (25 cm.sup.2, 3 to 6 mL suspension volume, TPP, Germany) and were incubated at 37 C., 98% humidity and 8% CO.sub.2 (Integra Biosciences IBS, Biosafe plus, Switzerland or Thermo/Heraeus BBD 6220, Germany). Cell expansion was carried out using T flasks (75 cm.sup.2, 12 to 30 mL Volume; 150 cm.sup.2, 50 to 150 mL) and Spinner flasks (100 mL to 1000 mL, Integra Biosciences IBS, Cellspin, Switzerland).
(79) General cultivation parameters: media were inoculated with 2.010.sup.5 cells/mL. Continuous operation was enabled by feeding 1GTM at a perfusion rate of 0.5 V/d (usually day 4-5) and, depending on cell growth and nutrient requirements, increased to a maximum perfusion rate of two reactor volumes per day. When maximum perfusion with 1GTM was achieved, feed medium was replaced by modified 2GTM. Media was maintained at pH 7.2 by either addition of 0.5 M NaOH or sparging with CO.sub.2. Dissolved oxygen was set to 40% and a temperature to 37 C. Lowering the dissolved oxygen below 40% to e.g. to 20% dissolved oxygen is as well possible. In the latter case the content of docdecamer can be slightly increased compared to culturing under 40% dissolved oxygen.
(80) 1 L perfusion bioreactor: Laboratory 1 L scale cultivations were carried out in Sartorius Biostat B-DCU 2l Quad system or 2L BBI Quad system. Dissolved oxygen and pH were measured by standard electrodes (Mettler Torledo InPro 6800 and Mettler-Torledo 405-DPAS-SC-K8S, respectively, Mettler Torledo, Switzerland). Agitation was performed by 3-blade segment impellers with a stirring rate of 300 to 400 rpm. Perfusion was performed using an ATF2 module with a 60 cm PES membrane (0.2 m pore size and 0.15 m.sup.2 membrane area, Spectrum, USA) and a flow rate of 0.9 L/min. In Process control: Cell concentration and viability were determined by Cedex HiRes (Roche, Switzerland) using the trypan blue exclusion principle. Glucose/lactate and glutamine/glutamate were measured by YSI2700 or YSI2900 Select Biochemical Analyzer (Yellow Springs Instruments, USA).
(81)
Example 4
Purification of SP-D from Mammalian Cell Lines
(82) SP-D was found be secreted from expressing cells. Cell supernatant from SP-D producing cells was collected from the bioreactor runs or other cultures and purified using Q-Sepharose chromatography run (Q-Sepharose FF; GE Healthcare) in bind and elute mode, followed by a Superdex75 chromatography run (Superdex75; GE Healthcare) performed in bind and elute mode. The chromatography was performed on FPLC systems from GE (kta Explorer, kta Avant, kta Pure).
(83) Q-Sepharose chromatography: the supernatant was sterile filtered and diluted with the same volume of a solution of 20 mM TRIS, 10 mM EDTA, pH 7.4 and loaded on the Q-Sepharose column and eluted by step elution with 600 mM NaCl. The chromatography was performed with the settings shown in TABLE 2.
(84) TABLE-US-00002 TABLE 2 Parameter Setting Equilibration and running buffer 20 mM TRIS, 50 mM NaCl, pH 7.4 Elution buffer 20 mM Tris, 600 mM NaCl, pH 7.4 Column volume/length 240 mL/11.5 cm 24000 mL Load per mL Col. Vol. 100 mL Total load 24000 ml (1:2 dilution) Flow rate (ml/min) 55 mL/min Dynamic flow rate (cm/min) 2.6 cm/min Contact time 4.4 min SP-D concentration in eluate 0.2-2 mg/ml
(85) Superdex75 chromatography: the eluate was diluted with the same volume of a 20 mM Tris buffer pH 7.4 containing 10 mM CaCl.sub.2 and loaded onto the Superdex75 column and eluted by step elution with 10 mM EDTA. The chromatography was performed with the settings shown in TABLE 3.
(86) TABLE-US-00003 TABLE 3 Parameter Setting Equilibration and running buffer 20 mM Tris, 300 mM NaCl, 5 mM CaCl.sub.2, pH 7.4 Elution buffer 20 mM Tris, 10 mM EDTA 300 mM NaCl, pH 7.4 Total load 2228 mL Column volume/length 106 mL/21.5 cm Load per mL Col. Vol. 21 mL (1:2 dilution) Flow rate (ml/min) 5 mL/min Dynamic flow rate (cm/min) 1.01 cm/min Contact time 21.2 min Elution concentration 0.5-3 mg/mL
(87) The Superdex eluate contained SP-D in >90% purity as determined by non-reducing SDS-PAGE following Coomassie blue staining (
Example 5
Activity of SP-D in a Bacterial Aggregation Assay
(88) The activity of SP-D purified from the clone H9D8-P1315-2A5 was tested in a bacterial aggregation assay. The bacterial aggregation assay was performed by a method substantially similar to the following method. E. coli (ATCC: Y1088) was streaked onto a bacterial agar plate and incubated at 37 C. overnight. A single colony was selected and used to inoculate an overnight culture, shaken at 37 C. overnight. A 1 mL bacterial culture was pipetted into four 1.5 mL centrifuge tubes and centrifuged at 4,000 rpm for 5 minutes. The supernatant was discarded, and the pellet resuspended in 1 mL buffer, (150 mM HEPES, 20 mM NaCl pH 7.4). The tubes were centrifuged at 4,000 rpm for 5 minutes and the pellet was resuspended in 7 mL buffer. Absorbance of the bacterial suspension was measured in a spectrometer at 700 nm. The bacterial suspension was adjusted to obtain an Absorbance in the range of 1.0000 to 1.1000. 1 M CaCl.sub.2 was added to the suspension to obtain a final concentration of 5 mM CaCl.sub.2. rhSP-D dilutions in placebo buffer (15 l total volume for each dilution) were created at the following concentrations: 5, 1, 0.5, 0.25, 0.1, 0 g/ml and added to cuvettes each containing 20 L of the HEPES-NaCl buffer. 600 L bacterial suspension were then added to cuvettes, and absorbance was measured every 2.5 minutes for each cuvette at 700 nm, for a total of 120 minutes.
(89) In the aggregation assay, active SP-D aggregates bacterial cells and reduces absorbance/increases transmission through the bacterial suspension.
(90) Human SP-D recombinantly expressed in further clones of H9D8 produced as described in example 2, above, was also analyzed for its activity. SP-D from all of the final selected clones tested had a similar high activity. One exemplary isolated clone is NM-H9D8(8B11) which was also used in subsequent analyses. NM-H9D8(8B11) has been deposited as AT100-rhSP-D-H9D8-P20011-8B11 with the DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH in Braunschweig (Germany) by Airway Therapeutics LLC, Cincinnati, Ohio, USA on Sep. 4, 2018 from which the deposited clone can be readily identified, and an under the accession number can be readily obtained.
Example 6
Activity of SP-D in a TLR4 Inhibition Assay
(91) Oligomeric forms of SP-D inhibit lipopolysaccharide (LPS)-induced inflammatory cell responses by preventing LPS from binding/activating the Toll-like receptor 4 (TLR4). See e.g., Yamazoe M. et al., (2008) J. Biological Chem. 283:35878-35888, which is incorporated by reference in its entirety.
(92) The activity of rhSP-D purified from the clone H9D8-P1315-2A5 to inhibit activation of the TLR4 pathway by LPS was tested. HEK-Blue hTLR4 cells (InvivoGen, San Diego, Calif., U.S.A.) were plated at a density 20000 cells/well in 384-well plates and incubated with various concentrations of SP-D for 2 hours at 37 C., 5% CO2. LPS (Escherichia coli O26:B6, L5543 Sigma Aldrich) at an EC.sub.80 concentration was added to each well, and the cells incubated for another 22 hours at 37 C., 5% CO.sub.2. TLR4 activity was measured by detaching the cells from the wells, washing the suspended cells, resuspending the cells in PBS and removing any clumps by gentle pipetting. Washed cells were transferred to a 384-well plate at a density of 20e10.sup.3 cells/well containing HEK blue detection medium (InvivoGen, San Diego, Calif., U.S.A.) that had been made up in endotoxin-free water containing 5 mM CaCl.sub.2 and 1% (v/v) BSA. Cells were incubated at 37 C. in 5% CO.sub.2 for 24 hours, and activity of TLR4 was determined by measuring the activity of a secreted embryonic alkaline phosphatase (SEAP) reporter gene using a spectrophotometer at 655 nm. An IC.sub.50 value for the SP-D was determined using nonlinear regression analysis by fitting the data to the four-parameter logistics equation with XLfit from idbs.
Example 7
Stability of SP-D from Various Sources
(93) The stability of rhSP-D from various sources was determined. The sources included rhSP-D expressed with a wild-type SP-D leader polypeptide in H9D8 cells (rhSP-D:WT), and rhSP-D expressed with a TCR leader polypeptide in H9D8 cells (rhSP-D:TCR). Solutions of rhSP-D:WT or rhSP-D:TCR in various buffers (Buffers: 1, 2, 3, or 4) were incubated at 5 C. for several weeks. The stability of rhSP-D:WT or rhSP-D:TCR in the various buffers was determined by measuring the relative distribution of rhSP-D oligomeric forms including: rhSP-D trimers/hexamers, dodecamers, higher order oligomers fuzzy balls, and very high order oligomers/aggregates. The relative distribution of rhSP-D oligomeric forms was determined by an asymmetric flow field-flow fractionation (AF4) with multi-angle light scattering (AF4-MALS) analysis using methods substantially the same as those provided in EXAMPLE 8. A mean result was determined from triplicate determinations, and +/ standard deviations were determined. The results are summarized in TABLE 4.
(94) TABLE-US-00004 TABLE 4 Relative distribution of oligomeric forms (%) SP-D Time at Very high source 5 C. Trimer/ Transition to order (buffer) (weeks) hexamer Dodecamer Fuzzy balls oligomers rhSP-D: 0 17.30 0.61 53.56 2.23 24.19 1.16 5.06 0.63 TCR 2 15.69 0.75 58.09 0.22 11.83 0.47 14.89 0.54 (1) 4 15.92 3.68 42.82 2.62 14.96 1.13 26.29 1.21 8 11.45 0.55 51.57 0.27 21.38 1.39 15.79 1.09 rhSP-D: 0 13.71 1.42 58.48 0.90 16.06 1.12 11.75 0.60 TCR 2 14.05 1.99 61.01 1.12 12.05 1.23 12.88 0.76 (2) 4 16.39 1.68 32.28 0.27 24.72 0.35 26.51 1.69 8 8.04 0.83 47.40 2.19 13.35 1.54 31.21 1.30 rhSP-D: 0 14.46 0.90 64.06 2.30 15.17 0.90 6.31 2.32 TCR 2 13.57 1.81 63.91 0.54 11.11 0.76 11.41 0.68 (3) 4 9.41 0.70 56.74 2.49 15.77 3.56 18.08 2.30 8 18.22 3.48 59.07 2.45 11.71 1.85 11.06 1.26 rhSP-D: 0 12.49 0.45 60.76 0.58 13.92 0.21 12.83 0.33 TCR 2 6.53 1.16 60.60 0.44 13.48 0.30 19.38 1.16 (4) 4 9.15 0.67 46.93 0.33 12.45 0.31 31.47 0.53 8 13.48 0.32 52.32 0.70 13.33 0.40 20.87 0.72 rhSP-D: 0 10.21 2.34 49.54 7.07 16.75 6.40 23.50 5.60 WT 2 10.61 0.95 62.05 0.14 21.24 0.84 6.10 0.64 (1) 4 9.50 0.60 60.11 0.29 21.37 0.54 9.01 0.14 8 13.80 0.48 59.05 1.49 20.15 1.56 7.00 0.38 rhSP-D: 0 9.12 1.72 65.67 5.02 18.25 3.12 6.95 3.58 WT 2 9.05 0.85 69.20 0.64 16.31 1.00 5.44 0.67 (2) 4 9.79 0.71 62.43 0.88 19.91 0.96 7.87 0.56 8 9.73 1.23 67.58 1.31 16.58 1.86 5.70 0.51 rhSP-D: 0 8.81 2.06 69.36 2.27 17.18 0.23 4.65 0.17 WT 2 7.62 0.76 69.28 1.54 19.41 1.67 3.69 0.64 (3) 4 9.21 0.58 65.79 1.56 19.96 1.22 5.04 0.93 8 12.00 0.82 66.32 0.32 17.39 0.92 4.30 0.21 rhSP-D: 0 8.58 0.51 63.43 1.26 20.48 0.69 7.51 0.07 WT 2 5.15 0.61 61.56 0.57 22.21 0.48 11.07 0.14 (4) 4 9.57 0.43 62.52 0.58 18.82 0.56 9.13 0.42 8 13.84 0.02 63.01 0.33 14.16 0.03 9.00 0.32
(95) TABLE 4 illustrates differences in the relative stabilities of the various oligomeric forms in different solutions containing rhSP-D:WT and rhSP-D:TCR. For example, with regard to the very high order oligomeric forms of SP-D, solutions of rhSP-D:WT generally had a lower percentage of such oligomers than corresponding solutions of rhSP-D:TCR. In addition, the percentage of very high order oligomers for solutions of rhSP-D:WT did not increase substantially between at least 0 week and 2 weeks, compared to corresponding solutions of rhSP-D:TCR. With regard to dodecamer oligomeric forms of rhSP-D, the percentage of such oligomers in solutions of rhSP-D:WT were generally stable between weeks 0 and 8; in contrast; the percentage of such oligomers in solutions of rhSP-D:TCR decreased between weeks 0 and 8 in corresponding solutions.
(96) These differences between solutions of rhSP-D:WT and rhSP-D:TCR were notable because both SP-D polypeptides have the same amino acid sequence and are each produced by H9D8 cells. rhSP-D:WT is initially expressed with a leader/signal polypeptide that corresponds with the leader/signal polypeptide of the wild-type human SP-D protein, and rhSP-D:TCR is initially expressed with a leader/signal polypeptide that corresponds with the leader/signal polypeptide of the human TCR protein. Each leader/signal sequence would have been cleaved from the corresponding protein shortly after or during translocation. This finding may be particularly advantageous for the production and development of stable solutions of human SP-D for the treatment of various lung disorders, especially solutions having the more active dodecamer oligomeric forms of SP-D.
Example 8
AF4-MALS Analysis
(97) An asymmetric flow field-flow fractionation with multi-angle light scattering (AF4-MALS) analysis was used to determine the relative distribution of different oligomeric forms of SP-D in a solution. AF4-MALS is a separation technique related to field flow fractionation (FFF). Unlike FFF, AF4-MALS includes a single permeable wall such that a cross-flow is caused only by a carrier liquid. The cross-flow is induced by the carrier liquid constantly exiting by way of a semi-permeable wall on the bottom of a channel.
(98) Samples were analyzed using an AF4-MALS system (Eclipse Dual Tec, Wyatt Technology Corp., Santa Barbara, Calif.) followed by UV (Ultimate 3000 variable wavelength detector, Dionex Corporation, Sunnyvale, Calif.) and MALS analysis (Dawn Heleos II detector, Wyatt Technology Corp., Santa Barbara, Calif.). A Dionex Ultimate 3000 HPLC system (Dionex Corporation, Sunnyvale, Calif.) was used to inject the samples and deliver the mobile phase to the AF4 system. The AF4 configuration used a short channel with a 350 m thick spacer (Wyatt Technology Corp., Santa Barbara, Calif.). Analysis of the data and calculations were performed using Chromeleon (Dionex Corporation, Sunnyvale, Calif.) and Astra (Wyatt Technology Corp., Santa Barbara, Calif.) software. Samples included rhSP-D purified from either H9D8 or F9 cells transfected with an expression vector encoding rhSP-D and a wild-type SP-D leader polypeptide (pHBG1Ddhfr_WT_SP-D); and H9D8 cells transfected with an expression vector encoding rhSP-D and a wild-type TCR leader polypeptide (pHBG1Ddhfr_TCR_SP-D). Samples used are listed in TABLE 5. Parameters for an AF4-MALS system with rhSP-D are shown in TABLE 6.
(99) TABLE-US-00005 TABLE 5 Batch Parent cell line Expression construct Volume (mL) S729 H9D8 pHBG1Ddhfr_TCR_SP-D 0.25 S730 F9 pHBG1Ddhfr_WT_SP-D 0.25 S731 H9D8 pHBG1Ddhfr_WT_SP-D 0.25
(100) TABLE-US-00006 TABLE 6 Start End X flow X flow time time Duration start end Step (min) (min) (min) Mode (ml/min) (ml/min) 1 0 1 1 Focus 2 1 2 1 Focus + inject 3 2 3.5 1.5 Focus 4 3.5 3.7 0.2 Elution 0.5 3 5 3.7 6.7 3 Elution 3 3 6 6.7 16.7 10 Elution 3 0.18 7 16.7 26.7 10 Elution 0.18 0.18 8 26.7 41.7 15 Elution 0.18 0 9 41.7 51.7 10 Elution 0 0 10 51.7 56.7 5 Elution + 0 0 Inject 11 56.7 57 0.3 Elution 0 0 Detector Flow: 0.5 ml/min Inject Flow: 0.2 ml/min Focus Flow: 0.5 ml/min Injection Amount: 5 g Mobile phase: 20 mM Tris, 200 mM NaCl, pH 7.4 Channel: short (145 mm) Spacer: 350 M Membrane: 10 kD PES
(101) Data using AF4-MALS was collected using a UV detector and a multi-angle light-scattering detector and analyzed to determine absolute molar mass and size of SP-D at a certain time during elution. The ratio of size to mass was indicative of the shape of the SP-D. From the size to mass ratio, it was determined that in the early stages of an elution (0-34 minutes) the SP-D molecule had a linear or rod-shape. For rod model calculations, the software assumed that the thickness of a rod-shaped particle was insignificant (0.0 nm) compared to its length. If the thickness was significant, its thickness or approximate thickness in nm is used. Rod thickness was estimated from atomic force microscopy (AFM) data, and rod lengths were determined to be consistent with AFM measurements of 1368.1 nm (R. Arroyo et al., J Mol Biol (2018) 430: 1495-1509). The later stages of the elution (34-45 minutes) for SP-D indicated that a more compact structure was being observed. A second order Debye model was employed for analysis of these stages of the elution. The second order Debye model provided better results over a wider range of molar masses, including the very large (greater than 10e6 Daltons or 50 nm RMS radius). For dodecamer oligomeric forms of SP-D, molecular weight was determined to be 520.09+/4.61 kDa (N=72 determinations).
(102) A first peak in the elution profile (Peak 1) contained SP-D trimers and hexamers based on mass calculations according to the rod model. A second peak in the elution profile (Peak 2) contained SP-D dodecamers. A third peak in the elution profile (Peak 3) contained intermediate species between SP-D dodecamers to SP-D fuzzy balls based on the intermediate MW as determined by the rod model. A fourth peak in the elution profile (Peak 4) contained a heterogeneous mass of SP-D oligomers with constant RMS radius of about 70 nm, consistent with what has been observed by AFM measurements for the fuzzy ball species. Beyond 36 minutes in the elution profile the RMS radius increases, indicative of aggregate species.
Example 9
N-glycan Profiling
(103) The N-glycosylation patterns of SP-D produced in NM-H9D8 cells (rhSP-D), and SP-D obtained from human amniotic fluid (hSP-D) were compared. The purified SP-D protein was denatured and reduced. N-glycans were released by action of N-glycanase F. Free N-glycans were tagged with a fluorophore at the reducing end, followed by a purification step employing solid phase extraction. The mixture of purified fluorescence tagged N-glycans was applied to hydrophilic interaction ultra-performance chromatography with fluorescence detection (HILIC-UPLC-FLD) coupled to electrospray ionization quadrupole time-of-flight tandem mass spectrometry (ESI-Q-TOF MS/MS). Glycans were quantified by fluorescence peak areas and identified by molecular masses in combination with fragment analyses.
(104) Fluorescence traces showed a constant retention time range for all N-glycans. Reliable structure assignment was performed through MS/MS experiments due to consistent signals throughout all samples. The glycosylation patterns of the compared SP-D proteins are shown in TABLE 7.
(105) TABLE-US-00007 TABLE 7 Percentage of carbohydrate structures including the N-glycan N-glycan hSP-D rhSP-D fucosylated glycan 91 99 glycan with bisecting N- 18 38 acetylglucosamine glycan with at least one sialic acid 52 58 glycan with 1 sialic acid 45 50 glycan with 2 sialic acids 7 8 glycan with 3 sialic acids 0 0 glycan with at least one galactose 93 92 glycan with 1 galactose 19 22 glycan with 2 galactoses 64 66 glycan with 3 galactoses 10 4 monoantennary glycan 1 1 biantennary glycan 82 90 triantennary glycan 13 5 tetraantennary glycan 1 1 glycan with at least one GalNAc 1 11 hybrid-type glycan 2 2 high mannose-type glycan 2 2
(106) From the amount of the different antennarities, the A-number can be calculated as a measure of the overall antennarity using the formula 1percent monoantennary glycans+2percent biantennary glycans+3percent triantennary glycans+4percent tetraantennary glycans=A-number. The A-numbers of rhSP-D and hSP-D are very similar with rhSP-D having an A-number of 200 and hSP-D having an A-number of 208.
(107) In some aspects, the N-glycosylation profiles of hSP-D and of rhSP-D were similar. For example, for both hSP-D and rhSP-D the percentage of carbohydrate structures including a glycan with 3 sialic acids, a monoantennary glycan, a tetraantennary glycan, a hybrid-type glycan, or a high mannose-type glycan, were the same. However, in some aspects, the N-glycosylation profiles of hSP-D and rhSP-D were dissimilar. For example, the percentage of carbohydrate structures including a glycan with bisecting N-acetylglucosamine, a glycan with 1 sialic acid, a glycan with 3 galactoses, a triantennary glycan, or a glycan with at least one GalNA, were different between the hSP-D and of SP-D.
(108) In a further analysis, the glycoprofiles of recombinant human SP-D produced in different clones of NM-H9D8 cells (rhSP-D), including two different purification batches from the NM-H9D8(8B11) clone, recombinant human SP-D produced in different clones of CHO cells (CHO-SP-D), and native SP-D obtained from human amniotic fluid (hSP-D) were compared. As shown in
(109) In addition, the linkage of the sialic acids (N-acetylneuraminic acid; NANA) in the glycan structures of SP-D was analyzed. NANA generally may be linked in an 2,3 or an 2,6 conformation to the terminal galactose residue. In human glycosylation, a mixture of 2,3- and 2,6-linked NANA is found, while hamster cells such as CHO do not produce 2,6-linked NANA. CHO as well as NM-H9D8 produced human SP-D was purified, denatured and reduced. N-Glycans were released during incubation with N-glycanase F. Free N-glycans were labeled with a fluorophore (RapiFluor, Waters) followed by purification step employing a HILIC solid phase extraction. For neuraminidase treatment, purified N-glycans were digested with neuraminidase S (NEB) for 1 h at 37 C. Neuraminidase S specifically removes 2,3-linked NANA while it does not cleave off 2,6-linked NANA. The enzyme was removed through repeated HILIC solid phase extraction. An I-class system with fluorescence detection (Waters) was used for HILIC-UPLC. The mixture of purified fluorescence tagged N-glycans were separated on an Acquity UPLC BEH Glycan column (1502.1 mm, 1.7 u, Waters) at 60 C. with a flowrate of 0.5 mL/min. 100% acetonitrile (A) and 100 mM ammoniumformiate, pH4.5, were used as the eluent system and the gradient of 22% B to 44% B in 82 min was applied. The fluorescence wavelength settings were: .sub.ex 265 nm and .sub.em 425 nm. A coupled Bruker Impact HD ESI-Q-TOF-MS(MS) was used for N-glycan identification in positive ion mode. N-glycans were identified according to molecular masses in combination with fragment analyses.
(110) The analysis revealed that SP-D from CHO shows a heterogeneous N-glycan profile between 20 and 70 min RT. Besides the three major peaks comprising biantennary N-glycans with zero (S0), one (S1) and two (S2) NANAs, higher antennary structures with up to four NANAs are detected between 53-70 min. The biantennary S1 and S2 structures as well as most of the higher antennary structures after 56 min RT are affected by neuraminidase S treatment proving the presence of 2,3-linked NANA. The overall sialylation was strongly reduced, indicating the presence of mainly 2,3-linked NANA in CHO-produced SP-D (see
(111) The term comprising as used herein is synonymous with including, containing, or characterized by, and is inclusive or open-ended and does not exclude additional, unrecited elements or method steps.
(112) The above description discloses several methods and materials of the present invention. This invention is susceptible to modifications in the methods and materials, as well as alterations in the fabrication methods and equipment. Such modifications will become apparent to those skilled in the art from a consideration of this disclosure or practice of the invention disclosed herein. Consequently, it is not intended that this invention be limited to the specific embodiments disclosed herein, but that it covers all modifications and alternatives coming within the true scope and spirit of the invention.
(113) All references cited herein, including but not limited to published and unpublished applications, patents, and literature references, are incorporated herein by reference in their entirety and are hereby made a part of this specification. To the extent publications and patents or patent applications incorporated by reference contradict the disclosure contained in the specification, the specification is intended to supersede and/or take precedence over any such contradictory material.