CTLA-4 ANTIBODIES AND USES THEREOF
20200262921 ยท 2020-08-20
Inventors
Cpc classification
A61K39/292
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C12N2710/00034
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/70
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
Abstract
Human antibodies which specifically bind to human CTLA-4, and related antibody-based compositions and molecules, are disclosed. Also disclosed are pharmaceutical compositions comprising the human antibodies, and therapeutic and diagnostic methods for using the human antibodies.
Claims
1. An isolated human antibody, or an antigen-binding portion thereof, that specifically binds to human CTLA-4, the antibody comprising: a heavy chain variable region comprising three complementarity determining regions (CDRs): V.sub.HCDR1 of SEQ ID NO: 34, V.sub.HCDR2 of SEQ ID NO: 35, and V.sub.HCDR3 of SEQ ID NO: 36; and a light chain variable region comprising three CDRs: V.sub.LCDR1 of SEQ ID NO: 25, V.sub.LCDR2 of SEQ ID NO: 26, and V.sub.LCDR3 of SEQ ID NO: 27.
2. An isolated human antibody, or an antigen-binding portion thereof, that specifically binds to human CTLA-4, the antibody comprising: a heavy chain variable region comprising three CDRs: V.sub.HCDR1 of SEQ ID NO: 37, V.sub.HCDR2 of SEQ ID NO: 38, and V.sub.HCDR3 of SEQ ID NO: 39; and a light chain variable region comprising three CDRs: V.sub.LCDR1 of SEQ ID NO: 28, V.sub.LCDR2 of SEQ ID NO: 29, and V.sub.LCDR3 of SEQ ID NO: 30.
3. An isolated human antibody, or an antigen-binding portion thereof, that specifically binds to human CTLA-4, the antibody comprising a heavy chain variable region comprising three CDRs: V.sub.HCDR1 of SEQ ID NO: 40, V.sub.HCDR2 of SEQ ID NO: 41, and V.sub.HCDR3 of SEQ ID NO: 42; and a light chain variable region comprising three CDRs: V.sub.LCDR1 of SEQ ID NO: 31, V.sub.LCDR2 of SEQ ID NO: 32, and V.sub.LCDR3 of SEQ ID NO: 33.
4. The antibody of any one of claims 1, 2 and 3, which is an IgG1 antibody.
5. The antibody of claim 4, which is an IgG1, or IgG1, antibody.
6. The antibody of any one of claims 1, 2 and 3, which is a single chain antibody (scFv).
7. The scFv of claim 6, comprising a heavy chain variable region comprising the amino acid sequence as set forth is SEQ ID NO: 8, and a light chain variable region comprising the amino acid sequence as set forth is SEQ ID NO: 2.
8. The scFv of claim 6, comprising a heavy chain variable region comprising the amino acid sequence as set forth is SEQ ID NO: 10, and a light chain variable region comprising the amino acid sequence as set forth is SEQ ID NO: 4.
9. The scFv of claim 6, comprising a heavy chain variable region comprising the amino acid sequence as set forth is SEQ ID NO: 12, and a light chain variable region comprising the amino acid sequence as set forth is SEQ ID NO: 6.
10. The antibody of claim 1, wherein the heavy chain variable region comprises: (i) the amino acid sequence set forth in SEQ ID NO: 8, (ii) an amino acid sequence encoded by a nucleic acid comprising the nucleotide sequence as set forth in or degenerate to SEQ ID NO: 7, (iii) a variable region of a human IgG heavy chain encoded by a nucleic acid comprising the V gene segment VH 3-33 of the sequence set forth in SEQ ID NO: 72, or (iv) an amino acid sequence having at least 90% identity with (i), (ii) or (iii), such as at least 95%, at least 98%, or at least 99% identity.
11. The antibody of claim 1, wherein the light chain variable region comprises: (i) the amino acid sequence set forth in SEQ ID NO: 2, (ii) an amino acid sequence encoded by a nucleic acid comprising the nucleotide sequence as set forth in or degenerate to SEQ ID NO: 1, (iii) a variable region of a human kappa light chain encoded by a nucleic acid comprising the V gene segment KV 3-20 of the sequence set forth in SEQ ID NO: 13, or (iv) an amino acid sequence having at least 90% identity with (i), (ii) or (iii), such as at least 95%, at least 98%, or at least 99% identity.
12. The antibody of claim 2, wherein the heavy chain variable region comprises: (i) the amino acid sequence set forth in SEQ ID NO: 10, (ii) an amino acid sequence encoded by a nucleic acid comprising the nucleotide sequence as set forth in or degenerate to SEQ ID NO: 9, (iii) a variable region of a human IgG heavy chain encoded by a nucleic acid comprising the V gene segment VH 1-46 of the sequence set forth in SEQ ID NO: 14, or (iv) an amino acid sequence having at least 90% identity with (i), (ii) or (iii), such as at least 95%, at least 98%, or at least 99% identity.
13. The antibody of claim 2, wherein the light chain variable region comprises: (i) the amino acid sequence set forth in SEQ ID NO: 4, (ii) an amino acid sequence encoded by a nucleic acid comprising the nucleotide sequence as set forth in or degenerate to SEQ ID NO: 3, (iii) a variable region of a human lambda light chain encoded by a nucleic acid comprising the V gene segment LV 2-23 of the sequence set forth in SEQ ID NO: 15, or (iv) an amino acid sequence having at least 90% identity with (i), (ii) or (iii), such as at least 95%, at least 98%, or at least 99% identity.
14. The antibody of claim 3, wherein the heavy chain variable region comprises: (i) the amino acid sequence set forth in SEQ ID NO: 12, (ii) an amino acid sequence encoded by a nucleic acid comprising the nucleotide sequence as set forth in or degenerate to SEQ ID NO: 11, (iii) a variable region of a human IgG heavy chain encoded by a nucleic acid comprising the V gene segment VII 1-69 of the sequence set forth in SEQ ID NO: 16, or (iv) an amino acid sequence having at least 90% identity with (i), (ii) or (iii), such as at least 95%, at least 98%, or at least 99% identity.
15. The antibody of claim 3, wherein the light chain variable region comprises: (i) the amino acid sequence set forth in SEQ ID NO: 6, (ii) an amino acid sequence encoded by a nucleic acid comprising the nucleotide sequence as set forth in or degenerate to SEQ ID NO: 5, (iii) a variable region of a human lambda light chain encoded by a nucleic acid comprising the V gene segment LV 2-14 of the sequence set forth in SEQ ID NO: 17, or (iv) an amino acid sequence having at least 90% identity with (i), (ii) or (iii), such as at least 95%, at least 98%, or at least 99% identity.
16. A host cell line that produces the antibody of any one of claims 1-12.
17. The host cell line of claim 13, which is a CIIO cell line.
18. An isolated nucleic acid comprising a nucleotide sequence encoding an amino acid sequence of the antibody of any one of claims 1-12.
19. An isolated nucleic acid comprising: (i) a nucleotide sequence chosen from SEQ ID NOs: 7, 9 and 11, (ii) a nucleotide sequence having at least 90% identity with (i), such as at least 95%, at least 98%, or at least 99% identity, (iii) a nucleotide sequence encoding an antibody heavy chain variable region amino acid sequence chosen from SEQ ID NOs: 8, 10 and 12, or (iv) a nucleotide sequence degenerate to (i), (ii) or (iii).
20. An isolated nucleic acid comprising: (i) a nucleotide sequence chosen from SEQ ID NOs: 1, 3 and 5, (ii) a nucleotide sequence having at least 90% identity with (i), such as at least 95%, at least 98%, or at least 99% identity, (iii) a nucleotide sequence encoding an antibody heavy chain variable region amino acid sequence chosen from SEQ ID NOs: 2, 4 and 6, or (iv) a nucleotide sequence degenerate to (i), (ii) or (iii).
21. A pharmaceutical composition comprising the antibody of any one of claims 1-12, and a pharmaceutically acceptable carrier.
22. The pharmaceutical composition according to claim 21, further comprising one or more additional therapeutic agents.
23. The pharmaceutical composition of claim 22, wherein the additional therapeutic agent or agents are effective to induce an immune response against tumors.
24. The pharmaceutical composition of claim 22, wherein the additional therapeutic agent or agents are chemotherapeutic agents.
25. The pharmaceutical composition of claim 22, wherein the additional therapeutic agent or agents are antibodies acting as immune checkpoint inhibitors, including but not limited to antibodies against PD-1, PD-L1, or PD-L2.
26. A method of treating a CTLA-4 associated disease in a subject, which comprises administering to the subject a therapeutically effective amount of the pharmaceutical composition of claim 21.
27. The method according to claim 26, further comprising administering to the subject one or more additional therapeutic agents.
28. The method according to claim 27, wherein the additional therapeutic agent or agents are effective to induce an immune response against tumors.
29. The method according to claim 27, wherein the additional therapeutic agent or agents are chemotherapeutic agents.
30. The pharmaceutical composition of claim 27, wherein the additional therapeutic agent or agents are antibodies acting as immune checkpoint inhibitors, including but not limited to antibodies against PD-1, PD-L1, or PD-L2.
31. The method according to claim 27, wherein the additional therapeutic agent is a vaccine, including but not limited to a GM-CSF-modified tumor vector vaccine or an antigen-loaded dendrite cell vaccine.
32. The method according to claim 26, wherein the CTLA-4 associated disease is a T cell mediated autoimmune disease.
33. The method according to claim 26, wherein the CTLA-4 associated disease is cancer.
34. The method according to claim 26, wherein the CTLA-4 associated disease is chosen from melanoma, non-small lung cancer, and prostate cancer.
35. A method of inhibiting the ability of CTLA-4 to activate a cell expressing a CTLA-4 peptide, the method comprising contacting the antibody of any one of claims 1-12 with the cell.
36. Use of the antibody of any one of claims 1-12, or the pharmaceutical composition of claim 18, for detecting in vitro or in vivo the presence of human CTLA-4 antigen in a sample for diagnosis of a CTLA-4 associated disease.
37. The use of claim 36, wherein the CTLA-4 associated disease is a T cell mediated autoimmune disease.
38. The use of claim 36, wherein the CTLA-4 associated disease is cancer.
39. The use of claim 36, wherein the CTLA-4 associated disease is chosen from melanoma, non-small lung cancer, and prostate cancer.
40. Use of the antibody of any one of claims 1-12, or the pharmaceutical composition of claim 18, for treating a CTLA-4 associated disease.
41. The use of claim 40, wherein the CTLA-4 associated disease is a T cell mediated autoimmune disease.
42. The use of claim 40, wherein the CTLA-4 associated disease is cancer.
43. The use of claim 40, wherein the CTLA-4 associated disease is chosen from melanoma, non-small lung cancer, and prostate cancer.
44. Use of the antibody of any one of claims 1-12 for the fabrication of a medicament for treating a CTLA-4 associated disease.
45. The use of claim 44, wherein the CTLA-4 associated disease is a T cell mediated autoimmune disease.
46. The use of claim 44, wherein the CTLA-4 associated disease is cancer.
47. The use of claim 44, wherein the CTLA-4 associated disease is chosen from melanoma, non-small lung cancer, and prostate cancer.
48. Use of the antibody of any one of claims 1-12 for inhibiting the ability of CTLA-4 to activate a cell expressing a CTLA-4 peptide.
49. A method for inducing, augmenting or prolonging an immune response to an antigen in a patient, comprising administering a therapeutically effective amount of a pharmaceutical composition of claim 18, wherein the pharmaceutical composition blocks binding of human CTLA-4 to human B7 ligands.
50. The method of claim 49, wherein the antigen is a tumor antigen or an antigen From a pathogen.
51. The method of claim 49, wherein the antigen is a Hepatitis B surface antigen.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
[0062] The present disclosure provides novel antibody-based therapies for treating and diagnosing diseases characterized by expression, particularly overexpression, or activation, particularly ovcractivation, of human CTLA-4 and/or related molecules. Therapies described herein employ human antibodies, particularly human monoclonal antibodies, that bind specifically to human CTLA-4. In certain embodiments, the antibodies described herein may be derived from particular heavy and light chain sequences, and/or comprise particular structural features such as CDR regions comprising particular amino acid sequences. The present disclosure also provides isolated antibodies, methods of making such antibodies, assays for detecting such antibodies, immunoconjugates and bispecific molecules comprising such antibodies, and pharmaceutical compositions comprising the antibodies. The present disclosure also relates to methods of using the antibodies to inhibit, i.e., antagonize, the ability of CTLA-4 to bind ligands or to activate cells, e.g., by inhibiting its ability to transmit a signal to the cell or to simulate, i.e. agonize, the effect of the ligand.
[0063] In order that the present disclosure may be more readily understood, certain terms are first defined. These definitions should be read in light of the remainder of the disclosure and as understood by a person of ordinary skill in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by a person of ordinary skill in the art. Additional definitions are set forth throughout the detailed description.
[0064] The articles a and an, as used herein, should be understood to mean at least one, unless clearly indicated to the contrary.
[0065] The phrase and/or, as used herein, should be understood to mean either or both of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Other elements may optionally be present other than the elements specifically identified by the and/or clause, whether related or unrelated to those elements specifically identified unless clearly indicated to the contrary. Thus, as a non-limiting example, a reference to A and/or B, when used in conjunction with open-ended language such as comprising can refer, in one embodiment, to A without B (optionally including elements other than B); in another embodiment, to B without A (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements).
[0066] As used herein, or should be understood to have the same meaning as and/or as defined above. For example, when separating items in a list, or or and/or shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as only one of or exactly one of, or, when used in the claims, consisting of, will refer to the inclusion of exactly one element of a number or list of elements.
[0067] In general, the term or as used herein shall only be interpreted as indicating exclusive alternatives (i.e. one or the other but not both) when preceded by terms of exclusivity, such as either, one of, only one of, or exactly one of.
[0068] As used herein, the phrase at least one in reference to a list of one or more elements should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase at least one refers, whether related or unrelated to those elements specifically identified.
[0069] Thus, as a non-limiting example, at least one of A and B (or, equivalently, at least one of A or B, or, equivalently at least one of A and/or B) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
[0070] As used herein, all transitional phrases such as comprising, including, carrying, having, containing, involving, holding, and the like are to be understood to be open-ended, i.e., to mean including but not limited to.
[0071] Only the transitional phrases consisting of and consisting essentially of shall be closed or semi-closed transitional phrases, respectively, as used in the field of patent law.
[0072] The term epitope means a protein determinant capable of specific binding to an antibody. Epitopes may include chemically active surface groupings of molecules such as amino acids or sugar side chains and may have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
[0073] The term antigen refers to a molecule, e.g., CTLA-4, or a portion of a molecule, capable of being specifically hound by a selective binding agent, such as an antigen binding protein (including, e.g., an antibody or immunological functional fragment thereof), and/or capable of being used in an animal to produce antibodies capable of binding to that molecule or the portion thereof. An antigen may possess one or more epitopes that are capable of interacting with different antigen binding proteins, e.g., antibodies.
[0074] The term antibody encompasses any moiety having immunoglobin-like antigen binding function. The term includes whole antibody molecules, single chain antibodies, camelid antibodies including, e.g., nanobodies, phage-display binding constructs, as well as bispecific antibodies, antibody conjugates, chimeric antibodies, and the like. A naturally occurring antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. There are two types of light chain: lambda and kappa. Each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant region. The light chain constant region is comprised of one domain, C.sub.L. The V.sub.Hand V.sub.Lregions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). As found in nature, each V.sub.H and V.sub.Lis composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system. An antibody may be monoclonal or polyclonal. In some embodiments, the antibody is a human antibody. In some embodiments, the antibody is non-human (e.g., mouse), chimeric, or humanized.
[0075] The terms antigen-binding fragment, antigen-binding portion, and antigen portion are used interchangeably herein and refer to one or more fragments of an antibody having the ability to specifically bind to an antigen (e.g., a portion of CTLA-4). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody molecule. Examples of antigen-binding portions include a Fab fragment, which is a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and CH1 domains; a F(ab).sub.2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment having the V.sub.H and CH1 domains; a Fv fragment having the V.sub.Land V.sub.H domains of a single amino acid sequence of an antibody chain; a dAb fragment (Ward et al., 1989 Nature 341:544-546), which has a V.sub.H domain; and an isolated complementary determining region (CDR).
[0076] Antigen-binding portions may be isolated fragments or may be conjugated to one or more another atoms or molecules, such as chemical or biological moieties, or fragments attached to non-traditional immunoglobulin-derived frameworks or scaffolds, including but not limited to, e.g., ankyrins, fibronectins, domain antibodies, lipocalin, small modular immuno-pharmaceuticals, maxybodies, nanobodies, protein A, affilin, gamma-crystallin and ubiquitin, and other contemplated scaffolds known to one skilled in the art.
[0077] Furthermore, although in a naturally occurring antibody molecule there are two chains having Fv domains, V.sub.Land V.sub.H, which are encoded by separate genes, they can be joined using recombinant methods, by a synthetic linker that enables them to be recombinantly expressed as a single protein chain in which the V.sub.Land V.sub.H regions form one monovalent molecule (known as single chain Fv (scFv); see e.g., Bird et al., 1988 Science 242:423-426; and Huston et al., 1988 Proc. Nad. Acad. Sci. 85:5879-5883). Such single chain antibodies are also encompassed within the term antibody. These single chain antibodies may be obtained using conventional techniques known to those of skill in the art, and may be screened for utility in the same manner as are intact antibodies.
[0078] An isolated antibody refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to a determinant that is a set of amino acids on CTLA-4 is substantially free of antibodies that bind specifically and substantially to antigens other than CTLA-4). An isolated antibody that specifically binds to a CTLA-4 protein such as human CTLA-4 may, however, have cross-reactivity to other antigens, such as to CTLA-4 molecules from other species, or to proteins having a high amount of homology to a human CTLA-4 amino acid sequence. Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals.
[0079] The terms monoclonal antibody or monoclonal antibody composition refer to a preparation of antibody molecules, all of which share a single molecular composition. A monoclonal antibody composition thus displays a single binding specificity and affinity for a particular epitope.
[0080] As used herein, the term polyclonal antibody refers to an antibody composition having a heterogeneous antibody population. Polyclonal antibodies are often derived from the pooled serum from immunized animals or from selected humans.
[0081] The term human antibody, as used herein, is intended to include antibodies having variable regions in which at least one and generally both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences. The human antibodies of the disclosure may include amino acid residues not encoded by human sequences (e.g., mutations such as substitutions introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
[0082] The term human monoclonal antibody refers to a human antibody that is also a monoclonal antibody. In some embodiments, the human monoclonal antibodies are produced by hybridoma cells, which include a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse, having a genome comprising a heavy chain transgene, generally of human origin, and a light chain transgene, generally of human origin, fused to an immortalized cell, generally of human origin.
[0083] The term recombinant human antibody, as used herein, includes human antibodies that are prepared, expressed, created or isolated by recombinant means. This includes antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom; antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma; antibodies isolated from a recombinant, combinatorial human antibody library; and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of one or more human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibody sequences may be altered by in vitro mutagenesis, or, when an animal transgenic for human Ig sequences is used, by in vivo somatic mutagenesis, so that the amino acid sequences of the V.sub.H and V.sub.L regions of the recombinant human antibodies are sequences that, while derived from and related to human germline V.sub.Hand V.sub.L sequences, may differ somewhat from those that naturally exist within the human antibody germline repertoire in vivo.
[0084] The phrases an antibody recognizing an antigen and an antibody specific for an antigen are used interchangeably herein with the term an antibody which binds specifically to an antigen.
[0085] In some embodiments, the human antibodies to human CTLA-4 described herein may block or antagonize signals transduced by the human CTLA-4. Some of these antibodies may bind to an epitope on human CTLA-4 so as to inhibit CTLA-4 from interacting with a human B7 counterreceptor. Because interaction of human CTLA-4 with human B7 transduces a signal leading to inactivation of T-cells bearing the human CTLA-4 receptor, antagonism of the interaction effectively induces, augments, or prolongs the activation of T cells bearing the human CTLA-4 receptor, thereby prolonging or augmenting an immune response. A blocking antibody refers to an antibody that reduces the binding of soluble human CTLA-4 to cell-expressed human B7 ligand by at least 10%, such as by 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99% or 99.9%, or any range that begins and ends with any of the above percentages, under conditions in which the ratio of antibody combining site to human CTLA-4 ligand binding site is greater than 1:1 and the concentration of antibody is greater than 10 nM.
[0086] As used herein, an antibody that specifically binds to human CTLA-4 refers to an antibody that binds to human CTLA-4 with a K.sub.D of 110.sup.7 M or less, such as 110.sup.8 M or less, 110.sup.9 M or less. As used herein, the term cross-reactivity refers to a situation in which an antibody or population of antibodies detectably binds riot only to its intended antigen, but also to epitopes on other antigens. This can be caused either by low avidity or specificity of the antibody or by multiple distinct antigens having identical or very similar epitopes. Cross reactivity is sometimes desirable when one wants general binding to a related group of antigens or when attempting cross-species labeling if the antigen epitope sequence is not highly conserved in evolution.
[0087] The term nucleic acid molecule, as used herein, refers to a polymer of nucleotides including, e.g., DNA molecules and RNA molecules. Such polymers of nucleotides may contain natural and/or non-natural nucleotides. A nucleic acid molecule may be single-stranded or double-stranded.
[0088] The nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. A nucleic acid is isolated or rendered substantially pure when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987). The term degenerate when applied to a reference nucleic acid molecule herein refers to a nucleic acid molecule that encodes the same amino acid sequence as the reference nucleic acid molecule, but that has a different nucleotide sequence from the reference nucleic acid molecule. For example, a nucleic acid sequence that is degenerate to SEQ ID NO:1 herein encodes the same amino acid sequence as encoded by SEQ ID NO:1, but has itself a different nucleic acid sequence than SEQ ID NO:1.
[0089] The term substantially identical, in the context of two nucleic acids or polypeptides refers to two or more sequences or subsequences that have at least about 80%, for example, at least about 85%, about 90%, about 95%, about 98%, or about 99% nucleotide or amino acid residue identity with a specific reference sequence, when compared and aligned for maximum correspondence, as measured using the following sequence comparison method and/or by visual inspection. For example, the disclosure provides nucleic acids having sequences that are substantially identical to SEQ ID NO:1, SEQ ID NO:2. The substantial identity can exist over a region of sequence that is at least about 50 residues in length, over a region of at least about 100 residues, or over a region at least about 150 residues, or over the full length of the two sequences to be compared. As described below, any two antibody sequences can only be aligned in one way, by using the numbering scheme in Kabat. Amino acids from the variable regions of the mature heavy and light chains of immunoglobulins are designated Hx and Lx respectively, where x is a number designating the position of an amino acid according to the scheme of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1987 and 1991). Kabat lists many amino acid sequences for antibodies for each subgroup, and lists the most commonly occurring amino acid for each residue position in that subgroup to generate a consensus sequence. Kabat uses a method for assigning a residue number to each amino acid in a listed sequence, and this method for assigning residue numbers has become standard in the field. Kabat's scheme is extendible to other antibodies not included in his compendium by aligning the antibody in question with one of the consensus sequences in Kabat by reference to conserved amino acids. The use of the Kabat numbering system readily identifies amino acids at equivalent positions in different antibodies. For example, an amino acid at the L50 position of a human antibody occupies the equivalent position to an amino acid position L50 of a mouse antibody. Likewise, nucleic acids encoding antibody chains are aligned when the amino acid sequences encoded by the respective nucleic acids are aligned according to the Kabat numbering convention.
[0090] A nucleic acid is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence. With respect to transcription of regulatory sequences, operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
[0091] The term vector, as used herein, refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as recombinant expression vectors (or simply, expression vectors). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector. However, other forms of expression vectors are also encompassed herein, such as phagemid vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
[0092] The term recombinant host cell (or simply host cell), as used herein, refers to a cell into which a recombinant expression vector has been introduced. Such terms refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term host cell as used herein. Recombinant host cells include, for example, transfectomas, such as CHO cells, NS/0 cells, and lymphocytic cells.
[0093] The phrase immune cell response refers to the response of immune system cells to external or internal stimuli (e.g., antigen, cytokines, chemokines, and other cells) producing biochemical changes in the immune cells that result in, for example, immune cell migration, killing of target cells, phagocytosis, production of antibodies, other soluble effectors of the immune response, and the like.
[0094] The terms T lymphocyte response and T lymphocyte activity are used here interchangeably to refer to the component of immune response dependent on T lymphocytes (e.g., the proliferation and/or differentiation of T lymphocytes into helper, cytotoxic killer, or suppressor T lymphocytes, the provision of signals by helper T lymphocytes to B lymphocytes that cause or prevent antibody production, the killing of specific target cells by cytotoxic T lymphocytes, and the release of soluble factors such as cytokines that modulate the function of other immune cells).
[0095] The term immune response refers to the concerted action of lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules (including, e.g., antibodies, cytokines, and complement) produced by the above cells or tissues, e.g., the liver, that results in selective damage to, destruction of, or elimination from the human body of invading pathogens, cells or tissues infected with pathogens, cancerous cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
[0096] Components of an immune response may be detected in vitro by various methods. For example, (1) cytotoxic T lymphocytes can be incubated with radioactively labeled target cells and the lysis of these target cells detected by the release of radioactivity, (2) helper T lymphocytes can be incubated with antigens and antigen presenting cells and the synthesis and secretion of cytokines measured by standard methods (Windhagen A; et al., 1995, Immunity 2 (4): 373-80), (3) antigen presenting cells can be incubated with whole protein antigen and the presentation of that antigen on MHC detected by either T lymphocyte activation assays or biophysical methods (Harding et al., 1989, Proc. Natl. Acad. Sci., 86: 4230-4), (4) mast cells can be incubated with reagents that cross-link their Fc-epsilon receptors and histamine release measured by enzyme immunoassay (Siraganian, et al., 1983, TIPS 4: 432-437).
[0097] Similarly, products of an immune response in either a model organism (e.g., mouse) or a human patient can also be detected by various methods that are well known to those of ordinary skill in the art. For example, (1) the production of antibodies in response to vaccination can be readily detected by standard methods currently used in clinical laboratories, e.g., an ELISA; (2) the migration of immune cells to sites of inflammation can be detected by scratching the surface of skin and placing a sterile container to capture the migrating cells over scratch site (Peters et al., 1988, Blood 72: 1310-5); (3) the proliferation of peripheral blood mononuclear cells in response to mitogens or mixed lymphocyte reaction can be measured using .sup.3H-thymidine; (4) the phagocitic capacity of granulocytes, macrophages, and other phagocytes in PBMCs can be measured by placing PBMCs in wells together with labeled particles (Peters et al., 1988 Blood 72: 1310-5)); and (5) the differentiation of immune system cells can be measured by labeling PBMCs with antibodies to CD molecules such as CD4 and CD8 and measuring the fraction of the PBMCs expressing these markers.
[0098] As used herein, the phrase signal transduction pathway or signal transduction event refers to at least one biochemical reaction, but more commonly a series of biochemical reactions, which result from interaction of a cell with a stimulatory compound or agent. Thus, the interaction of a stimulatory compound with a cell generates a signal that is transmitted through the signal transduction pathway, ultimately resulting in a cellular response, e.g., an immune response described above.
[0099] As used herein, the phrase cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and the transmission of such a signal across the plasma membrane of a cell. An example of a cell surface receptor described herein is the T cell receptor (TCR) or the B7 ligands of CTLA-4.
[0100] A signal transduction pathway in a cell can be initiated by interaction of a cell with a stimulator that is inside or outside of the cell. If an exterior (i.e., outside of the cell) stimulator (e.g., an MHC-antigen complex on an antigen presenting cell) interacts with a cell surface receptor (e.g., a T cell receptor), a signal transduction pathway can transmit a signal across the cell's membrane, through the cytoplasm of the cell, and in some instances into the nucleus. If an interior (e.g., inside the cell) stimulator interacts with an intracellular signal transduction molecule, a signal transduction pathway can result in transmission of a signal through the cell's cytoplasm, and in some instances into the cell's nucleus.
[0101] Signal transduction can occur through, e.g., the phosphorylation of a molecule; non-covalent allosteric interactions; complexing of molecules; the conformational change of a molecule; calcium release; inositol phosphate production; proteolytic cleavage; cyclic nucleotide production and diacylglyceride production. Typically, signal transduction occurs through phosphorylating a signal transduction molecule.
[0102] The term nonspecific T cell activation refers to the stimulation of T cells independent of their antigenic specificity.
[0103] The term pharmaceutically acceptable carrier, as used herein, refers to solid or liquid filler, diluent or substance which may be safely used in the administration of the antibodies described herein (for example, systemic or topical administration). Pharmaceutically acceptable carriers for systemic administration that may be incorporated in the composition of the disclosure include sugar, starches, cellulose, vegetable oils, buffers, polyols and alginic acid, among others known to one of ordinary skill in the art. Representative carriers include acacia, agar, alginates, hydroxyalkylcellulose, hydroxypropyl methylcellulose, carboxymethylcellulose, carboxymethylcellulose sodium, carrageenan, powdered cellulose, guar gum, cholesterol, gelatin, gum agar, gum arabic, gum karaya, gum ghatti, locust bean gum, octoxynol 9, oleyl alcohol, pectin, poly(acrylic acid) and its homologs, polyethylene glycol, polyvinyl alcohol, polyacrylamide, sodium lauryl sulfate, poly (ethylene oxide), polyvinylpyrrolidone, glycol monostearate, propylene glycol monostearate, xanthan gum, tragacanth, sorbitan esters, stearyl alcohol, starch and its modifications, among others known to one of ordinary skill in the art.
[0104] The terms therapeutically effective amount or effective amount refer to an amount of the pharmaceutical composition described herein effective to treat a disease or disorder in a subject. In the case of cancer, the therapeutic effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent or stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent or stop) tumor metastasis; inhibit, to some extent, tumor growth, and/or relieve to some extent one or more of the symptoms associated with the cancer. The skilled artisan would understand that the effective amount of the compound or composition administered herein varies and can be readily determined based on a number of factors such as the disease or condition being treated, the stage of the disease, the age and health and physical condition of the mammal being treated, the severity of the disease, the particular compound being administered, and the like.
[0105] As used herein, to treat means reducing the frequency of symptoms of a disease that are experienced by a patient (i.e., tumor growth and/or metastasis, or other effect mediated by the numbers and/or activity of immune cells, and the like). The term includes the administration of the compounds or agents of the present disclosure to prevent or delay the onset of the symptoms, complications, or biochemical indicia of a disease (e.g., elevation of PSA level), alleviating the symptoms or arresting or inhibiting further development of the disease, condition, or disorder. Treatment may be prophylactic (to prevent or delay the onset of the disease, or to prevent the manifestation of clinical or subclinical symptoms thereof) or therapeutic suppression or alleviation of symptoms after the manifestation of the disease.
[0106] The term CTLA-4 associated disease refers to a disease characterized by expression, particularly over-expression, or activation, particularly overactivation, of human CTLA-4.
[0107] The term subject refers to mammals such as human beings and non-human primates, as well as experimental animals such as rabbits, rats, and mice, and other animals. Animals include all vertebrates, e.g., mammals and non-mammals, such as sheep, dogs, cows, chickens, amphibians, and reptiles.
[0108] As used herein, the terms administer or administration refer to the act of injecting or otherwise physically delivering a substance as it exists outside the body (e.g., a formulation of the invention) into a patient, such as by oral, mucosal, intradermal, intravenous, subcutaneous, intramuscular delivery and/ or any other method of physical delivery described herein or known in the art. When a disease, or a symptom thereof, is being treated, administration of the substance typically occurs after the onset of the disease or symptoms thereof. When a disease or symptoms thereof, are being prevented, administration of the substance typically occurs before the onset of the disease or symptoms thereof.
[0109] The term immune checkpoint inhibitor as used herein refers to an agent involved in inhibitory pathways in the immune system that are responsible for maintaining self-tolerance and modulating the degree of immune system response to minimize peripheral tissue damage.
[0110] The term tumor antigen refers to a differentiation antigen expressed in tumors and in cells from which the tumors arose, for example melanocyte antigens gplOO, MAGE/BAGS/GAGE, Yo, GAD, MART-I/melan-A, Trp-2, Heat Shock Proteins, and many others. The tumor antigen as described herein can be targets of tumor specific T-cells found in the host. The tumor antigen may also include telomerase, which is required for the synthesis of telomeres of chromosomes and expressed in more than 85% of human cancers and in only a limited number of somatic tissues (Kim et al. (1994) Science, 266:2011-2013).
[0111] The term pathogen as used herein refers to a biological agent that causes disease to its host. For example, the pathogen can be bacteria, virus, fungi or parasites. The pathogen can also be an HIV. Various aspects of the invention are described in further detail in the following subsections.
I. Production of Human Antibodies to Human CTLA-4
[0112] Human antibodies or human monoclonal antibodies described herein can be produced by a variety of techniques, e.g., somatic cell hybridization techniques of Kohler and Milstein, Nature 256:495 (1975). Other techniques for producing monoclonal antibody can also be employed, e.g., viral or oncogenic transformation of B-lymphocytes or phage display techniques using libraries of human antibody genes.
[0113] Human monoclonal antibodies directed against CTLA-4 can also be prepared using phage display methods for screening libraries of human immunoglobulin genes. See for example: U.S. Pat. Nos. 5,223,409; 5,403,484; and 5,571,698 to Ladner et al.; U.S. Pat. Nos. 5,427,908 and 5,580,717 to Dower et al.; U.S. Pat. Nos. 5,969,108 and 6,172,197 to McCafferty et al.; and U.S. Pat. Nos. 5,885,793; 6,521,404; 6,544,731; 6,555,313; 6,582,915 and 6,593,081 to Griffiths et al., which describe such methods.
Construction of a Library and Panning Using CTLA-4
[0114] A phage display library can be formed by cloning the antibody variable region genes described herein into a phage display vector encoding a phage coat protein that is normally expressed on the outer surface of the phage. A fusion protein containing the antibody variable regions and the phase coat protein is expressed, transported to the outer surface, assembled, and displayed on the outer surface of the phage. The phage most frequently used for display libraries are bacteriophage, particularly filamentous phage, and especially phage M13, Fd or F1.
[0115] The phase display antibody library is then panned against human CTLA-4 bound to a solid phase. After surface is washed to remove nonbinding phage antibodies, bound phages were eluted for infection and production of fresh phage antibodies that are used in the next round of panning. Repeated rounds of panning lead to the enrichment of phage antibodies that are specific to CTLA-4.
[0116] The phage display library of antibodies can be made in single chain form or double chain form. Single chain antibody libraries may comprise the heavy chain or light chain of an antibody alone or the variable domain thereof. However, the members of single-chain antibody libraries are more often formed from a fusion of heavy and light chain variable domains separated by a peptide spacer within a single contiguous protein which is fused to a phage coat protein.
[0117] Diversity of antibody libraries may arise from obtaining antibody variable domain-encoding sequences from a natural source, e.g., a nonclonal population of immunized or unimmunized B cells. Alternatively, diversity can be introduced by artificial mutagenesis of nucleic acids encoding antibody chains before or after inserted into a display vector. Such mutagenesis can occur in the course of PCR or can be introduced before or after PCR.
[0118] Repertoires of antibody fragments can be constructed by combining amplified V.sub.H and V.sub.L sequences together in several ways.
Production of Human Monoclonal Antibodies to CTLA-4
[0119] Human antibodies described herein can be produced in a host cell transfectoma using, for example, a combination of recombinant DNA techniques and gene transfection methods, see e.g. Morrison, S. (1985) Science 229:1202.
[0120] For example, to express the antibodies, DNAs encoding partial or full-length light and heavy chains, can be obtained by standard molecular biology techniques (e.g., PCR amplification, site directed mutagenesis) and can be inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences. The expression vector and expression control sequences are chosen to be compatible with the expression host cell used. The antibody light chain gene and the antibody heavy chain gene can be inserted into separate vectors or, in some embodiments, both genes are inserted into the same expression vector. The antibody genes can be inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present). The light and heavy chain variable regions of the antibodies described herein can be used to create full-length antibody genes of any antibody isotype by inserting them into expression vectors already encoding heavy chain constant and light chain constant regions of the desired isotype such that the V.sub.H segment is operatively linked to the C.sub.H segment(s) within the vector and the V.sub.L segment is operatively linked to the C segment within the vector. Additionally, a recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell. The antibody chain genes can be cloned into vectors such that the signal peptide is linked in-Frame to the amino terminus of the antibody chain gene. Or alternatively, a signal peptide gene can be operatively linked to the antibody chain gene. The signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
[0121] In addition to the antibody chain genes, the recombinant expression vectors described herein may carry regulatory sequences that control the expression of the antibody chain genes in a host cell. The term regulatory sequence includes promoters, enhancers, and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes. Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology. Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). The design of the expression vector, including the selection of regulatory sequences, may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. Exemplary regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV), Simian Virus 40 (SV40), adenovirus (e.g., the adenovirus major late promoter (AdMLP)), and polyoma. In some embodiments, nonviral regulatory sequences may be used, such as the ubiquitin promoter or -globin promoter.
[0122] In addition to the antibody chain genes and regulatory sequences, the recombinant expression vectors described herein may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes. The selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Pat. No. 4,399,216, U.S. Pat. No. 4,634,665 and U.S. Pat. No. 5,179,017, all by Axel et al.). For example, the selectable marker gene may confer resistance to drugs, such as G418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced. Exemplary selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr-host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
[0123] For expression of the light and heavy chains, the expression vector(s) encoding the heavy and light chains may be transfected into a host cell by standard techniques. The various forms of the term transfection encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like. It is possible to express the antibodies described herein in either prokaryotic or eukaryotic host cells.
[0124] In some embodiments, the antibodies may be expressed in eukaryotic cells, such as mammalian host cells. Exemplary mammalian host cells for expressing the recombinant antibodies described herein include Chinese Hamster Ovary (CHO cells), including dhfr- CHO cells, described in Urlaub and Chasin, 1980 Proc. Natl. Acad. Sci. USA 77:4216-4220 used with a DH FR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp, 1982 Mol. Biol. 159:601-621, NSO myeloma cells, COS cells, and SP2 cells. In some embodiments, the GS gene expression system shown in WO 87/04462, WO 89/01036 and EP 338,841 may be used with NSO myeloma cells. When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies may be produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods.
[0125] In some embodiments, the cloned antibody genes can be expressed in other expression systems, including prokaryotic cells, such as microorganisms, e.g. E. coli (e.g., for the production of scFv antibodies), algi, as well as insect cells. Furthermore, the antibodies can be produced in transgenic non-human animals, such as in milk from sheep and rabbits or eggs from hens, or in transgenic plants. See e.g. Verma, R., et al. (1998) J. Immunol. Meth. 216:165-181; Pollock, et al. (1999) J. Immunol. Meth. 231:147-157; and Fischer, R., et al. (1999) Biol. Chem. 380:825-839.
[0126] To create an scFv gene, the V.sub.H- and V.sub.L -encoding DNA fragments may be operatively linked to another fragment encoding a flexible linker, e.g., the amino acid sequence (Gly4-Ser).sub.3, such that the V.sub.Hand V.sub.L sequences can be expressed as a contiguous single-chain protein, with the V.sub.L and V.sub.H regions joined by the flexible linker (see e.g., Bird et al.; 1988 Science 242:423-426; Huston et at., 1988 Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990 Nature 348:552-554).
[0127] Detailed procedures to generate fully human monoclonal antibodies to CTLA-4 according to some embodiments of the present disclosure are described in the Examples below. For example, dhfr-CHO cells may be transfected by electroporation with the expression vectors carrying heavy chain and light chain genes and limit-dilution plated on 96-well plates. Transfected cells may be cultured in OptiCHO medium containing Methotrexate. Cell lines expressing human monoclonal antibodies to CTLA-4 may be selected by ELISA screening wells in which cell colonies are formed.
[0128] To purify anti-CTLA-4 human monoclonal antibodies, selected CHO cell clones can be grown in two-liter spinner-flasks for monoclonal antibody purification. Supernatants can be filtered and concentrated before affinity chromatography with commercially available protein A-sepharose (e.g., Pharmacia, Piscataway, N.J.). Eluted IgG can be checked by gel electrophoresis and high performance liquid chromatography to ensure purity. The buffer solution can be exchanged into PBS, and the concentration can be determined by OD280 using 1.54 extinction coefficient. The monoclonal antibodies can be aliquoted and stored at 80 C. The antibodies can be further purified by affinity chromatography for CTLA-4 using routine techniques.
[0129] To determine if the selected human anti-CTLA-4 monoclonal antibodies bind to unique epitopes, each antibody can be biotinylated using commercially available reagents (e.g., Pierce, Rockford, Ill.). Competition studies using unlabeled monoclonal antibodies and biotinylated monoclonal antibodies can be performed using CTLA-4 coated-ELISA plates as described above. Biotinylated MAb binding can be detected with a strep-avidin-alkaline phosphatase probe.
[0130] To demonstrate binding of monoclonal antibodies to live cells expressing the CTLA4, flow cytometry can be used. For example, cell lines expressing CTLA-4 (grown under standard growth conditions) may be mixed with various concentrations of monoclonal antibodies in PBS containing 0.1% BSA and 10% fetal calf scrum, and incubated at 37 C. for 1 hour. After washing, the cells may be reacted with Fluorescein-labeled anti-human IgG antibody under the same conditions as the primary antibody staining. The samples can be analyzed by FACScan instrument using light and side scatter properties to gate on single cells. An alternative assay using fluorescence microscopy may be used (in addition to or instead of) the flow cytometry assay. Cells can be stained as described above and examined by fluorescence microscopy.
[0131] Anti-CTLA-4 human IgGs can be further tested for reactivity with CTLA-4 antigen by Western blotting. For example, cell extracts from cells expressing CTLA-4 can be prepared and subjected to sodium dodecyl sulfate polyacrylamide gel electrophoresis. After electrophoresis, the separated antigens are transferred to nitrocellulose membranes, blocked with 10% fetal calf serum, and probed with the monoclonal antibodies to be tested. Human IgG binding can be detected using anti-human IgG alkaline phosphatase and developed with BCIP/NBT substrate tablets (e.g., Sigma Chem. Co., St. Louis, Mo.).
[0132] In some embodiments, certain structural features of the human anti-CTLA-4 antibodies described herein may be used to create structurally related human anti-CTLA-4 antibodies that retain at least one functional property of the antibodies, such as the capability of binding to CTLA-4. For example, one or more CDR regions of C2, C5 and C15 can be combined recombinantly with known human framework regions and CDRs to create additional, recombinant human anti-CTLA-4 antibodies encompassed herein.
[0133] Accordingly, in some embodiments, a method for preparing an anti-CTLA-4 antibody is provided, the method comprising:
[0134] preparing an antibody comprising (1) human heavy chain framework regions and human heavy chain CDRs, wherein at least one of the human heavy chain CDRs comprises the amino acid sequence of SEQ ID NOs: 34, 35, and 36; and (2) human light chain framework regions and human light chain CDRs, wherein at least one of the human light chain CDRs comprises the amino acid sequence chosen from SEQ ID NOs: 25, 26, and 27; wherein the antibody specifically binds to CTLA-4.
[0135] preparing an antibody comprising (1) human heavy chain framework regions and human heavy chain CDRs, wherein at least one of the human heavy chain CDRs comprises the amino acid sequence of SEQ ID NOs: 37, 38, and 39; and (2) human light chain framework regions and human light chain CDRs, wherein at least one of the human light chain CDRs comprises the amino acid sequence chosen from SEQ ID NOs: 28, 29, and 30; wherein the antibody specifically binds to CTLA-4.
[0136] preparing an antibody comprising (1) human heavy chain framework regions and human heavy chain CDRs, wherein at least one of the human heavy chain CDRs comprises the amino acid sequence of SEQ ID NOs: 40, 41, and 42; and (2) human light chain framework regions and human light chain CDRs, wherein at least one of the human light chain CDRs comprises the amino acid sequence chosen from SEQ ID NOs: 31, 32, and 33; wherein the antibody specifically binds to CTLA-4.
[0137] To some embodiments, the recombinant antibodies as prepared above may comprise (1) human heavy chain variable region comprising three CDRs: V.sub.H CDR1 of SEQ ID NO: 34, V.sub.H CDR2 of SEQ ID NO: 35, and V.sub.H CDR3 of SEQ ID NO: 36; and (2) human a light chain variable region comprising three CDRs: V, CDR1 of SEQ ID NO: 25, V.sub.L CDR2 of SEQ ID NO: 26, and V.sub.L CDR3 of SEQ ID NO: 27.
[0138] In some embodiments, the recombinant antibodies as prepared above may comprise (1) human heavy chain variable region comprising three CDRs: V.sub.H CDR1 of SEQ TD NO: 37, V.sub.H CDR2 of SEQ ID NO: 38, and V.sub.H CDR3 of SEQ ID NO: 39; and (2) human light chain variable region comprising three CDRs: V.sub.L CDR1 of SEQ ID NO: 28, V.sub.L CDR2 of SEQ ID NO: 29, and V.sub.L CDR3 of SEQ ID NO: 30.
[0139] In some embodiments, the recombinant antibodies as prepared above may comprise (1) human heavy chain variable region comprising three CDRs: V.sub.H CDR1 of SEQ ID NO: 40, V.sub.H CDR2 of SEQ ID NO: 41, and V.sub.H CDR3 of SEQ ID NO: 42; and (2) human light chain variable region comprising three CDRs: V.sub.L CDR1 of SEQ ID NO: 31, V.sub.L CDR2 of SEQ ID NO: 32, and V.sub.L CDR3 of SEQ ID NO: 33.
[0140] In some embodiments, the recombinant antibodies as prepared above may be a single-chain Fv (scFv) comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 8, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 2.
[0141] In some embodiments, the recombinant antibodies have non-human framework regions (e.g., mouse).
[0142] In some embodiments, the recombinant antibodies as prepared above may be a scFv comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 10, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 4.
[0143] In some embodiments, the recombinant antibodies as prepared above may be a scFv comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 12, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 6.
[0144] In some embodiments, the scFv may optionally further comprise a flexible peptide linker between the heavy chain variable region and the light chain variable region. The peptide linker preferably consists of 1-15 amino acids and more preferably consists of 3-10 amino acids; the preferred sequence of the peptide linker is GSGGGGS.
[0145] The nucleotide and polypeptide sequences of the antibodies according to some embodiments are provided below. The amino acid and nucleotide sequences of the parental, or first screen, antibodies are provided in Table A and Table B, respectfully.
TABLE-US-00001 TABLEA AminoAcidSequencesofHeavyandLightChain VariableRegionsofAnti-CTLA-4scFvAntibodies (UnderlinedandboldedaretheCDRs) C2VH,SEQIDNO:8 QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEW VAVIWYDGSRQYYADSVKGRFTISRDDSKNTMYLQMNSLRAEDTAVY YCARGGFWGAFDIWGQGTMVTVSS C2VL,SEQIDNO:2 DVVMTQSPGTLSLSPGEGATLSCRASQHVISSYLAWYQQKPGQAPRL LVYGASSRDTGVSDRFTGSGSGTDFTLTISRLEPEDSAVYFCQQYGT SPWTFGQGTKLEIKR C5VH,SEQIDNO:10 QVQLVQSGAEVKKPGASVKVSCKASGFSFPNYYMHWVRQAPGQGLEW MGIISPTGGSRTYAQKFQGRVTITRDTSTSTVYMELSSLRSEDTAVY YCAREMYNWNGGWDYGMDVWGQGTLVTVSS C5VL,SEQIDNO:4 QSALTQSASVSGFPGQSITVSCVGTNSDVEAYDLVSWYRQHPDKSPN LLIYDNYKRPSGVSDRFSAFKSGNTASLTISGLQAEDEAYYYCCSYA GFSTWIFGAGTQLTVLG C15VH,SEQIDNO:12 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEW MGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVY YCARDTAMALFYYYYGMDVWGQGTLVTVSS C15VL,SEQIDNO:6 QSALTQPASVSGSPGQSTTISCTGTSSDVGGYNYVSWYQQHPGKAPK LMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYR SSGTPYVFGTGTKLTVLG
TABLE-US-00002 TABLEB NucleotideSequencesofHeavyandLightChain VariableRegionsofAnti-CTLA-4scFvAntibodies C2VH,SEQIDNO:7 CAGGTCCAGCTGGTGCAGTCTGGGGGAGGCGTGGTCCAGCCTGGG AGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGT AGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG GAGTGGGTGGCAGTTATATGGTATGATGGAAGTAGGCAATATTAT GCTGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACGATTCC AAGAACACGATGTATCTGCAAATGAACAGCGTGAGAGCCGAAGAC ACGGCTGTTTATTACTGTGCGAGAGGGGGATTTTGGGGGGCTTTT GATATCTGGGGCCAAGGGACAATGGTCACCGTCTCCTCA C2VL,SEQIDNO:1 GATGTTGTGATGACTCAGTCTCCAGGCACC CTGTCTTTGTCTCCAGGGGAAGGAGCCACACTCTCCTGCAGGGCC AGTCAACATGTTATCAGCAGCTACTTAGCCTGGTATCAGCAAAAA CCTGGCCAGGCTCCCAGGCTCCTCGTCTACGGTGCATCCAGTAGG GACACTGGCGTCTCAGACAGGTTCACTGGCAGTGGGTCTGGGACA GACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTCTGCG GTGTATTTCTGTCAGCAGTATGGTACATCACCGTGGACGTTCGGC CAAGGGACCAAGCTGGAGATCAAACGT C5VH,SEQIDNO:9 CAGGTGCAGCTGGTGCAATCTGGGGCTGAG GTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCAAGGCATCT GGATTCAGTTTCCCCAACTACTACATGCACTGGGTGCGACAGGCC CCTGGACAAGGGCTTGAGTGGATGGGAATAATCAGCCCTACCGGT GGTAGCAGAACGTACGCACAGAAGTTCCAGGGCAGAGTCACCATA ACCAGGGACACGTCCACGAGCACAGTCTATATGGAGTTGAGCAGC CTGAGATCTGAGGACACGGCCGTCTATTAGTGTGCGAGAGAAATG TACAACTGGAACGGAGGTTGGGACTACGGTATGGACGTCTGGGGC CAAGGAACCCTGGTCACCGTCTCCTCA C5VL,SEQIDNO:3 CAGTCTGCCCTGACTCAGTCTGCCTCCGTGTCT GGATTTCCTGGACAGTCGATCACCGTCTCCTGCGTTGGAACCAAC AGTGATGTTGAGGCTTATGACCTCGTCTCCTGGTACCGACAACAC CCAGACAAGTCCCCCAACCTCCTAATTTATGACAACTATAAGCGA CCCTCAGGGGTTTCTGATCGCTTCTCTGCCTTCAAATCTGGAAAC ACGGCCTCCCTGACCATTTCTGGCCTCCAGGCTGAAGACGAGGCT TATTATTACTGCTGCTCTTATGCAGGTTTTTCCACCTGGATCTTC GGCGCGGGGACCCAGCTCACCGTTTTAGGT C15VH,SEQIDNO:11 CAGGTGCAGCTGGTGCAGTCCGGGGCTGAGGTGAAGAAGC CTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCT TCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAG GGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGGTACAGCAA ACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACG AATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTG AGGACACGGCCGTGTATTACTGTGCGAGAGATACTGCTATGGCAC TATTCTACTACTACTACGGTATGGACGTCTGGGGCCAAGGCACCC TGGTCACCGTCTCCTCA C15VL,SEQIDNO:5 CAGTCTGCCC TGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGACCA CCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACT ATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCA TGATTTATGAGGTCAGTAATCGGCCCTCAGGGGTTTCTAATCGCT TCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTG GGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCAGCTCATATA GAAGCAGCGGCACTCCTTATGTCTTCGGAACTGGGACCAAGCTGA CCGTCCTAGGT
TABLE-US-00003 TABLE1 CDRaminoacidsequencesoflightchainand heavychainvariableregions forC2,C5andC15 CDRsequencesoflightandheavychains forMAbsC2,C5andC15 SEQ SEQ SEQ ID ID ID Chain HuMAb CDR1 NO: CDR2 NO: CDR3 NO: Light C2 RASQHV 25 GASSRDT 26 QQYGT 27 chain ISSYLA SPWTF C5 VGTNSDV 28 DNYKRPS 29 CSYAGF 30 EAYDLVS STWIF C15 TGTSSDV 31 EVSNRPS 32 SSYRSS 33 GGYNYVS GTPYVF Heavy C2 SYGMH 34 VIWYDGS 35 GGFWGAFDI 36 chain RQYYADS C5 NYYMH 37 IISPTGG 38 EMYNWNGG 39 SRTYAQK WDYGMDV C15 SYAIS 40 GIIPIFG 41 DTAMALFY 42 TANYAQK YYYGMDV
II. Therapeutic Compositions and Methods
[0146] Also provided are pharmaceutical compositions comprising at least one human monoclonal antibody and/or human antibody and/or antigen-binding fragment thereof, and a pharmaceutically acceptable carrier as described herein. Some compositions include a combination of multiple (e.g., two or more) isolated human monoclonal antibodies and/or human antibodies described herein. In some embodiments, each of the antibodies of the composition may be a monoclonal antibody or a human antibody that binds to a distinct, pre-selected epitope of human CTLA-4.
[0147] The pharmaceutical compositions of the present disclosure have in vitro and in vivo diagnostic and therapeutic utilities. In some embodiments, the present disclosure provides a method of using antibodies described herein for detecting in vitro or in vivo the presence of human CTLA-4 antigen in a sample, e.g., for diagnosing a CTLA-4 associated disease. In some methods, this is achieved by contacting a sample to be tested, along with a control sample, with an antibody of the present disclosure, under conditions that allow for formation of a complex between the antibody and human CTLA-4. Complex formation is then detected (e.g., by ELISA) in the test samples, and any statistically significant increase in the formation of complexes between the test and control samples is indicative of human CTLA-4 antigen in the test sample.
[0148] The present disclosure also provides a method of inhibiting the ability of CTLA-4 to activate a cell expressing a CTLA-4 peptide by contacting the antibody described herein with the cell. In some embodiments, a method of treating a CTLA-4 associated disease in a subject is provided, which comprises administering to the subject a therapeutically effective amount of the pharmaceutical composition described herein. Also in some embodiments, the antibody of the present disclosure can be used for Fabrication ofa medicament For treating a CTLA-4 associated disease. The CTLA-4 associated disease may include cancer, a cell proliferative disorder, a disease of the central nervous system, a disease of the blood system, an inflammatory disease, an infectious disease, an allergy, or a T-cell related disease. In some embodiments, the CTLA-4 associated disease is a T cell mediated autoimmune disease. In some embodiments, the CTLA-4 associated disease is cancer. Further in some embodiments, the CTLA-associated disease is chosen from melanoma, non-small lung cancer, and prostate cancer.
[0149] The present disclosure also provides a method for inducing, augmenting, or prolonging an immune response to an antigen in a patient, comprising administering a therapeutically effective amount of the pharmaceutical composition described herein that blocks binding of human CTLA-4 to human B7 ligands. The antigen described herein can be a tumor antigen or an antigen from a pathogen. The tumor antigen may also include the protein telomerase. Another form of tumor antigen is purified heat shock proteins (HSP) isolated from the tumor tissue itself. These heat shock proteins contain fragments of proteins from the tumor cells and these HSPs are highly efficient at delivery to antigen presenting cells for eliciting tumor immunity (Suot, R & Srivastava, P (1995) Science 269: 1585- 1588; Tamura, Y. et al. (1997) Science 278: 117-120). In some embodiments, the antigen is a Hepatitis B surface antigen.
[0150] Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. The specification for the dosage unit forms of the disclosure are dictated by and directly dependent on (a) the unique characteristics of the antibody and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art for the treatment of sensitivity in individuals.
[0151] In one embodiment, administration be intravenous, intramuscular, intraperitoneal, or subcutaneous, or administered proximal to the site of the target. If desired, the effective daily dose can be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. While it is possible for the antibody of the present disclosure to be administered alone, it is preferable to administer the compound as a pharmaceutical composition as described herein.
Combination Therapies
[0152] One or more additional therapeutic agents can be either incorporated into the pharmaceutical compositions described herein for administering to a subject or co-administered to a subject, for treatment of a CTLA-4 associated disease in the subject.
[0153] CTLA-4 blockade may be effectively combined with chemotherapeutic regimes. In these instances, it may be possible to reduce the dose of chemotherapeutic reagent administered (Mokyr, M. et al. (1998) Cancer Research 58: 5301-5304). In some embodiments, the additional therapeutic agent or agents are chemotherapeutic agents including but are not limited to mitotic inhibitors, alkylating agents, anti-metabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, anti-hormones, angiogenesis inhibitors, and anti-androgens.
[0154] In some embodiments, the additional therapeutic agents are antibodies acting as immune checkpoint inhibitors, including but not limited to rituximab, bevacizumab, trastuzumab, anti-IGF 1R antibody (e.g., CP-751,871), anti-CD40 antibody (e.g., CP-870,8930), anti-PD-1 antibody, anti-PD-1 L1 antibody, anti-PD-1 L2 antibody, and the like. In some embodiments, the additional therapeutic agent is a vaccine, including but not limited to a GM-CSF-modified tumor vector vaccine or an antigen-loaded dendrite cell vaccine. Co-administration includes administration of the therapeutic agents in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, concurrently. Sequential or concurrent administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular, subcutaneous routes, and direct absorption through mucous membrane tissues. The therapeutic agents can be administered by the same route or by different routes. For example, a first therapeutic agent (e.g., a chemotherapeutic agent) can be administered orally, and a second agent (e.g., anti-CTLA4 antibody) can be administered intravenously. Further, a first therapeutic agent of the combination selected may be administered by intravenous injection while the other therapeutic agents of the combination may be administered orally. Alternatively, for example, both the therapeutic agents may be administered by intravenous or subcutaneous injection.
EXAMPLES
[0155] The examples discussed below are intended to be purely exemplary of the invention and should not be considered to limit the invention in any way. The examples are not intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (for example, amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
Example 1
Construction of PIII Phage-Display Library
[0156] Synthesis of the Phage-Display Vector. The vector comprising a gene coding for viral coat protein PIII was synthesized (GenScript). The PIII gene is located downstream of polyclonal sites in which antibody variable region genes (both VH and VL genes) would be inserted. An enterokinase cut site is located upstream of the PIII gene and downstream of a his-tag for purification purposes.
[0157] Preparation of the cDNA Template. Human Peripheral Blood from eight donors were collected in PAXgene Blood RNA Tubes (PAXgene). PBMCs were purified using the Ficoll Hypaque method. Total RNA was prepared from PBMCs using RNeasy Midi Kit (Qiagen). First strand cDNA was synthesized from total RNA by using a SuperScript III First-Strand Synthesis kit (Invitrogen) with oligo (dT).
[0158] Amplification of Antibody Variable Region Genes. Both the VH and VL gene repertoires were PCR amplified by using the cDNA a as template. To amplify the VH and VL genes from the cDNA and plasmid template, primers were designed based on those previously published and the most recent gene segments entered in the V-Base sequence directory (de Haard (1999) J. Biol. Chem. 274:18218-18230; Ilaidaris (1999) J. Immunol. Methods 257: 185-202; Welschof (1995) J. Immunol. Methods 179: 203-214; Marks (1991) Eur. J. Immunol. 21:985-991). All primary PCR reactions were carried out with separate backward primers and combined forward primers. For the amplification of the VH gene repertoires, 12 separate PCR reactions were set up by using one of 12 different human VH (HVH) back primers and an equimolar mixture of four human heavy chain J region (HJH) forward primers. For the kappa and lamda VL genes, the same approach was used with 13 separate reactions defined by individual HV.sub.kappa or HV.sub.lamda hack primers and a mixture of HJ.sub.kappa or HJ.sub.lamda forward primers. PCRs were performed in 100 ul volumes containing 2 ul of cDNA reaction mixture, 2uM of primer solutions, 200 uM of dNTPs, 5% DMSO, and 10 ul of Pfu polymerase reaction buffer (Stratagene). After 5 min of denaturation at 94 C., 5 units of Pfu polymerase was added, followed by 30 cycles of 1 min at 94 C., 1 min at 57 C., and 1 min at 72 C., and at the end of cycling an incubation of 10 min at 72 C. After PCR, the various reactions afforded VH, V.sub.kappa, and V.sub.lamda subpools from the mixture of 8 different PBI, samples which gave three Final VH, V.sub.kappa, and V.sub.lamda pools ready For purification and assembly.
[0159] Cloning of VH or VL genes into the TA plasmid. The amplified VH and VL genes were gel-purified using QIAquick Kit (Qiagen) and cloned into a TA vector, separately. Ligation reactions were performed in 400 ul volume (NEB) containing 2 ug of T vector and 3 ug of purified VH fragments or 2.5 ug of T vector and 6 ug of purified VL fragments. The reactions were incubated at 16 C. overnight. The reaction volume was concentrated to 50 ul using a plasmid miniprep column. The ligated products were transformed into XL-1 blue E. Coli competent cells (transformation efficiency was 8.710.sup.8 cell/ug). Transformation was performed 9 times for each ligation product with each transformation using 5 ul of ligated product and 40 ul of competent cells. The mixture of ligation product and competent cells was electroporated at 25 FD, 200 , 2.5 kV using Xccll (Bio-Rad). When each electroporation was done, cells were harvested in LB medium and combined. The final volume of transformed cells was 15 ml. To calculate the size of T vector library of VH or VL, 10 ul of transformed cells were distributed evenly on a LB plate and cultured at 37 C. overnight. Colonies were counted and the size of the T vector library was calculated: 1.6210.sup.7 for VI-I genes, 1.8610.sup.7 for VL genes. All 15 ml of transformed cells were plated on 10 150-mm LB/agar plates and incubated at 37 C. overnight. Cells from plates were harvest using total 320 LB medium and 20 ml was aliquoted in 16 50-ml falcon tubes and stored at 80 C. freezer.
[0160] Construction of the scFv Library. 20 ml of each T vector library of VH genes and VL, genes was thawed and spun down to obtain cells. VH and VL genes-containing T vectors were purified using HighPure Midi plasmid purification kit (TianGen). The purified plasmid was double digested with NcoI-HF/XhoI-HF (both from NEB) for VH genes or with NheI-HF and NotI-HF (both from NEB) for VL, genes as follows: in total 750 ul reaction volume, 120 ug of above purified VII or VL genes-containing T plasmid, and 600 U NcoI-HF and 900 U XhoI-HF or 600 U NhetI-HF and 900 U NotI-HF were added. The reaction was performed at 37 C. overnight. After the digestion reaction was done, the digested plasmid was precipitated in ethanol, dissolved in 40 ul TE buffer and the insert of VH or VL genes was gel-purified. Linearized phage-vectors digested with NcoI/XhoI for VH genes or NheI-HF and NotI-HF for VL genes were prepared using the same method. VH genes were cloned between NcoI/XhoI sites, and V.sub.kappa/V.sub.lamda genes were cloned between NheI/NotI sites, such that both VH and VL genes were in frame with a PIII coat protein coding sequence in the phage display vector. VH and VL genes were cloned into the phage-display vector in two steps. The VL genes were cloned into the vector first. The ligation reaction was performed in 900 ul volume containing 5.5 ug of the linearized vector, 3.5 ug of the VL genes insert and 10,000 U of T.sub.4 ligase (NEB) at 16 C. overnight. The ligated products were purified in mini columns and eluted in 200 ul TE buffer and were electroporated into E. Coli XL-1 blue competent cells. The electroporation were done 40 times with each 5 ul of the ligated product and 40 ul of competent cells, which yielded a diversity of total about 5.310.sup.8 independent transformants. After electroporation, cells were plated on LB agar containing 2% glucose, 50 ug/ml carbenicillin, and 20 ug/ml tetracycline in 40 dishes (150 mm10 mm; Nunc) and incubated overnight at 37 C. The clones were scraped off the plates into 1600 ml of superbroth (SB) medium with 10% glycerol and aliquot and stored at 70 C. The VL genes-containing phage vector was purified and linearized plasmid by digestion with NheI-HF and NotI-HF was gel-purified. The ligation with VII genes was performed in the same way as VL genes ligation.
Example 2
Panning and Obtaining scFv Sequences Targeting CTLA-4 Extracellular Ig-V Domain
[0161] Antigen. Recombinant human CTLA-4-Fc fusion protein was purchased from R&D Systems (Catalog number 352-CTY/CF). CTLA-4 sequence from amino acid 37 to 162 was fused to immunoglobulin gamma I Fc region. The recombinant human CTLA-4-Fc fusion protein is then expressed in cultured insect cells and purified using an immobilized protein A column (Repligen Corporation).
[0162] Preparation of the PIII Phage Library. 1 L of SB medium containing 2% glucose, 50 ug/ml carbenicillin and 20 ug/ml tetracycline was inoculated overnight with about 510.sup.10 cells from the above mentioned PIII library glycerol stock. The culture was shaken at 37 C. until OD600 of about 0.5-0.7 was obtained. Then, about 410.sup.13 plaque forming units of helper phage VCSM13 and 2 ml of 0.5 M isopropylbeta-D-thiogalactopyranoside (IPTG) were added. After 30-min incubation at room temperature, the culture was diluted into 5 liters of SB medium containing 50 ug/ml carbenicillin, 20 ug/ml tetracycline, and 0.5 mM IPTG and grown for 2 h at 30 C. Kanamycin was then added to a final concentration of 70 ug/ml, and the culture was grown overnight at 30 C. On next day, the culture was spun down at a speed of 3000 g, 15 mins, 4 C., and bacteria pellets were discarded. The supernatant was transferred to clean, 500 ml centrifuge bottles, and PEG8000 (4% w/v) and NaCl (3% w/v) were added to precipitate ScFv-phage. The phage pellet was resuspended in PBS (10 mM phosphate/150 mM NaCl, pH 7.4) supplied with 2% skimmed milk or 2% BSA.
[0163] Panning. 1 ml CTLA-4 Extracellular Ig-V Domain obtained/prepared as described above was solubilized in PBS and incubated with immunotubes (Maxisorb, Nunc) overnight at room temperature. The protein concentration was 50 ug/ml for the First round panning, 10 ug/ml and 5 ug/ml for the second and third round panning, respectively. The immunotubes were blocked with PBS supplied with 4% skimmed milk (Blotto) for 1 h at room temperature. And then about 10.sup.13 cfu scFv-phages were added. After 2 h of incubation with rocking at room temperature, the unbound and nonspecifically bound scFv-phages were eluted by 10 washes of PBS/0.1% Tween-20, and 10 washes of PBS. Specifically bound scFv-phages were eluted with 1 ml elution buffer (100 mM HCl, adjusted to pH 2.2 with solid glycine and containing 0.1% BSA) for 10 min at room temperature. The elute was neutralized with 60 ul of 2 M Tris base, and was subjected to ELISA assay.
[0164] ELISA check of scFv-Phage Binding. CTLA-4 Extracellular V Domain (10 ug/ml in PBS) obtained/prepared as described above was coated on a microtiter plate at room temperature overnight, and then with Blotto. Approximately 25 ul soluble scFv-phage was added to each well, and incubated for 1 h at 37 C. After washing, 25 ul of anti-M13 mAb horseradish peroxidase (HRP) conjugate (Amersham Pharmacia) diluted 1:1000 in Blotto was added, and incubated for 30 min at 37 C. Then 50 ul tetramethylbenzidine substrate (Pierce) was added to each well, and the absorbance at 450 nm was checked.
[0165] Rescue of scFv-Phage. Positive ScFv-phage pools were used to infect freshly prepared E. coli XL1-Blue cells. The scFv-phages were then rescued, amplified, and subjected to the next round of panning. To rescue the scFv-phage, 10 ml SB (10 ug/ml tetracycline) was inoculated with fresh XL1-Blue cells, and shacked at 250 rpm, 37 C., till OD600=1. 1 ml Sc-Fv phage was added and incubated at 37 C. for 1 hour. Bacteria were spun down, plated on 2YT agar with 50 ug/ml carbenicillin, 20 ug/ml tetracycline and 2% glucose, and incubated at 30 C., overnight. On next day, bacterial cells from the plates were inoculated into 50 ml of SB medium containing 1% glucose, 50 ug/ml carbenicillin, and 10 ug/ml tetracycline (make sure OD6000.1), and shook at 250 rpm, 37 C. until OD600=0.7. Helper phage VCSM13 was added, and IPTG to a final concentration of 0.25 mM. The culture was incubated at room temperature for 30 mins, diluted into 100 ml of SB medium containing 50 ug/ml carbenicillin, 10 ug/ml tetracycline, and 0.5 mM IPTG, and grown for 2 hours at 30 C. 70 ug/ml kanamycin was added, and the culture was grown overnight (about 16 hours) at 30 C. On next day, amplified phages were precipitated.
[0166] Retrieve positive scFv sequences. Once final positive phage pools were identified after several rounds of panning, phages were transduced back into XL1-Blue. XL1_Blue SB culture (10 ug/ml tetracycline) was grown to OD600=1, then phage was added. After incubation at 37 C. for 1 hour, the culture was plated on SB agar with 50 ug/ml carbenicillin, 20 ug/ml tetracycline, 2% glucose, and incubated at 30 C., overnight. On next day, single clones were picked, miniprep-ed, and sent for sequencing.
[0167] Purification of scFvs and Affinity Measurements. Positive scFv genes were subcloned into expression vector pETFlag (derived from pET-15b, Novagen) and transformed into E. coli B834 (Novagen). The scFv expression was induced by growth in super broth containing 0.5 mM isopropyl-thiogalactoside overnight at 30 C. The Flag-tagged scFvs were purified on anti-Flag M2 affinity agorose (Sigma) from the periplasmic extracts and media. Purified monomeric scFv was prepared by Sephacryl-100 chromatography on FPLC (Amersham Pharmacia) by using PBS buffer. (Mao (1999) PNAS 96:6953-6958)). Dissociation constants (Kd) were calculated from the measured association (kon) and dissociation (koff) rate constants determined by BIAcore instrumentation and software (Amersham Pharmacia) (Medaglia (2002) Protein-Protein Interact. 255-272; Roder (1998) Methods Mol. Med. 13:531-554). In BIAcore experiments, protein antigens were immobilized on CM5 chips. After scFv binding measurements, chips were regenerated with 75 mM HCl (Table 6).
Example 3
Binding of scFv to CTLA-4
[0168] Binding to purified recombinant human CTLA-4 Binding of CTLA-4 scFv expressed (sequences shown in
Example 4
Production of Human Full Length Monoclonal Antibodies
[0169] Construction of Expression Vectors Full length nucleotide sequences coding for anti-human CTLA-4 MAbs were assembled by overlap PCR from signal peptide gene, VII or VL genes, and IgG gamma 1 constant region or kappa or lambda constant region genes. All of signal peptide gene, IgG gamma 1 constant region or kappa or lambda constant region genes were synthesized (GenScript) and had been cloned into mammalian expression vectors.
[0170] In order to construct KD6001-2 full length nucleotide sequence of IgG gamma I heavy chain isotype, the signal peptide gene, VH gene, and IgG gamma I constant region gene were PCR amplified from plasmids containing corresponding sequences by three pairs of primers, CMV promoter and KDP032, KDP034 and KDP035, and KDP020 and BGH reverse primer, respectively (see Table 2 for used primer sequences). The forward primer sequence of KDP034 for VH gene was complementary at 5 end 19 nt to the back primer sequence of KDP032 for the signal peptide gene, and the back primer sequence of KDP035 for VH gene was complementary at 5 end 21 nt to the forward primer sequence of KDP020 for the IgG gamma I constant region gene, so that the short regions of complementarity built into the ends of VH gene promoted hybridization of the various fragments. The three amplified genes were gel-purified on agarose. Approximately 20 ng of each of three genes were linked by gradient PCR using outer primers CMV promoter and BGH reverse sequence. Gradient PCRs were performed in 10 ul volumes for each annealing temperature reaction containing 2 uM of primer solutions, 200 uM of dNTPs and 0.1ul of Pfx polymerase reaction buffer (Invitrogen). An initial denaturation step for 5 min at 94 C. was followed by 30 cycles of 1 min at 94 C., 1 min at 8 various temperatures ranging from 45 C. to 60 C., and 1.5 min at 68 C., and at the end of cycling an incubation of 7 min at 68 C. After PCR, products were examined on agarose and right DNA fragments were gel-purified. The purified DNA fragment was digested with NotI and XbaI, agarose gel-purified, and ligated into the mammalian expression vector that had been cut with the same restriction enzymes. The ligated products were transformed into E. coli XL1-Blue competent cells and transformed cells were plated on LB/agar plates containing 100 ug/ml Ampicillin. The plates were cultured at 37 C. overnight. PCR were performed directly on E. coli colonies using CMV promoter and BGH reverse sequence to obtain positive clones. 3 positive colonies were picked up, inoculated into 3 ml LB, and cultured at 37 C. overnight. Plasmids were purified from 1.5 ml LB culture using Miniprep kit (Qiagen, Germany). The sequence was confirmed by sequencing using CMV promoter and BGH reverse sequence (
TABLE-US-00004 TABLE2 Primersequencesusedforvectorconstruction ofC2mAbheavychain Signal CMV CGCAAATGGGCGGTAGGCGTG peptide promoter (SEQIDNO:43) gene KDP032 GCCGGTGGCGGTGGCCACC (SEQIDNO:44) VHgene KDP034 GGTGGCCACCGCCACCGGCCA GGTCCAGCTGGTGCAGTC (SEQIDNO:45) KDP035 GCTAGGCCCCTTTGTTGATGC TGAGGAGACGGTGACCATTG (SEQIDNO:46) IgGgamma KDP020 GCATCAACAAAGGGGCCTAGC Iconstant (SEQIDNO:47) regiongene BGH AACTAGAAGGCACAGTCGAGGC reverse (SEQIDNO:48)
[0171] The same approach was used to construct KD6001-5 and KD6001-15 full length nucleotide sequence of IgG gamma I heavy chain (
TABLE-US-00005 TABLE3 Primersequencesusedforvectorconstruction ofC5andC15mAbheavychains KD6001-5VH KDP038 GGTGGCCACCGCCACCGGCCAGG gene TGCAGCTGGTGCAATC (SEQIDNO:49) KDP039 GCTAGGCCCCTTTGTTGATGCTG AGGAGACGGTGACCAGG (SEQIDNO:50) KD6001-15 KDP042 GGTGGCCACCGCCACCGGCCAGG VHgene TGCAGCTGGTGCAGTC (SEQIDNO:51) KDP039 GCTAGGCCCCTTTGTTGATGCTG AGGAGACGGTGACCAGG (SEQIDNO:50)
[0172] In order to construct KD6001-2 full length nucleotide sequence of kappa light chain isotype, the signal peptide gene, VL gene, and kappa constant region gene were PCR amplified from plasmids containing corresponding sequences by three pairs of primers, CMV promoter and KDP032, KDP036 and KDP037, and KDP010 and BGH reverse primer, respectively (see Table 4 for used primer sequences). The forward primer sequence of KDP036 for VL gene was complementary at 5 end 19 nt to the back primer sequence of KDP032 for the signal peptide gene, and the back primer sequence of KDP037 for VL gene was complementary at 5 end 21 nt to the forward primer sequence of KDP010 for the kappa constant region gene, so that the short regions of complementarity built into the ends of VL gene promoted hybridization of the various Fragments. The three amplified genes were gel-purified on agarose. Approximately 20 ng of each of three genes were linked by gradient PCR using outer primers CMV promoter and BGH reverse sequence. Gradient PCRs were performed in 10 ul volumes for each annealing temperature reaction containing 2 uM of primer solutions, 200 uM of dNTPs and 0.1 ul of Pfx polymerase reaction buffer (Invitrogen). An initial denaturation step for 5 min at 94 C. was followed by 30 cycles of 1 min at 94 C., 1 min at 8 various temperatures ranging from 45 C. to 60 C., and 1 min at 68 C., and at the end of cycling an incubation of 7 min at 68 C. After PCR, products were examined on agarose and right DNA fragments were gel-purified. The purified DNA fragment was digested with NotI and XbaI, agarose gel-purified, and ligated into the mammalian expression vector that had been cut with the same restriction enzymes. The ligated products were transformed into E. coli XL1-Blue competent cells and transformed cells were plated on LB/agar plates containing 100 ug/ml Ampicillin. The plates were cultured at 37 C. overnight. PCR were performed directly on E. coli colonies using CMV promoter and BGH reverse sequence to obtain positive clones. 3 positive colonies were picked up, inoculated into 3 ml LB, and cultured at 37 C. overnight. Plasmids were purified from 1.5 ml LB culture using Miniprep kit (TianGen Corp., China). The sequence was confirmed by sequencing using CMV promoter and BGH reverse sequence.
TABLE-US-00006 TABLE4 Primersequencesusedforvectorconstruction ofC2mAblightchain C2VLgene KDP036 GGTGGCCACCGCCACCGGCGAT GTTGTGATGACTCAGTC (SEQIDNO:52) KDP037 GACAGATGGAGCGGCCACAGTA CGTTTGATCTCCAGCTTGG (SEQIDNO:53) kappa KDP010 ACTGTGGCCGCTCCATCTGTC constant (SEQIDNO:24) region BGH AACTAGAAGGCACAGTCGAGGC gene reverse (SEQIDNO:48)
[0173] To construct KD6001-5 and KD6001-15 full length nucleotide sequences of lambda constant region isotype, lambda constant region gene was PCR amplified from the plasmid containing the lambda constant region gene using primers KDP108 and M13F (-21) sequence. For VL genes PCR amplified, primers KDP040 and KDP106 were used for KD5001-5 VL gene, primers KDP043 and KDP107 were used for KD5001-15 VL gene (see Table 5 for primer sequences). The signal peptide gene was the same as that used for KD6001-2 IgG gamma I construction.
TABLE-US-00007 TABLE5 Primersequencesusedforvectorconstruction ofC5andC15mAblightchains KD6001-5VL KDP040 GGTGGCCACCGCCACCGGCC gene AGTCTGCCCTGACTCAGTC (SEQIDNO:54) KDP106 GGGTTGGCCTTGGGCTGACC TAAAACGGTGAGCTGG (SEQIDNO:55) KD6001-15VL KDP043 GGTGGCCACCGCCACCGGCC gene AGTCTGCCCTGACTCAGC (SEQIDNO:56) KDP107 GGGTTGGCCTTGGGCTGACC TAGGACGGTCAGCTTGG (SEQIDNO:57) lambdaconstant KDP108 GGTCAGCCCAAGGCCAACCC regiongene (SEQIDNO:58) M13F TGTAAAACGACGGCCAGT (21) (SEQIDNO:59)
[0174] Generation of mAb-producing CHO cells The parent CHO DG44 cells (which are dhfr.sup.) were cultured in CD DG44 medium containing 8 mM L-glutamine and 5 ug/ml recombinant human insulin (rINS). Stable transfected cells were cultured in OptiCHO medium containing 8 mM L-glutamine, ug/ml rINS and various concentrations of methotrexate (MTX).
[0175] The expression vectors for the heavy chains and light chains of mAbs were co-transfected into CHO DG44 cells by electroporation method. Pools of stable transfected clones were made by culturing in the selection medium containing 20 nM of MTX. Then stable pools were further selected with iteratively increasing concentrations of MIX up to 10 uM in order to amplify expression genes. At this stage, single clones were obtained by plating the cells with amplified expression genes at low density in 96-well plates. After an appropriate period of growth, those wells with single clones were screened for mAb production using ELISA with anti-Fc antibodies (Wood et al., 1984, Nucleic Acids Research 12:3937). Clones with high levels of mAb-producing were further expanded.
Example 5
Anti-CTLA-4 Full Length mAbs Binding to CTLA-4
[0176] Binding to purified recombinant human CTLA-4 (rhCTLA-4) Binding of CTLA-4 mAbs to purified recombinant human CTLA-4 (Purchased from R&D Systems, Catalog number 352-CTY/CF) was shown by ELISA using standard methods and procedures. Microtiter plates coated with purified CTLA-4 were incubated with varying concentration of C2 and C5 mAbs, and then developed with goat anti-human IgG F(ab), conjugated to alkaline phosphatase. The data demonstrate dose-dependent binding of C2 (
[0177] Kinetic analysis of binding to rhCTLA-4. Dissociation constants (Kd) of C2 and C5 mAb were calculated from the measured association (kon) and dissociation (koff) rate constants determined by Fortbio instrumentation and software (Pall Corp) (Table 6). C2 and C5 mAbs were diluted in the binding buffer to 20 ug/ml and sensors of eight were soaked in the diluted mAb solution for 5 min for antibody capturing. The sensors were then blocked in the blocking solution for 5 min. Recombinant human CTLA-4-Fc protein was two-fold serial diluted in the blocking solution to 7 different concentrations, range from 100 nM to 1.6 nM. Kinetic association assays were started by putting antibody-capturing sensors into above serial diluted CTLA-4-Fc solutions. One sensor was immersed into the blocking solution as negative control. After 5 min binding, all sensors were moved to the blocking solution to start kinetic dissociation assays. Assays were stopped after 7 min. Results were shown in Table 6.
TABLE-US-00008 TABLE 6 Kinetic analysis of C2 and C5 mAb binding to rhCTLA-4 Clones kon (1/Ms) koff (1/s) KD (M) C2 5.5 10.sup.5 4.8 10.sup.4 8.6 10.sup.10 C5 2.8 10.sup.5 6.1 10.sup.4 2.2 10.sup.9
Example 6
[0178] C2 mAb Blocking of B7-1 Ligand Binding to CTLA-4 CTLA-4 inhibits T cell activation by binding to co-activators, CD80 (B7-1) and CD86 (B7-2). To determine if the disclosed mAbs and B7-1 or B7-2 may inhibit each other's binding to CTLA-4, an in vitro assay was conducted to test if C2 mAb was capable of inhibiting the binding of B7-1 to CTLA-4. Ipilimumab (Bristol-Myers Squibb, USA) was used as a positive control.
[0179] Human recombinant CTLA-4-Fc (2 ug/ml) in 50 ul of 20 mM NaHCO3, pH 9.7 was coated on 96-well plates and incubated at 4 C. overnight. After rhCTLA-4-Fc was removed, the plates were blocked with 100 ul of 3% BSA in wash/dilution buffer (TBS buffer, pH 7.0 containing 0.05% Tween-20) at 37 C. for 2 hours. Human recombinant B7-1-IgG1 Fc fusion protein (R&D Systems Inc., USA) was biotin-labeled using a biotin protein labeling kit (Herochem Inc., China). 10 ng/ml of the biotin-B7-1 fusion protein was mixed with different concentrations of C2 mAb or Tpilimumab in binding buffer (1% BSA in TBST). The mixtures (50 ul/well) were added to rhCTLA-4-Fc coated plates and incubated at 37 C. for 2 hours. The solution was decanted, and the plates were washed 3 times with wash buffer. Alkaline phosphatase conjugated streptavidin (Herochem Inc., China) was diluted 2500-fold in binding buffer and add 50 ul/well to plates. After the plates were incubated at 37 C. for 2 hours, the AP-streptavidin solution was decanted, and the plates were washed 6 times with wash buffer. Alkaline phosphatase substrate pNpp solution was added 50 ul/well to plates. The plates were incubated at 37 C. for 20 min and read at 405 nm using a Bio-Rad microplate reader. Results are shown in
Example 7
PBMC IL-2 Production Enhanced by C2 mAb
[0180] Upon cell activation, the lymphocyte secrets the cytokine interleukin-2 (1L-2). CTLA-4 suppresses 1 cell activity by decreasing the production of cytokine IL-2. In order to test the function of the antibodies disclosed herein to act as positive regulators of T cell activation, we performed the following experiments to quantify the enhancement of T cell IL-2 production upon CTLA-4 signal blockade with the disclosed antibodies.
[0181] Fresh human peripheral blood mononuclear cells (PBMCs) were prepared using Accuspin, and stimulated with various concentration of phytohemagglutinin (PHA) (Sigma). In a 96-well plate PBMC at a concentration of 110.sup.6 cells/ml were stimulated in 200 ul of RPMI 1640 medium containing L-glutamine, MEM non-essential amino acids, 25 mM Hepes and 10% FBS with 0.1 ug/ml, 1 ug/ml and 10 ug/ml of PHA, respectively. PBMC were cultured at 37 C. for 2 days. The cells were washed and resuspended in the medium to 510.sup.6cells/ml. Raji cells (ATCC), a NK-resistent target cell line, was used to measure the intrinsic NK activity of the IL-2. The Raji cells were treated with 25 ug/ml of mitomycin C (Roche) for one hour at 37 C. Raji cells were washed 4 times with the medium and diluted in the medium to 110.sup.6cells/ml. PBMC (510.sup.5 cells) stimulated with various concentrations of PHA, Raji cells (110.sup.5 cells) and C2 mAb at the concentration of 25 ug/ml were added to 96-well culture plates and plates were incubated at 37 C. for 48 hours to 96 hours. Culture supernatants were collected from the plate at the incubation time of 48 hours, 72 hours and 96 hours. Harvested supernatants were frozen for later determination of IL2 amount using standard ELISA methods and procedures.
[0182] Results from above experiments are shown in
Example 8
C2 mAb Binding to rhCTLA-4 Treatment Enhances Antibody Responses to a Hepatitis B Surface Antigen (HBsAg).
[0183] Hepatitis B surface antigen (HBsAg) can immunize primates and generate strong neutralizing antibodies against HBsAg in those primates. CTLA-4 is a negative regulator of such in vivo immune responses. Accordingly, the ability of the C2 mAb disclosed herein to enhance antibody responses to a HBsAg vaccine was examined in cynomolgus monkeys. Two groups of 4 monkeys of each (two males and two females) were administered intravenously with a control human IgG1 (anti-Her2 mAb) or anti-CTLA-4 mAb C2 at a dose of 10 mg/kg on days 1 and 29. Antibodies were prepared at 5 mg/ml in PBS and sterilized using 0.22 um filters. All monkeys were vaccinated intramuscularly with 10 ug/each of HBsAg (Engerix-B, commercially available from GlaxoSmithKline, China) on days 2 and 30. Plasma levels of antibody to HBsAg were measured on days 1, 35 and 49 using standard ELISA methods and procedures. Briefly, HBsAg was diluted in 200 mM NaHCO3 (pH9.6) to 2 ug/ml and was coated on 96-well microplates at 4 C. overnight. HBsAg was removed and plates were washed three times with TBST (IBS containing 0.05% Tween-20). Plates were blocked with 100 ul of 3% BSA in TBST at 37 C. for 1 hour. For anti-HBsAg antibody titer assays, plasma mixtures were used. The plasma mixtures were prepared using 5 ul from each monkey in the same group. Mixtures were diluted in binding buffer (1% BSA in TBST) to 100, 500, 2500 and 12500 fold. After blocking buffer was removed, the mixtures were added to 96-well plates and incubated at 37 C. for 2 hours. To compare amounts of anti-HBsAg antibodies, each monkey's plasma was diluted 1000 fold in binding buffer and was added to 96-well plates and incubated at 37 C. for 2 hours. The plasma mixture from day-49 of C2 mAb treated monkeys was used as a standard reference, anti-HBsAg antibody concentration was set at 2500 units/ml. After 2-hour incubation, all plasma was removed and plates were washed 3 times with TBST. 2000-fold diluted goat anti-monkey IgG was added to plates and incubated at 37 C. for 2 hours. Plates were washed 6 times and 50 ul/well of pNpp substrate (Southern Biotech, China) was added and incubated at room temperature, and then plates were read at 405 nm using a microplate reader (Bio-Rad). All samples were tested in duplicate. The titer assay results and amount comparison results were shown in