ANTI- ISOASP7 AMYLOID ß (Aß) ANTIBODIES AND USES THEREOF
20200264197 · 2020-08-20
Inventors
- Anke PIECHOTTA (Halle (Saale), DE)
- Kathrin GNOTH (Halle (Saale), DE)
- Holger CYNIS (Halle (Saale), DE)
- Jens-Ulrich Rahfeld (Seegebiet Mansfelder Land, DE)
- Stephan SCHILLING (Halle (Saale), DE)
- Hans-Ulrich Demuth (Halle (Saale), DE)
Cpc classification
A61K39/39583
HUMAN NECESSITIES
G01N33/543
PHYSICS
C07K2317/92
CHEMISTRY; METALLURGY
C07K16/44
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention can be included in the field of medicine. Specifically, the present invention provides antibodies and antigen-binding fragments thereof which can bind isoAsp7 amyloid (A) and a pharmaceutical composition comprising the antibodies or antigen-binding fragments thereof. IsoAsp7 A can be found in plaques of Alzheimer's patients and is thus a suitable target for the treatment and/or prevention of A-related diseases such as Alzheimer's disease. Thus, the antibodies, antigen-binding fragments thereof and the pharmaceutical composition comprising either can be used to treat and/or prevent neurodegenerative diseases. Further, the present invention provides hybridoma cell lines, the use of the antibodies or antigen-binding fragments thereof for the diagnosis and/or prognosis of a neurodegenerative disease and a method for detecting isoAsp7 A in an isolated sample.
Claims
1. A pharmaceutical composition comprising: (i) an antibody or antigen-binding fragment thereof which specifically binds to L-isoAsp7 amyloid (A) wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8 and the K.sub.D is determined by surface plasmon resonance at 25 C.; and (ii) a pharmaceutically acceptable carrier or diluent.
2. An antibody or antigen-binding fragment thereof which specifically binds to L-isoAsp7 A for use as a medicament, wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8 and the K.sub.D is determined by surface plasmon resonance at 25 C.; or the pharmaceutical composition according to claim 1 for use as a medicament.
3. An antibody or antigen-binding fragment thereof which specifically binds to L-isoAsp7 A for use in the treatment and/or prevention of a neurodegenerative disease, wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8 and the K.sub.D is determined by surface plasmon resonance at 25 C.; or the pharmaceutical composition according to claim 1 for use in the treatment and/or prevention of a neurodegenerative disease.
4. The pharmaceutical composition according to claim 1, the antibody or antigen-binding fragment thereof for use according to any one of claims 2-3 or the pharmaceutical composition for use according to any one of claims 2-3, wherein the antibody or antigen-binding fragment thereof comprises a light chain variable region (VL) and a heavy chain variable region (VH), wherein said VL comprises LCDR1, LCDR2 and LCDR3 polypeptides and VH comprises HCDR1, HCDR2 and HCDR3 polypeptides which are selected from the group consisting of: (a) LCDR1 is KSSQSLLNSRNRKNYLA (SEQ ID NO: 9), LCDR2 is WASTRDS (SEQ ID NO: 11), LCDR3 is KQSYNLRT (SEQ ID NO: 13), HCDR1 is GFSLTSYGVH (SEQ ID NO: 14), HCDR2 is ALWASGNTDYSSTLMS (SEQ ID NO: 15), and HCDR3 is DRGILTGGYFDV (SEQ ID NO: 17); (b) LCDR1 is KSSQSLFNSRTRKNYVA (SEQ ID NO: 27), LCDR2 is WASTRES (SEQ ID NO: 29), LCDR3 is KQSYNLRA (SEQ ID NO: 30), HCDR1 is GFTFTDYYMS (SEQ ID NO: 32), HCDR2 is FIRNKANGYTTEYSASVKG (SEQ ID NO: 34), and HCDR3 is DIPTIMDY (SEQ ID NO: 35); (c) LCDR1 is KSSQSLLNX.sub.1RX.sub.2RKNYLA (SEQ ID NO: 10), LCDR2 is WASTRX.sub.3S (SEQ ID NO: 12), LCDR3 is KQSYNLRT (SEQ ID NO: 13), HCDR1 is GFSLTSYGVH (SEQ ID NO: 14), HCDR2 is X.sub.4LWASGX.sub.5TDYX.sub.6SX.sub.7LMS (SEQ ID NO: 16), and HCDR3 is DRGIX.sub.8TGGYFDV (SEQ ID NO: 18), wherein X.sub.1 is S or R, X.sub.2 is N or T, X.sub.3 is D or E, X.sub.4 is A or V, X.sub.5 is N or R, X.sub.6 is S or N, X.sub.7 is T or A, and X.sub.8 is L, T or M; and (d) LCDR1 is KSSQX.sub.1LX.sub.2NSRTRKNYX.sub.3A (SEQ ID NO: 28), LCDR2 is WASTRES (SEQ ID NO: 29), LCDR3 is X.sub.4QSYNLRX.sub.5 (SEQ ID NO: 31), HCDR1 is GFTFX.sub.6DYYMX.sub.7 (SEQ ID NO: 33), HCDR2 is FIRNKANGYTTEYSASVKG (SEQ ID NO: 34), and HCDR3 is DIPTIMDY (SEQ ID NO: 35), wherein X.sub.1 is S or N, X.sub.2 is F or L, X.sub.3 is V or L, X.sub.4 is K or M, X.sub.5 is A or T, X.sub.6 is T or S, and X.sub.7 is S or N.
5. The pharmaceutical composition according to claim 1, the antibody or antigen-binding fragment thereof for use according to any one of claims 2-3 or the pharmaceutical composition for use according to any one of claims 2-3, wherein the antibody or antigen-binding fragment thereof comprises a light chain (LC) and a heavy chain (HC), wherein said LC and HC are polypeptides selected from the group consisting of: (a) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 22; (b) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 39; (c) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 39; and (d) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 22.
6. The pharmaceutical composition according to any one of claims 1-5, the antibody or antigen-binding fragment thereof for use according to any one of claims 2-5 or the pharmaceutical composition for use according to any one of claims 2-5, wherein the antibody or antigen-binding fragment thereof is a monoclonal antibody or antigen-binding fragment thereof.
7. The pharmaceutical composition according to any one of claims 1, 2, 3, 4 and 6, the antibody or antigen-binding fragment thereof for use according to any one of claims 2, 3, 4 and 6 or the pharmaceutical composition for use according to any one of claims 2, 3, 4 and 6, wherein the antibody or antigen-binding fragment thereof is a humanized antibody or antigen-binding fragment thereof.
8. The pharmaceutical composition according to claim 1 or the pharmaceutical composition for use according to any one of claims 2-7, wherein the composition further comprises donepezil, gelantamine, memantine, rivastigmine, a beta secretase inhibitor, a gamma secretase modulator, an additional antibody selected from the group of pan-A specific antibodies like aducanumab, bapineuzumab, crenezumab, ganteneumab, solanezumab and/or an antibody with specificity to posttranslational phosphorylated or nitrated A peptides.
9. The antibody or antigen-binding fragment thereof for use according to any one of claims 3-8 or the pharmaceutical composition for use according to any one of claims 3-8, wherein the neurodegenerative disease is selected from the list consisting of mild cognitive impairment, clinical or preclinical Alzheimer's disease, neurodegeneration in Down Syndrome, clinical and preclinical amyloid angiopathy, progressive supranuclear palsy, multiple sclerosis, Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotrophic lateral sclerosis), dementia related to Adult Onset Diabetes, senile cardiac amyloidosis and muscular degeneration.
10. The antibody or antigen-binding fragment thereof for use according to any one of claims 3-9 or the pharmaceutical composition for use according to any one of claims 3-9, wherein the neurodegenerative disease is clinical or preclinical Alzheimer's disease.
11. Use of an antibody or antigen-binding fragment thereof which specifically binds to L-isoAsp7 A for the diagnosis and/or prognosis of a neurodegenerative disease, wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8 and the K.sub.D is determined by surface plasmon resonance at 25 C.
12. A method for detecting isoAsp7 A comprising a step wherein an isolated sample is put into contact with an antibody or antigen-binding fragment thereof which specifically binds to L-isoAsp7 A, wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8 and the K.sub.D is determined by surface plasmon resonance at 25 C.
13. The method according to claim 12, wherein the isolated sample is an isolated serum, cerebrospinal fluid or tissue sample.
14. A method of determining the percentage of A peptide comprising L-isoAsp at position 7 of SEQ ID NO: 1 in an isolated sample comprising: (a) quantifying the amount of L-isoAsp-comprising peptide through the use of a sandwich immunoassay, wherein the immobilized capture antibody or antigen-binding fragment thereof specifically binds to L-isoAsp7 A, and the detection antibody is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1; (b) quantifying the total amount of A through the use of a sandwich immunoassay, wherein the immobilized capture antibody or antigen-binding fragment thereof is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1, and the detection antibody is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1; and (c) determining the percentage value by using the values obtained in steps (a) and (b), wherein the K.sub.D of the interaction between the antibody that specifically binds to L-isoAsp7 A and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the same antibody and SEQ ID NO: 8 and the K.sub.D is determined by surface plasmon resonance at 25 C.
15. The method according to claim 14, wherein the isolated sample is an isolated serum, cerebrospinal fluid or tissue sample.
Description
FIGURES
[0012]
[0013]
[0014]
[0015]
[0016] A50.8 M isoD7-A(1-18) was titrated to 2.5 M K11
[0017] B56.7 M A(1-18) was titrated to 11.9 M K11
[0018] C238 M isod7-A(1-17) was titrated to 11.9 M K11
[0019] The top graphs show raw data of heat pulses resulting from titration of antigen in the calorimetric cell with antibody K11. The bottom graphs show the integrated heat pulses, normalized per mol of injectant as a function of molar ratio.
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032] AThe time the animals spent in the open arms was summed up in order to calculate % in exposed area.
[0033] BArm entries are defined as presence of the complete animal (except tail) in the open arm.
[0034] Sample size consisted of at least 9 animals per group (some groups contained one or two more animals). Statistical analysis was performed using Bonferroni's Multiple Comparison Test. * means p0.05. ** means p0.01. *** means p0.001.
[0035]
[0036]
[0037]
[0038]
SUMMARY OF THE INVENTION
[0039] Targeting of isoAsp7 A in AD patients is a new promising approach, because antibodies will solely bind modified and aged A peptides. Consequently, freshly synthesized circulating A in the periphery will be largely unaffected, thereby preventing loss of active antibodies via A binding in e.g. blood or CSF. This possibly allows a reduction of antibody dosage. Furthermore, the epitope density of isoAsp7-modified species in A deposits is low in comparison to native A variants. This leads to a better antibody distribution within the brain tissue and a lower reactivity with amyloid deposits in the walls of blood vessels in the central nervous system (cerebral amyloid angiopathy, CAA), thereby preventing ARIA.
[0040] Here, we show that treatment of transgenic mice with Alzheimer-pathology with an isoAsp7-A specific antibody results in attenuation of disease pathology. Surprisingly, we observed that application of a highly isoAsp-specific antibody does not only reduce isoAsp7-A in these mice but also shows an unexpected reduction of amyloid plaques and non-isoAsp7-modified A (see
[0041] Moreover, we also show that the isoAsp7-modified A is, compared to total A, an underrepresented species, making up only 4% in mice (
[0042] Surprisingly, an antibody of the present invention was able to remove more fibrillary A than 3D6 (an antibody that binds to residues 1-5 of an A42 peptide without an L-isoAsp 7 modification) as shown in
[0043] The present invention thus provides an antibody or antigen-binding fragment thereof which specifically binds to isoAsp7 amyloid (A(62 ), wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8. The present invention also provides a pharmaceutical composition comprising the antibody or antigen-binding fragment thereof of the present invention and a pharmaceutically acceptable carrier or diluent. Also, the present invention encompasses the use of the antibody or antigen-binding fragment thereof of the present invention or the pharmaceutical composition of the present invention as a medicament, specifically for the treatment and/or prevention of a neurodegenerative disease. Further, the present invention provides the use of the antibody or antigen-binding fragment thereof of the present invention for the diagnosis and/or prognosis of a neurodegenerative disease. The present invention also provides hybridoma cell-lines and a method for detecting isoAsp7 A comprising a step wherein an isolated sample is put into contact with the antibody or antigen-binding fragment thereof of the present invention. Finally, the present invention provides a method of determining the percentage of peptides in an amyloid plaque which comprises an L-isoAsp at position 7 of SEQ ID NO: 1.
DETAILED DESCRIPTION OF THE INVENTION
Antibodies
[0044] In a first aspect, the present invention provides an antibody or antigen-binding fragment thereof which specifically binds to isoAsp7 amyloid (A), wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8. In a preferred embodiment, the K.sub.D of the interaction between the antibody and SEQ ID NO: 48 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8. Preferably, the K.sub.D is determined by surface plasmon resonance or isothermal titration calorimetry. More preferably, the K.sub.D is determined by surface plasmon resonance at 25 C.
[0045] In an alternative aspect, the present invention provides an antibody or antigen-binding fragment thereof which specifically binds to pE3 (contains L-pyroglutamate at position 3) isoAsp7 amyloid (A) wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 48 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8.
[0046] SEQ ID NO: 44 is isoAsp7 A (1-18) and has the following sequence:
TABLE-US-00001 DAEFRHXSGYEVHHQKLV,
wherein X is L-isoAsp.
[0047] SEQ ID NO: 8 is A (1-18) and has the following sequence:
TABLE-US-00002 DAEFRHDSGYEVHHQKLV
[0048] SEQ ID NO: 48 is pE3-isoD7-A(3-18) and has the following sequence:
TABLE-US-00003 ZFRHXSGYEVHHQKLV,
wherein X is L-isoAsp and Z is L-pyroglutamate.
[0049] As used herein, the term antibody refers to a protein comprising at least one immunoglobulin variable domain sequence. The term antibody includes, for example, full-length and mature antibodies. For example, an antibody can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL). In another example, an antibody molecule includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab, F(ab)2, Fc, Fd, Fd, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor. Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies. The antibodies of the present invention can be monoclonal or polyclonal. The antibody can also be a human, humanized, CDR-grafted, or in vitro generated antibody. The antibody can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4. The antibody can also have a light chain chosen from, e.g., kappa or lambda.
[0050] Examples of antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883); (viii) a single domain antibody. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
[0051] The term antibody includes intact molecules. Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function or complement function).
[0052] Antibody molecules can also be single domain antibodies. Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine. According to another aspect of the invention, a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
[0053] The VH and VL regions can be subdivided into regions of hypervariability, termed complementarily determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR or FW).
[0054] The extent of the framework region and CDRs has been precisely defined by a number of methods (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; and the AbM definition used by Oxford Molecular's AbM antibody modeling software). See, generally, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg).
[0055] The terms complementarity determining region, and CDR, as used herein refer to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. In general, there are three CDRs in each heavy chain variable region (HCDR1, HCDR2, HCDR3) and three CDRs in each light chain variable region (LCDR1, LCDR2, LCDR3).
[0056] The precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (Kabat numbering scheme), Al-Lazikani et al., (1997) JMB 273,927-948 (Chothia numbering scheme). As used herein, the CDRs defined according the Chothia number scheme are also sometimes referred to as hypervariable loops.
[0057] The terms monoclonal antibody as used herein refers to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. A monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
[0058] The antibody or antigen-binding fragment thereof can be a polyclonal or a monoclonal antibody. In other embodiments, the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods. Preferably, the antibody or antigen-binding fragment thereof is a monoclonal antibody or antigen-binding fragment thereof.
[0059] Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al. International Publication WO 92/20791; Markland et al. International Publication No. WO 92/15679; Breitling et al. International Publication WO 93/01288; McCafferty et al. International Publication No. WO 92/01047; Garrard et al. International Publication No. WO 92/09690; Ladner et al. International Publication No. WO 90/02809; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Hay et al. (1992) Hum Antibod Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275-1281; Griffths et al. (1993) EMBO J 12:725-734; Hawkins et al. (1992) J Mol Biol 226:889-896; Clackson et al. (1991) Nature 352:624-628; Gram et al. (1992) PNAS 89:3576-3580; Garrad et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nuc Acid Res 19:4133-4137; and Barbas et al. (1991) PNAS 88:7978-7982, the contents of all of which are incorporated by reference herein).
[0060] In one embodiment, the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody. Preferably, the non-human antibody is a rodent (mouse or rat antibody). Methods of producing rodent antibodies are known in the art.
[0061] Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741; Lonberg et al. International Application WO 92/03918; Kay et al. International Application 92/03917; Lonberg, N. et al. 1994 Nature 368:856-859; Green, L. L. et al. 1994 Nature Genet. 7:13-21; Morrison, S. L. et al. 1994 Proc. Natl. Acad. Sci. USA 81:6851-6855; Bruggeman et al. 1993 Year Immunol 7:33-40; Tuaillon et al. 1993 PNAS 90:3720-3724; Bruggeman et al. 1991 Eur J Immunol 21:1323-1326).
[0062] An antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
[0063] Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al. (1987) PNAS 84:3439-3443; Liu et al., 1987, J. Immunol. 139:3521-3526; Sun et al. (1987) PNAS 84:214-218; Nishimura et al., 1987, Canc. Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al., 1988, J. Natl Cancer Inst. 80:1553-1559).
[0064] A humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR. The antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to isoAsp7 A. Preferably, the donor will be a rodent antibody, e.g., a rat or mouse antibody, and the recipient will be a human framework or a human consensus framework. Typically, the immunoglobulin providing the CDRs is called the donor and the immunoglobulin providing the framework is called the acceptor. In one embodiment, the donor immunoglobulin is a non-human (e.g., rodent) immunoglobulin. The acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
[0065] As used herein, the term consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (see e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987)). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence. A consensus framework refers to the framework region in the consensus immunoglobulin sequence.
[0066] An antibody can be humanized by methods known in the art (see e.g., Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, the contents of all of which are hereby incorporated by reference).
[0067] Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Pat. No. 5,225,539; Jones et al. 1986 Nature 321:552-525; Verhoeyan et al. 1988 Science 239:1534; Beidler et al. 1988 J. Immunol. 141:4053-4060; Winter U.S. Pat. No. 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A, filed on Mar. 26, 1987; Winter U.S. Pat. No. 5,225,539), the contents of which is expressly incorporated by reference.
[0068] Also within the scope of the invention are humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in U.S. Pat. No. 5,585,089, e.g., columns 12-16 of U.S. Pat. No. 5,585,089, e.g., columns 12-16 of U.S. Pat. No. 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 A1, published on Dec. 23, 1992.
[0069] The antibody can be a single chain antibody. A single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52). The single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
[0070] In yet other embodiments, the antibody has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1,IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4. In another embodiment, the antibody has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda. The constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function). In one embodiment the antibody has effector function and can fix complement. In other embodiments the antibody does not recruit effector cells or fix complement. In another embodiment, the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
[0071] Methods for altering an antibody constant region are known in the art. Antibodies with altered function, e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. Nos. 5,624,821 and 5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
[0072] An antibody can be derivatized or linked to another functional molecule (e.g., another peptide or protein). As used herein, a derivatized antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules. For example, an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
[0073] One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies). Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Such linkers are available from Pierce Chemical Company, Rockford, Ill.
[0074] An antibody molecule may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., a cytotoxic or cytostatic) agent or moiety. Radioactive isotopes can be used in diagnostic or therapeutic applications. Such radioactive isotopes include, but are not limited to iodine (131I or 125I), yttrium (90Y), lutetium (177Lu), actinium (225Ac), praseodymium, astatine (211At), rhenium (186Re), bismuth (212Bi or 213Bi), indium (111In), technetium (99 mTc), phosphorus (32P), rhodium (188Rh), sulfur (35S) , carbon (14C), tritium (3H), chromium (51Cr), chlorine (36Cl), cobalt (57Co or 58Co), iron (59Fe), selenium (75Se), or gallium (67Ga). Radioisotopes useful as labels, e.g., for use in diagnostics, include iodine (131I or 125I), indium (111In), technetium (99mTc), phosphorus (32P), carbon (14C), and tritium (3 H), or one or more of the therapeutic isotopes listed above.
[0075] The invention provides radiolabeled antibody molecules and methods of labeling the same. In one embodiment, a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody. The conjugated antibody is radiolabeled with a radioisotope, e.g., 111Indium, 90Yttrium and 177Lutetium, to thereby produce a labeled antibody molecule.
[0076] The antibody molecule can be conjugated to a therapeutic agent. The antibody may be labeled. For example, the antibody may be labeled with a biotin molecule, an enzyme or a fluorophore.
[0077] The terms isoAsp7 amyloid , isoAsp7 A, isoD7 A and isoD7 amyloid A refer to an amyloid (A) polypeptide wherein the Asp at position 7 has isomerized. Thus, isoAsp7 A refers to an A polypeptide which comprises SEQ ID NO: 44 and an antibody which is specific for isoAsp7 A will preferentially bind an epitope comprising the L-isoAsp present in SEQ ID NO: 44.
[0078] The term K.sub.D refers to the dissociation constant. In a preferred embodiment, the K.sub.D is determined by surface plasmon resonance or isothermal titration calorimetry. Preferably, the K.sub.D is determined by surface plasmon resonance at 25 C.
[0079] In a preferred embodiment, the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 100 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8. More preferably, the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 150, 200, 250, 300, 350 or 400 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8. Preferably, the K.sub.D is determined by surface plasmon resonance or isothermal titration calorimetry. More preferably, the K.sub.D is determined by surface plasmon resonance at 25 C.
[0080] In a preferred embodiment, the K.sub.D of the interaction of the antibody or antigen-binding fragment and SEQ ID NO: 44 at 25 C. is less than 100 nM. Preferably, the K.sub.D is less than 50, 40, 30, 20 or 10 nM. More preferably, the K.sub.D is less than 50 nM. Most preferably, the K.sub.D is less than 10 nM. Preferably, the K.sub.D is determined by surface plasmon resonance or isothermal titration calorimetry. More preferably, the K.sub.D is determined by surface plasmon resonance at 25 C.
[0081] In a preferred embodiment, the antibody or antigen-binding fragment thereof comprises a light chain variable region (VL) and a heavy chain variable region (VH), wherein said VL comprises LCDR1, LCDR2 and LCDR3 polypeptides and VH comprises HCDR1, HCDR2 and HCDR3 polypeptides which are selected from the group consisting of: [0082] (a) LCDR1 is KSSQSLLNSRNRKNYLA (SEQ ID NO: 9), LCDR2 is WASTRDS (SEQ ID NO: 11), LCDR3 is KQSYNLRT (SEQ ID NO: 13), HCDR1 is GFSLTSYGVH (SEQ ID NO: 14), HCDR2 is ALWASGNTDYSSTLMS (SEQ ID NO: 15), and HCDR3 is DRGILTGGYFDV (SEQ ID NO: 17); [0083] (b) LCDR1 is KSSQSLFNSRTRKNYVA (SEQ ID NO: 27), LCDR2 is WASTRES (SEQ ID NO: 29), LCDR3 is KQSYNLRA (SEQ ID NO: 30), HCDR1 is GFTFTDYYMS (SEQ ID NO: 32),
[0084] HCDR2 is FIRNKANGYTTEYSASVKG (SEQ ID NO: 34), and HCDR3 is DIPTIMDY (SEQ ID NO: 35); [0085] (c) LCDR1 is KSSQSLLNX.sub.1RX.sub.2RKNYLA (SEQ ID NO: 10), LCDR2 is WASTRX.sub.3S (SEQ ID NO: 12), LCDR3 is KQSYNLRT (SEQ ID NO: 13), HCDR1 is GFSLTSYGVH (SEQ ID NO: 14), HCDR2 is X.sub.4LWASGX.sub.5TDYX.sub.6SX.sub.7LMS (SEQ ID NO: 16), and HCDR3 is DRGIX.sub.8TGGYFDV (SEQ ID NO: 18), wherein X.sub.1 is S or R, X.sub.2 is N or T, X.sub.3 is D or E, X.sub.4 is A or V, X.sub.5 is N or R, X.sub.6 is S or N, X.sub.7 is T or A, and X.sub.8 is L, T or M; and [0086] (d) LCDR1 is KSSQX.sub.1LX.sub.2NSRTRKNYX.sub.3A (SEQ ID NO: 28), LCDR2 is WASTRES (SEQ ID NO: 29), LCDR3 is X.sub.4QSYNLRX.sub.5 (SEQ ID NO: 31), HCDR1 is GFTFX.sub.6DYYMX.sub.7 (SEQ ID NO: 33), HCDR2 is FIRNKANGYTTEYSASVKG (SEQ ID NO: 34), and HCDR3 is DIPTIMDY (SEQ ID NO: 35), wherein X.sub.1 is S or N, X.sub.2 is F or L, X.sub.3 is V or L, X.sub.4 is K or M, X.sub.5 is A or T, X.sub.6 is T or S, and X.sub.7 is S or N.
[0087] In a preferred embodiment, the antibody or antigen-binding fragment thereof comprises a VL and a VH, wherein the VL and VH are polypeptides selected from the group consisting of: (a) VL of SEQ ID NO: 19 and VH of SEQ ID NO: 20; (b) VL of SEQ ID NO: 36 and VH of SEQ ID NO: 37; (c) VL of SEQ ID NO: 19 and VH of SEQ ID NO: 37; and (d) VL of SEQ ID NO: 36 and VH of SEQ ID NO: 20.
[0088] SEQ ID NO: 19 is the VL fragment present in K11 and has the following sequence:
TABLE-US-00004 DIVMSQSPTSLAVSAGEKVTMSCKSSQSLLNSRNRKNYLAWYQQKPGQSP K11IYWASTRDSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNL RTFGGGTKLEIK
[0089] SEQ ID NO: 20 is the VH fragment present in K11 and has the following sequence:
TABLE-US-00005 QVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEW LGALWASGNTDYSSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMYY CARDRGIMTGGYFDVWGAGTTVTVSS
[0090] SEQ ID NO: 36 is the VL fragment present in K119 and has the following sequence:
TABLE-US-00006 DIVMSQSPSSLAVSAGEKATMSCKSSQSLFNSRTRKNYVAWLQQKPG QSPK11ISWASTRESGVPDRFTGSGSGTDFALTITNVQAEDLAVYYC KQSYNLRAFGGGTKLEIT
[0091] SEQ ID NO: 37 is the VH fragment present in K119 and has the following sequence:
TABLE-US-00007 EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEW LGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRTEDSA TYYCTRDIPTIMDYWGQGTSVTVSS
[0092] In a preferred embodiment, the antibody or antigen-binding fragment thereof comprises a light chain (LC) and a heavy chain (HC), wherein said LC and HC are polypeptides selected from the group consisting of: (a) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 22; (b) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 39;(c) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 39; and (d) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 22.
[0093] SEQ ID NO: 21 is the LC present in K11 and has the following sequence:
TABLE-US-00008 DIVMSQSPTSLAVSAGEKVTMSCKSSQSLLNSRNRKNYLAWYQQKPG QSPK11IYWASTRDSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYC KQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFL NNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTK DEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[0094] SEQ ID NO: 22 is the HC present in K11 and has the following sequence:
TABLE-US-00009 QVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEW LGALWASGNTDYSSTLMSRLSISKDNSKSQVFLKMNSLQTDDTAMYY CARDRGILTGGYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNS MVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSV TVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVS SVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVH TAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPI EKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITV EWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCS VLHEGLHNHHTEKSLSHSPGK
[0095] SEQ ID NO: 38 is the LC present in K119 and has the following sequence:
TABLE-US-00010 DIVMSQSPSSLAVSAGEKATMSCKSSQSLFNSRTRKNYVAWLQQKPG QSPK11ISWASTRESGVPDRFTGSGSGTDFALTITNVQAEDLAVYYC KQSYNLRAFGGGTKLEITRADAAPTVSIFPPSSEQLTSGGASVVCFL NNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTK DEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[0096] SEQ ID NO: 39 is the HC present in K119 and has the following sequence:
TABLE-US-00011 EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEW LGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRTEDSA TYYCTRDIPTIMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSS VTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVT VTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPN LLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVN NVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKD LPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMP EDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERN SYSCSVVHEGLHNHHTTKSFSRTPGK
[0097] In a preferred embodiment, the antibody or antigen-binding fragment thereof comprises two LCs and two HCs, wherein each LC and each HC are polypeptides selected from the group consisting of: (a) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 22; (b) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 39; (c) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 39; and (d) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 22.
[0098] In a preferred embodiment, the antibody or antigen-binding fragment thereof is a humanized antibody or antigen-binding fragment thereof which comprises an LC and HC, wherein the LC comprises a polypeptide selected from SEQ ID NO: 53 and SEQ ID NO: 55, and the HC comprises a polypeptide selected from SEQ ID NO: 61 and SEQ ID NO: 63. Preferably, the LC comprises SEQ ID NO: 53 and the HC comprises SEQ ID NO: 61.
[0099] In a preferred embodiment, the antibody or antigen-binding fragment thereof is a humanized antibody or antigen-binding fragment thereof which comprises two LCs and two HCs, wherein each LC comprises a polypeptide selected from SEQ ID NO: 53 and SEQ ID NO: 55, and each HC comprises a polypeptide selected from SEQ ID NO: 61 and SEQ ID NO: 63. Preferably, each LC comprises SEQ ID NO: 53 and each HC comprises SEQ ID NO: 61.
[0100] SEQ ID NO: 53 has the following sequence:
TABLE-US-00012 DIVMTQSPDSLAVSLGERATINCKSSQSLLNSRNRKNYLAWYQQKPG QPPKLLIYWASTRDSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC KQSYNLRTFGQGTKLEIK
[0101] SEQ ID NO: 55 has the following sequence:
TABLE-US-00013 EIVLTQSPGTLSLSPGERATLSCKSSQSLLNSRNRKNYLAWYQQKPG QAPRLLIYWASTRDSGIPDRFSGSGSGTDYTLTISRLEPEDFAVYYC KQSYNLRTFGGGTKVEIK
[0102] SEQ ID NO: 61 has the following sequence:
TABLE-US-00014 QVQLQESGPGLVKPSGTLSLTCAVSGFSLTSYGVHWVRQPPGKGLEW LGALWASGNTDYSSTLMSRVTISVDKSKNQFSLRLSSVTAADTAVYY CARDRGILTGGYFDVWGKGTTVTVSS
[0103] SEQ ID NO: 63 has the following sequence:
TABLE-US-00015 QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEW LGALWASGNTDYSSTLMSRVTISVDTSKNQFSLKLSSVTAADTAVYY CARDRGILTGGYFDLWGRGTLVTVSS
[0104] In a preferred embodiment, the antibody or antigen-binding fragment thereof is a humanized antibody or antigen-binding fragment thereof which comprises an LC and an HC, wherein the LC is selected from SEQ ID NO: 57 and SEQ ID NO: 59, and the HC is selected from SEQ ID NO: 65 and SEQ ID NO: 67. Preferably, the LC is SEQ ID NO: 57 and the HC is SEQ ID NO: 65.
[0105] In a preferred embodiment, the antibody or antigen-binding fragment thereof is a humanized antibody or antigen-binding fragment thereof which comprises two LCs and two HCs, wherein each LC is selected from SEQ ID NO: 57 and SEQ ID NO: 59, and each HC is selected from SEQ ID NO: 65 and SEQ ID NO: 67. Preferably, each LC is SEQ ID NO: 57 and each HC is SEQ ID NO: 65.
[0106] SEQ ID NO: 57 has the following sequence:
TABLE-US-00016 DIVMTQSPDSLAVSLGERATINCKSSQSLLNSRNRKNYLAWYQQKPG QPPKLLIYWASTRDSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC KQSYNLRTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[0107] SEQ ID NO: 59 has the following sequence:
TABLE-US-00017 EIVLTQSPGTLSLSPGERATLSCKSSQSLLNSRNRKNYLAWYQQKPG QAPRLLIYWASTRDSGIPDRFSGSGSGTDYTLTISRLEPEDFAVYYC KQSYNLRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[0108] SEQ ID NO: 65 has the following sequence:
TABLE-US-00018 QVQLQESGPGLVKPSGTLSLTCAVSGFSLTSYGVHWVRQPPGKGLEW LGALWASGNTDYSSTLMSRVTISVDKSKNQFSLRLSSVTAADTAVYY CARDRGILTGGYFDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGG TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
[0109] SEQ ID NO: 67 has the following sequence:
TABLE-US-00019 QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEW LGALWASGNTDYSSTLMSRVTISVDTSKNQFSLKLSSVTAADTAVYY CARDRGILTGGYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGG TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
[0110] In a preferred embodiment, the antibody or antigen-binding fragment thereof is obtained or is obtainable from the hybridoma cell line [0111] (a) MWT 11-1-3, Deposit No: DSM ACC3314, Deposit date: Dec. 1, 2016 or [0112] (b) MWT 119-8-6, Deposit No: DSM ACC3316, Deposit date: Dec. 1, 2016,
deposited by: Fraunhofer-Institut fr Zelltherapie und Immunologie IZI Perlickstr. 1; 04103 Leipzig; Germany.
[0113] The hybridoma cell lines were deposited in accordance with the Budapest Treaty and are available at the Deutsche Sammlung fr Mikroorganismen und Zellkulturen (DSMZ), Inhoffenstr. 7b, 38124 Braunschweig, DE.
[0114] In a preferred embodiment, the antibody or antigen-binding fragment thereof is a monoclonal antibody or antigen-binding fragment thereof.
[0115] In another embodiment, the invention provides antibodies and functional fragments thereof that bind to isoAsp7 A peptides in the circulation and tissue, in particular in the brain. The antibodies of the invention are capable of binding isoAsp7 A peptide molecules in a monomeric, dimeric, trimeric, etc, or a polymeric form, in form of an aggregate, oligomer, fibers, filaments or in the condensed form of a plaque.
[0116] In a further embodiment, the invention provides antibodies and antigen binding fragments thereof, wherein the antibodies specifically bind to the isoaspartate modification of isoAsp7 A.
Pharmaceutical Composition
[0117] In a second aspect, the present invention provides a pharmaceutical composition comprising the antibody or antigen-binding fragment thereof of the present invention and a pharmaceutically acceptable carrier or diluent.
[0118] As used herein, pharmaceutically acceptable carrier or pharmaceutically acceptable diluent means any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed and, without limiting the scope of the present invention, include: additional buffering agents; preservatives; co-solvents; antioxidants, including ascorbic acid and methionine; chelating agents such as EDTA; metal complexes (e.g., Zn-protein complexes); biodegradable polymers, such as polyesters; salt-forming counterions, such as sodium, polyhydric sugar alcohols; amino acids, such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactitol, stachyose, mannose, sorbose, xylose, ribose, ribitol, myoinisitose, myoinisitol, galactose, galactitol, glycerol, cyclitols (e.g., inositol), polyethylene glycol; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, [alpha]-monothioglycerol, and sodium thio sulfate; low molecular weight proteins, such as human serum albumin, bovine serum albumin, gelatin, or other immunoglobulins; and hydrophilic polymers, such as polyvinylpyrrolidone.
[0119] A pharmaceutical composition as described herein may also contain other substances. These substances include, but are not limited to, cryoprotectants, lyoprotectants, surfactants, bulking agents, anti-oxidants, and stabilizing agents. In some embodiments, the pharmaceutical composition may be lyophilized.
[0120] The term cryoprotectant as used herein, includes agents which provide stability to the antibody against freezing-induced stresses, by being preferentially excluded from the antibody's surface. Cryoprotectants may also offer protection during primary and secondary drying and long-term product storage. Non-limiting examples of cryoprotectants include sugars, such as sucrose, glucose, trehalose, mannitol, mannose, and lactose; polymers, such as dextran, hydroxyethyl starch and polyethylene glycol; surfactants, such as polysorbates (e.g., PS-20 or PS-80); and amino acids, such as glycine, arginine, leucine, and serine. A cryoprotectant exhibiting low toxicity in biological systems is generally used.
[0121] In one embodiment, a lyoprotectant is added to a pharmaceutical composition described herein. The term lyoprotectant as used herein, includes agents that provide stability to the antibody during the freeze-drying or dehydration process (primary and secondary freeze-drying cycles), by providing an amorphous glassy matrix and by binding with the antibody's surface through hydrogen bonding, replacing the water molecules that are removed during the drying process. This helps to minimize product degradation during the lyophilization cycle, and improve the long-term product stability. Non-limiting examples of lyoprotectants include sugars, such as sucrose or trehalose; an amino acid, such as monosodium glutamate, non-crystalline glycine or histidine; a methylamine, such as betaine; a lyotropic salt, such as magnesium sulfate; a polyol, such as trihydric or higher sugar alcohols, e.g., glycerin, erythritol, glycerol, arabitol, xylitol, sorbitol, and mannitol; propylene glycol; polyethylene glycol; pluronics; and combinations thereof. The amount of lyoprotectant added to a pharmaceutical composition is generally an amount that does not lead to an unacceptable amount of degradation of the strain when the pharmaceutical composition is lyophilized.
[0122] In some embodiments, a bulking agent is included in the pharmaceutical composition. The term bulking agent as used herein, includes agents that provide the structure of the freeze- dried product without interacting directly with the pharmaceutical product. In addition to providing a pharmaceutically elegant cake, bulking agents may also impart useful qualities in regard to modifying the collapse temperature, providing freeze-thaw protection, and enhancing the strain stability over long-term storage. Non-limiting examples of bulking agents include mannitol, glycine, lactose, and sucrose. Bulking agents may be crystalline (such as glycine, mannitol, or sodium chloride) or amorphous (such as dextran, hydroxyethyl starch) and are generally used in formulations in an amount from 0.5% to 10%.
[0123] Other pharmaceutically acceptable carriers, excipients, or stabilizers, such as those described in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980) may also be included in a pharmaceutical composition described herein, provided that they do not adversely affect the desired characteristics of the pharmaceutical composition. As used herein, pharmaceutically acceptable carrier means any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed and include: additional buffering agents; preservatives; co-solvents; antioxidants, including ascorbic acid and methionine; chelating agents such as EDTA; metal complexes (e.g., Zn-protein complexes); biodegradable polymers, such as polyesters; salt-forming counterions, such as sodium, polyhydric sugar alcohols; amino acids, such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactitol, stachyose, mannose, sorbose, xylose, ribose, ribitol, myoinisitose, myoinisitol, galactose, galactitol, glycerol, cyclitols (e.g., inositol), polyethylene glycol; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, [alpha]-monothioglycerol, and sodium thio sulfate; low molecular weight proteins, such as human serum albumin, bovine serum albumin, gelatin, or other immunoglobulins; and hydrophilic polymers, such as polyvinylpyrrolidone.
[0124] The pharmaceutical composition may be prepared for oral, sublingual, buccal, intravenous, intramuscular, subcutaneous, intraperitoneal, conjunctival, rectal, transdermal, intrathecal, topical and/or inhalation-mediated administration. In a preferred embodiment, the pharmaceutical composition may be a solution which is suitable for intravenous, intramuscular, conjunctival, transdermal, intraperitoneal and/or subcutaneous administration. In an alternative embodiment, the pharmaceutical composition may be a gel or solution which is suitable for intrathecal administration.
[0125] The pharmaceutical composition may further comprise common excipients and carriers which are known in the state of the art. For solid pharmaceutical compositions, conventional nontoxic solid carriers may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For solution for injection, the pharmaceutical composition may further comprise cryoprotectants, lyoprotectants, surfactants, bulking agents, anti-oxidants, stabilizing agents and pharmaceutically acceptable carriers. For aerosol administration, the pharmaceutical compositions are generally supplied in finely divided form along with a surfactant and propellant. The surfactant must, of course, be nontoxic, and is generally soluble in the propellant. Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides may be employed. A carrier can also be included, as desired, as with, e.g., lecithin for intranasal delivery. For suppositories, traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides.
[0126] In a preferred embodiment, the pharmaceutical composition further comprises donepezil, gelantamine, memantine, rivastigmine, a beta sectretase inhibitor, a gamma secretase modulator, an additional antibody selected from the group of pan-A specific antibodies like aducanumab, bapineuzumab, crenezumab, ganteneumab, solanezumab and/or an antibody with specificity to posttranslational phosphorylated or nitrated A peptides.
Medical Uses
[0127] In a third aspect, the present invention provides the antibody or antigen-binding fragment thereof of the present invention or the pharmaceutical composition of the present invention for use as a medicament. In a fourth aspect, the present invention provides the antibody or antigen-binding fragment thereof of the present invention or the pharmaceutical composition of the present invention for use in the treatment and/or prevention of a neurodegenerative disease.
[0128] The terms treatment and therapy, as used in the present application, refer to a set of hygienic, pharmacological, surgical and/or physical means used with the intent to cure and/or alleviate a disease and/or symptoms with the goal of remediating the health problem. The terms treatment and therapy include preventive and curative methods, since both are directed to the maintenance and/or reestablishment of the health of an individual or animal. Regardless of the origin of the symptoms, disease and disability, the administration of a suitable medicament to alleviate and/or cure a health problem should be interpreted as a form of treatment or therapy within the context of this application.
[0129] The term prevention, as used in the present application, refers to a set of hygienic, pharmacological, surgical and/or physical means used to prevent the onset and/or development of a disease and/or symptoms. The term prevention encompasses prophylactic methods, since these are used to maintain the health of an animal or individual.
[0130] The term therapeutically effective amount refers to an amount of antibody or fragment thereof which has a therapeutic effect and which is able to alleviate and/or cure a neurological disease.
[0131] The terms individual, patient or subject are used interchangeably in the present application and are not meant to be limiting in any way. The individual, patient or subject can be of any age, sex and physical condition.
[0132] In the context of the present invention, the term neurodegenerative disorder or neurodegenerative disease is understood as any hereditary and/or sporadic condition which is characterized by a progressive nervous system dysfunction. These disorders are often associated with the atrophy of the affected central or peripheral structures of the nervous system. In a preferred embodiment, the neurodegenerative disease is A-related. Preferably, the neurodegenerative disease is associated with the formation of isoAsp7 A-containing plaques.
[0133] In a particular embodiment, the antibodies of the invention, which are capable of binding to and clearing or removing isoAsp7 A peptides in biological fluids and tissues, are useful for the prevention and/or treatment of conditions associated with the formation of isoAsp7 A-containing plaques, such as diffuse, neuritic, and cerebrovascular plaques in the brain.
[0134] The administration of the antibodies of the invention, including immunologically reactive fragments thereof, may lead to the clearance or removal of isoAsp7 A from the aforementioned plaques or other biological complexes. Thus, the humanized antibody of the invention will be readily transported in the circulation, other body fluids and to sites where the aforementioned plaques and/or other biological complexes are formed or elsewhere where isoAsp7 A exhibits damaging effects.
[0135] In addition, removal of isoAsp7 A from plaques or other biological complexes by antibodies of the invention, including immunologically reactive fragments thereof, may lead to the solubilization of insoluble forms of plaques and thus lead to the removal of complete plaques from the affected tissue, such as brain tissue. This, in turn, may lead to improvement of cognition in patients diagnosed with a neurodegenerative disease, such as mild cognitive impairment (MCI), clinical or pre-clinical Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) or others, neurodegeneration in Down Syndrome, and clinical or pre-clinical CAA.
[0136] In a preferred embodiment, the present invention provides a method for treating and/or preventing a neurodegenerative disorder. Preferably, the method comprises administering the antibody of the present invention or antigen-binding thereof to a patient.
[0137] In a preferred embodiment, the present invention provides a method of treating Alzheimer's disease. Preferably, the method comprises administering the antibody of the present invention or antigen-binding fragment thereof to a patient.
[0138] The binding of antibodies or antigen binding fragments of the invention to isoAsp7 A in the circulation or other body fluids may further result in the removal of the circulating or soluble forms of isoAsp7 A IsoAsp7 A has a high affinity to other, modified or unmodified A peptides, which results in the formation of oligomeric and supermolecular structures, such as amyloid plaques. It has been shown that in particular these oligomeric structures are highly neurotoxic. The formation of oligomeric structures leads to cell damage and death of neuronal cells. Thus, the removal of circulating or soluble forms of A isoAsp7 or even of oligomers comprising isoAsp7 A leads to the prevention of cell damage and/or neurotoxicity. Thus, the invention also provides methods of preventing neurodegenerative diseases, such as mild cognitive impairment (MCI), clinical or pre-clinical Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) or others, neurodegeneration in Down Syndrome, and clinical or pre-clinical CAA.
[0139] The invention further provides methods of preventing and/or treating other diseases which are based on or associated with amyloid-like proteins, in particular A isoAsp7, such as progressive supranuclear palsy, multiple sclerosis, Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotrophic lateral sclerosis), dementia related to Adult Onset Diabetes; senile cardiac amyloidosis, and others, including macular degeneration.
[0140] In a preferred embodiment, the neurodegenerative disease is selected from the list consisting of mild cognitive impairment, clinical or preclinical Alzheimer's disease, neurodegeneration in Down Syndrome, clinical and preclinical amyloid angiopathy, progressive supranuclear palsy, multiple sclerosis, Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotrophic lateral sclerosis), dementia related to Adult Onset Diabetes; senile cardiac amyloidosis and muscular degeneration. Preferably, the disease is clinical or preclinical Alzheimer's disease.
Hybridoma Cell Line
[0141] In a fifth aspect, the present invention provides a hybridoma cell line deposited as follows:
[0142] (a) MWT 11-1-3, Deposit No: DSM ACC3314, Deposit date: Dec. 1, 2016; and/or
[0143] (b) MWT 119-8-6, Deposit No: DSM ACC3316, Deposit date: Dec. 1, 2016.
[0144] MWT 11-1-3 secretes monoclonal antibody K11 and MWT 119-8-6 secretes monoclonal antibody K119.
[0145] In an alternative aspect, the present invention provides a hybridoma cell line that can express any one of the antibodies of the present invention or antigen-binding fragments thereof.
[0146] The present invention also provides (i) a nucleic acid encoding the antibody of the present invention or an antigen-binding fragment thereof, (ii) a vector comprising the nucleic acid, and (iii) a cell comprising the nucleic acid and/or vector. Preferably the cell is a mammalian cell.
Diagnosis
[0147] In a sixth aspect, the present invention provides the use of the antibody or antigen-binding fragment thereof of the present invention for the diagnosis and/or prognosis of a neurodegenerative disease.
[0148] In a preferred embodiment, the antibody or antigen-binding fragment is derivatized in any manner which has been previously discussed. For example, the antibody may be fused to hydrogen peroxidase and used in an ELISA to diagnose and/or prognose a neurodegenerative disease.
[0149] The invention further envisions the use of the antibody or antigen-binding fragment thereof of the present invention in a highly sensitive and concomitantly robust detection technique that allows quantitative determination of A variants, in particular isoAsp7 A, in biological samples, e.g. liquor (cerebrospinal fluid) or serum samples, preferably serum samples, or tissue samples. This is a tremendous challenge, taking the low abundance of these isoAsp7 A peptides in blood into account. Having such a detection technique available is, however, a prerequisite for studying efficacy of small molecule inhibitors in drug screening and drug development programs.
[0150] In a seventh aspect, the present invention provides a method for detecting L-isoAsp7 A comprising a step wherein an isolated sample is put into contact with the antibody or antigen-binding fragment thereof of the present invention.
[0151] The method may involve the method steps of a direct or indirect ELISA, an agglutination assay, an immunochromatography assay, a radioimmunology assay, a pull-down assay, an immunofluorescence assay or an immunostaining assay.
[0152] In a preferred embodiment, the method comprises: (a) quantifying the amount of L-isoAsp7-comprising peptide through the use of a sandwich immunoassay, wherein the immobilized capture antibody or antigen-binding fragment thereof is an antibody of the present invention or an antigen-binding fragment thereof, and the detection antibody is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1.
[0153] In a preferred embodiment, the isolated sample is an isolated serum, liquor/cerebrospinal or another body fluid or tissue sample. Preferably a serum sample.
[0154] In an eighth aspect, the present invention provides a method of determining the percentage of A peptide comprising L-isoAsp at position 7 of SEQ ID NO: 1 in an isolated sample. In a preferred embodiment, the method comprises: (a) quantifying the amount of L-isoAsp-comprising peptide through the use of a sandwich immunoassay, wherein the immobilized capture antibody or antigen-binding fragment thereof is an antibody of the present invention or an antigen-binding fragment thereof, and the detection antibody is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1; (b) quantifying the total amount of A through the use of a sandwich immunoassay, wherein the immobilized capture antibody or antigen-binding fragment thereof is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1, and the detection antibody is an antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1; and (c) determining the percentage value by using the values obtained in steps (a) and (b).
[0155] Sandwich immunoassays are common in the art. There are plenty of articles available. For example: Cox K L, Devanarayan V, Kriauciunas A, et al. Immunoassay Methods. 2012 May 1 [Updated 2014 Dec. 24]. In: Sittampalam G S, Coussens N P, Brimacombe K, et al., editors. Assay Guidance Manual [Internet]. Bethesda (Md.): Eli Lilly & Company and the National Center for Advancing Translational Sciences; 2004-. Available from: https://www.ncbi.nlm.nih.gov/books/NBK92434/. In a preferred embodiment, the sandwich immunoassay is a direct or indirect ELISA.
[0156] The term specifically bind refers to a molecule (e.g., antibody or antibody fragment) that binds to a target with at least 2-fold greater affinity than non-target compounds, e.g., at least 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 25-fold, 50-fold, or 100-fold greater affinity.
[0157] In a preferred embodiment, the antibody or antigen-binding fragment thereof that specifically binds to a polypeptide comprising SEQ ID NO: 1 binds to an epitope found at any one of the positions encompassed by residues 1-6 and 8-42 of SEQ ID NO: 1. In other words, the epitope does not comprise the aspartate at position 7 of SEQ ID NO: 1.
[0158] The present invention also comprises the following items:
[0159] [1] An antibody or antigen-binding fragment thereof which specifically binds to isoAsp7 amyloid (A), wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 10 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8.
[0160] [2] The antibody or antigen-binding fragment thereof according to item [1], wherein the K.sub.D of the interaction between the antibody and SEQ ID NO: 44 is at least 100 times less than the K.sub.D of the interaction between the antibody and SEQ ID NO: 8.
[0161] [3] The antibody or antigen-binding fragment thereof according to any one of items [1]-[2], wherein the antibody or antigen-binding fragment thereof comprises a light chain variable region (VL) and a heavy chain variable region (VH), wherein said VL comprises LCDR1, LCDR2 and LCDR3 polypeptides and VH comprises HCDR1, HCDR2 and HCDR3 polypeptides which are selected from the group consisting of: [0162] (a) LCDR1 is KSSQSLLNSRNRKNYLA (SEQ ID NO: 9), LCDR2 is WASTRDS (SEQ ID NO: 11), LCDR3 is KQSYNLRT (SEQ ID NO: 13), HCDR1 is GFSLTSYGVH (SEQ ID NO: 14), HCDR2 is ALWASGNTDYSSTLMS (SEQ ID NO: 15), and HCDR3 is DRGILTGGYFDV (SEQ ID NO: 17); [0163] (b) LCDR1 is KSSQSLFNSRTRKNYVA (SEQ ID NO: 27), LCDR2 is WASTRES (SEQ ID NO: 29), LCDR3 is KQSYNLRA (SEQ ID NO: 30), HCDR1 is GFTFTDYYMS (SEQ ID NO: 32), HCDR2 is FIRNKANGYTTEYSASVKG (SEQ ID NO: 34), and HCDR3 is DIPTIMDY (SEQ ID NO: 35); [0164] (c) LCDR1 is KSSQSLLNX.sub.1RX.sub.2RKNYLA (SEQ ID NO: 10), LCDR2 is WASTRX.sub.3S (SEQ ID NO: 12), LCDR3 is KQSYNLRT (SEQ ID NO: 13), HCDR1 is GFSLTSYGVH (SEQ ID NO: 14), HCDR2 is X.sub.4LWASGX.sub.5TDYX.sub.6SX.sub.7LMS (SEQ ID NO: 16), and HCDR3 is DRGIX.sub.8TGGYFDV (SEQ ID NO: 18), wherein X.sub.1 is S or R, X.sub.2 is N or T, X.sub.3 is D or E, X.sub.4 is A or V, X.sub.5 is N or R, X.sub.6 is S or N, X.sub.7 is T or A, and X.sub.8 is L, T or M; and [0165] (d) LCDR1 is KSSQX.sub.1LX.sub.2NSRTRKNYX.sub.3A (SEQ ID NO: 28), LCDR2 is WASTRES (SEQ ID NO: 29), LCDR3 is X.sub.4QSYNLRX.sub.5 (SEQ ID NO: 31), HCDR1 is GFTFX.sub.6DYYMX.sub.7 (SEQ ID NO: 33), HCDR2 is FIRNKANGYTTEYSASVKG (SEQ ID NO: 34), and HCDR3 is DIPTIMDY (SEQ ID NO: 35), wherein X.sub.1 is S or N, X.sub.2 is F or L, X.sub.3 is V or L, X.sub.4 is K or M, X.sub.5 is A or T, X.sub.6 is T or S, and X.sub.7 is S or N.
[0166] [4] The antibody or antigen-binding fragment thereof according to any one of items [1]-[3], wherein the antibody or antigen-binding fragment thereof comprises a VL and a VH, wherein the VL and VH are polypeptides selected from the group consisting of: [0167] (a) VL of SEQ ID NO: 19 and VH of SEQ ID NO: 20; [0168] (b) VL of SEQ ID NO: 36 and VH of SEQ ID NO: 37; [0169] (c) VL of SEQ ID NO: 19 and VH of SEQ ID NO: 37; and [0170] (d) VL of SEQ ID NO: 36 and VH of SEQ ID NO: 20.
[0171] [5] The antibody or antigen-binding fragment thereof according to any one of items [1]-[4], wherein the antibody or antigen-binding fragment thereof comprises a light chain (LC) and a heavy chain (HC), wherein said LC and HC are polypeptides selected from the group consisting of: [0172] (a) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 22; [0173] (b) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 39; [0174] (c) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 39; and [0175] (d) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 22.
[0176] [6] The antibody or antigen-binding fragment thereof according to item [5], wherein the antibody or antigen-binding fragment thereof comprises two LCs and two HCs, wherein each LC and each HC are polypeptides selected from the group consisting of: [0177] (a) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 22; [0178] (b) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 39; [0179] (c) LC of SEQ ID NO: 21 and HC of SEQ ID NO: 39; and [0180] (d) LC of SEQ ID NO: 38 and HC of SEQ ID NO: 22.
[0181] [7] The antibody or antigen-binding fragment thereof according to any one of items [1]-[6], wherein the antibody or antigen-binding fragment thereof is obtained or is obtainable from the hybridoma cell line [0182] (a) MWT 11-1-3, Deposit No: DSM ACC3314, Deposit date: Dec. 1, 2016 or [0183] (b) MWT 119-8-6, Deposit No: DSM ACC3316, Deposit date: Dec. 1, 2016.
[0184] [8] The antibody or antigen-binding fragment thereof according to any one of items [1]-[7], wherein the antibody or antigen-binding fragment thereof is a monoclonal antibody or antigen-binding fragment thereof.
[0185] [9] A pharmaceutical composition comprising the antibody or antigen-binding fragment thereof according to any one of items [1]-[8] and a pharmaceutically acceptable carrier or diluent.
[0186] [10] The pharmaceutical composition according to item [9], wherein the composition further comprises donepezil, gelantamine, memantine, rivastigmine, a beta secretase inhibitor, a gamma secretase modulator, an additional antibody selected from the group of pan-A specific antibodies like aducanumab, bapineuzumab, crenezumab, ganteneumab, solanezumab and/or an antibody with specificity to posttranslational phosphorylated or nitrated A peptides.
[0187] [11] The antibody or antigen-binding fragment thereof according to any one of items [1]-[8] or the pharmaceutical composition according to any one of items [9]-[10] for use as a medicament.
[0188] [12] The antibody or antigen-binding fragment thereof according to any one of items [1]-[8] or the pharmaceutical composition according to any one of items [9]-[10] for use in the treatment and/or prevention of a neurodegenerative disease.
[0189] [13] The antibody or antigen-binding fragment thereof or the pharmaceutical composition for use according to item [12], wherein the neurodegenerative disease is selected from the list consisting of mild cognitive impairment, clinical or preclinical Alzheimer's disease, neurodegeneration in Down Syndrome, clinical and preclinical amyloid angiopathy, progressive supranuclear palsy, multiple sclerosis, Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotrophic lateral sclerosis), dementia related to Adult Onset Diabetes, senile cardiac amyloidosis and muscular degeneration.
[0190] [14] The antibody or antigen-binding fragment thereof or the pharmaceutical composition for use according to any one of items [12]-[13], wherein the neurodegenerative disease is clinical or preclinical Alzheimer's disease.
[0191] [15] A hybridoma cell line deposited as follows: [0192] (a) MWT 11-1-3, Deposit No: DSM ACC3314, Deposit date: Dec. 1, 2016; and/or [0193] (b) MWT 119-8-6, Deposit No: DSM ACC3316, Deposit date: Dec. 1, 2016.
[0194] [16] Use of the antibody or antigen-binding fragment thereof according to any one of claims 1-8 for the diagnosis and/or prognosis of a neurodegenerative disease.
[0195] [17] A method for detecting isoAsp7 A comprising a step wherein an isolated sample is put into contact with the antibody or antigen-binding fragment thereof according to any one of claims 1-8.
EXAMPLES
Example 1: Preparation and Screening of Monoclonal Antibodies Directed Against IsoAsp7-A
[0196] The aim was the generation of monoclonal antibodies, which react with isoAsp7-A and shorter peptides thereof containing isoaspartate at position 7, but not with the same molecules possessing an aspartate at position 7.
[0197] For immunization, a mixture of the peptides isoD7-A(1-12)Cys (SEQ ID NO: 3) and isoD7-A (5-9)repCys (SEQ ID NO: 4) was used. The sulfhydryl groups of terminal cysteine residues were used to conjugate the peptides to Bacterial Transglutaminase (BTG) as carrier. BTG was activated by using the crosslinker SMPH (Succinimidyl-6-[(-maleimidopropionamido)hexanoate]).
[0198] For generation of monoclonal antibodies, 8-week-old female BALB/c mice were immunized with the peptide-BTG-conjugates. Mice were immunized intraperitoneally with a water-in-oil emulsion that was prepared by emulsifying both antigens in equal volumes of Freund's complete adjuvant (priming) or incomplete adjuvant (boosting).
[0199] After mice showed sufficient antibody titer in serum, they were sacrificed by cervical dislocation. Spleens were aseptically removed, pooled, homogenized and immortalized by cell fusion using myeloma cell line SP2/0-Agl4 purchased from the German Collection of Microorganisms and Cell Culture (DSMZ GmbH, Braunschweig).
[0200] The resulting hybridoma clones were screened according their ability to bind SEQ ID NO: 3-BSA-conjugate, SEQ ID NO: 4-BSA-conjugate, isoD7-A(1-18)-PEG-Biotin (SEQ ID NO: 5) but not the wildtype peptide A(1-18)-PEG-Biotin (SEQ ID NO: 6). Screening of BSA conjugated antigens occurred via direct enzyme-linked immunosorbent assay (ELISA). Binding to biotinylated antigens was analysed by applying the peptides to streptavidin coated plates, followed by direct ELISA.
[0201] Stable antibody-producing hybridomas have been selected and subsequently cloned for a second time by limited dilution in order to ensure the monoclonality of the hybridomas. Hybridoma subclones were screened again by ELISA and the best clones chosen for cryopreservation, isotyping and mycoplasma testing.
Example 2: Characterization of Monoclonal Antibodies by Dot Blot Analysis
[0202] A simple Dot Blot protocol was accomplished to obtain a general idea about the specificity and cross reactivity of antibodies. 2 l of the following peptides based on human A were spotted in descending concentrations (200-0.02 M) on a nitrocellulose membrane: 1isoD7-A(1-17) (SEQ ID NO:7); 2isoD7-A (5-9)repCys (SEQ ID NO: 4); 3A(1-18) (SEQ ID NO: 8); 4isoD7-A(1-18) (SEQ ID NO: 44). For analysis, membranes were blocked for one hour with TBST-M (TBST (Tris buffered saline+0.05% (v/v) Tween-20)+5% (w/v) skimmed milk) at room temperature with gentle shaking. Afterwards, membranes were incubated for 3 hours up to overnight at 4 C. with antibodies K11, K119 and 6E10 diluted to 1 g/ml in equal volumes of TBST-M. Secondary anti-mouse antibody conjugated with alkaline phosphatase was used for signal detection, following standard procedures.
Results
[0203] As shown in
Example 3: Characterization of Monoclonal Antibodies by SPR Analysis
Methods
[0204] Binding affinities of K11 and K119 to different A species was determined by using Biacore 3000 at a temperature of 25 C. In order to bind analyzing antibodies K11 and K119 to a CMS sensor Chip (GE Healthcare, Product code BR100012), approximately 15,000-20,000 RU of goat anti mouse IgG (Thermo Fisher Scientific, PA1 28555) were immobilized first. To immobilize the anti-mouse IgG, the carboxymethylated dextran surface of the sensor chip was activated by mixing 0.1 M N-hydroxysuccinimide (NHS) with 0.4 M N-ethyl-N-(dimethylaminopropyl)carbodiimide hydrochloride (EDC) 1:1. EDC/NHS was applied to the sensor chip for 10 minutes with a flow rate of 10 l/min. Goat anti mouse IgG was diluted to 50 g/ml in 10 mM Sodium acetate, pH 5.5 and injected for 23 minutes with a flow rate of 10 l/min. After deactivation with 1 M ethanolamine, pH 8.5 for 27 minutes with a flow rate of 10 l/min, 0.1 M glycine, pH 1.7 was applied to the sensor chip with a flow rate of 30 l/min for 3 minutes, followed by a washing step with HBS-EP buffer (GE Healthcare, Product code BR100188).
[0205] Binding of about 2,000 RU anti isoAsp7-A antibodies occurred with a flow rate of 10 l/min. To achieve this, antibodies were diluted to 25 g/ml in HBS-EP buffer and applied to the sensor chip, followed by washing with HBS-EP until the RU signal remains constant.
[0206] Kinetic constants were determined by applying A peptides at different concentrations and calculated from the combined set of data by using BIAevaluation software (Biacore AB) (
Results
[0207] Table 1 shows the kinetic constants obtained for binding of isoD7-A(1-18) by K11 and K119. K11 binds the L-isoAsp containing antigen isoD7-A (1-18) (SEQ ID NO: 44) with a K.sub.D value of 6.3 nM. K119 has a lower affinity to the antigen (K.sub.D value of 68.5 nM). Much higher K.sub.D values were obtained for binding the D-isoaspartate isomer containing peptide derivative isod7-A(1-17) (SEQ ID NO:7) and the appropriate wildtype sequence A(1-18) (SEQ ID NO: 8) (Table 2). Both antibodies share a strong antigen specificity to L-isoaspartate 7 modified A peptides.
[0208] Table 3 shows that isoAsp7-A binding by K11 is not dependent on peptide length. Additionally, a number of posttranslationally modified A peptides found in amyloid plaques of AD patients were tested. Surprisingly, binding of isoD7-A peptides by K11 is enhanced if the N-terminus consists of L-pyroglutamate at position 3 (SEQ ID NO: 48).
TABLE-US-00020 TABLE 1 Kinetic constants of isoD7-A(1-18) binding by K11 and K119 Clone k.sub.on in s.sup.1M.sup.1 k.sub.off in s.sup.1 K.sub.D (k.sub.off/k.sub.on) K11 4.07 10.sup.4 2.57 10.sup.4 6.31 nM K119 102 10.sup.4 0.07 68.5 nM
TABLE-US-00021 TABLE 2 Kinetic constants for binding of different A peptides by K11 and K119 K.sub.D (nM) Peptide SEQ ID NO K11 K119 isoD7-A(1-18) 44 6.3 68.5 isod7-A(1-17) 7 2690 n.e.* A(1-18) 8 2700 931,000 *Not evaluable because of too fast dissociation
TABLE-US-00022 TABLE 3 Kinetic constants for binding of different A peptides by K11 Peptide SEQ ID NO K.sub.D (nM) isoD7-A(1-40) 45 3.5 A(1-40) 2 1670 isoD7-3NY10-A(1-18) 46 652 pE3-A(3-18) 47 402 pE3-isoD7-A(3-18) 48 1.7 isoD7-PhosphoSer8-A(1-18) 49 No binding Mouse isoD7-A(1-18) 50 153
Example 4: Characterization of Monoclonal Antibodies by Isothermal Titration Calorimetry (ITC)
[0209] In order to verify K.sub.D values obtained by SPR analysis and to further analyze binding kinetics of K11 to isoD7-A(1-18) (SEQ ID NO: 44), A(1-18) (SEQ ID NO: 8), and isod7-A(1-17) (SEQ ID NO: 7) in more detail, the association constant K.sub.A, reaction enthalpy H as well as reaction entropy S have been determined by using a VP-ITC microcalorimeter (MicroCal).
[0210] Antibodies were dialyzed against ITC buffer (25 mM KH.sub.2PO.sub.4; 25 mM Na.sub.2HPO.sub.4; 150 mM NaCl; 1 mM EDTA, pH 7.4) overnight at 4 C. Lyophilized peptides were dissolved in ITC buffer to concentrations between 50-240 M. Afterwards the exact concentration of antibody and peptides was calculated from absorbance at 280 nm and the respective extinction coefficient. The binding heat was recorded at 25 C. by titration of 12 l and 2114 l of antigens into the antibody solution every 5 minutes. In order to evaluate the heat development originated by the dilution of A peptides, these values were determined by titration of peptides into dialysis buffer using defined conditions and instrument setup. Plotting of data occurred by MicroCal ORIGIN software. The calculated binding heat was corrected by the heat originated by dilution of the antigen. The resulting curve was fitted by the One Set of Sites binding model. With this model, the stoichiometry, association constant, reaction enthalpy and reaction entropy can be calculated.
Results
[0211] The top graphs in
[0212] Table 4 gives an overview about the values calculated for stoichiometry, association constant, reaction enthalpy and reaction entropy for K11 and K119 binding to isoD7-A(1-18) (SEQ ID NO: 44). In order to compare kinetic parameter received from different methods, K.sub.D values obtained by SPR analysis and ITC are shown.
TABLE-US-00023 TABLE 4 Thermodynamic parameters of K11 and K119 binding to isoD7-A(1-18) Thermodynamic parameter K11 K119 N 2.02 1.88 K.sub.A (mol.sup.1) 1.15 10.sup.8 0.205 10.sup.8 H (kcal/mol) 26.12 20.39 S (cal/mol/K) 0.051 0.035 TS (kcal/mol) 10.99 9.8 G (kcal/mol) 15.13 10.59 K.sub.D ITC (nM) 8.7 48.8 K.sub.D SPR (nM) 6.3 68.5
Example 5: Immunohistochemical (IHC) Staining of Mouse Brain Samples
[0213] In order to verify the usage of our antibodies for the identification of isoAsp7-A modification in amyloid plaques, sections of brain tissue from animals of a 5FAD mouse model in different ages have been prepared. 5FAD transgenic mice overexpress mutant human APP(695) with the Swedish (K670N, M671L), Florida (I716V), and London (V717I) FAD mutations along with human PS1 harboring two FAD mutations, M146L and L286V. In consequence of these mutations, they start to develop an Alzheimer's disease phenotype. The mice have been first described by Oakley et al. (Oakley et al., (2006) J. Neurosci. 26(40):10129-40) and used in numerous pharmacological assessments since then (Ardestani et al., (2017) Neuropharmacology 116:371-386; Ano et al., (2017) J. Biol. Chem. 292(9):3720-3728; Cha et al., (2017) Stem Cells Transl. Med. 6(1):293-305; Torika et al., (2017) Brain Behav. Immun. 64:80-90; MacPherson et al., (2017) Neurobiol. Dis. 102:81-95). Male and female 5FAD mice have been narcotized with sodium pentobarbital, followed by brain withdrawal. Brains were fixed with paraformaldehyde, incubated for 3 d in 30% (w/v) sucrose in 0.1 M phosphate buffer, shock frozen in methylbutane and stored at 20 C. until further use. Frozen brains were sliced in 30 m thick sections by using Cryostar NX70. Immunostaining occurred by the avidin biotin peroxidase complex (ABC) method described by HSU et al (HSU et al (1981) J Histochem Cytochem. 29(4):577-80). After washing 35 min with TBS, brain slices were incubated for 30 min in 1% (v/v) H.sub.2O.sub.2; 60% (v/v) methanol, followed by another wash step and incubation for 30 min in blocking solution (5% (v/v) goat serum; 2.3% (v/v) M.O.M. Blocking Reagent in TBS with 0.3% (v/v) Triton-X 100). Incubation with 2 g/ml primary antibodies K11, K119 or 6E10 (Hiss Diagnostics) in 5% (v/v) goat serum; 0.1% (v/v) Triton-X 100 in TBS occurred overnight at 4 C. After 35 min washing with TBS, biotinylated goat anti mouse IgG (Thermo Fisher Scientific) was diluted 1:1000 in TBS with 2% BSA and incubated for 60 min with the samples. ExtrAvidin-Peroxidase (Sigma-Aldrich) was added 1:1000 in TBS with 2% (v/v) BSA after 3x5 min washing steps and incubated for 60 min, followed by 35 min washing with TBS and another 5 min washing step with 0.05 M Tris-HCl, pH 7.6. Chromogenic substrate 3,3-Diaminobenzidin (DAB) (0.05% (w/v) DAB; 0.015% (v/v) H.sub.2O.sub.2 in 0.05 M Tris-HCl, pH 7.6) was added for 4-7 min
Results
[0214] Amyloid plaque formation occurs in 5FAD mice about six months after birth (
[0215]
Example 6: Application of K11 in an IsoAsp7-A Specific ELISA
Methods
[0216] In order to determine the amounts of isoD7-A in biological samples, an indirect Sandwich ELISA was established. Therefore, K11 was diluted in PBS to 2g/ml and immobilized on polystyrene 96-well microtiter plates overnight at 4 C. Blocking occurred for 2 hours at 4 C. with ELISA Blocker (Thermo Fisher Scientific). For preparation of the standard curve, synthetic isoD7-A(1-30) was serially diluted with ELISA Blocker+Tween (Thermo Fisher Scientific) from 150 pg/ml down to 1.6 pg/ml and added to the wells in duplicate. Two wells filled with ELISA Blocker+Tween represent the standard curve value 0 pg/ml. After an incubation period of 2 hours at room temperature, plates were washed six times with TBS-T. For detection of bound isoD7-A species, the HRP-conjugated anti A antibody clone 4G8 (Biolegends) was diluted to a final concentration of 1 g/ml in ELISA Blocker+Tween and incubated for 1 hour at 4 C. with the samples. After three washing steps with TBS-T, a color reaction with commercially available HRP substrate TMB (SureBlue Reserve TMB Microwell Peroxidase Substrate (1-component), KPL) was performed (30 minutes incubation at room temperature in the dark) and subsequently stopped by the addition of 1.2 N H.sub.2SO.sub.4. Absorption at 450/540 nm was determined by a Tecan Sunrise plate reader. The standard curve was calculated from measured absorption by a 4-Parameter-Logistic-Fit: y=(A2+(A1A2)/(1+(x/x0){circumflex over ()}p).
[0217] In order to determine the amount of total A, a comparative ELISA was established by immobilizing the A-N-terminal specific antibody 3D6 (ATCC Murine Hybridoma Cell Line RB96 3D6.32.2.4) on 96-well microtiter plates, replacing K11. 3D6 recognizes the N-terminus of A(1-X) independent from an isoAsp7 modification (see
Results
[0218] By using the anti isoD7-A specific antibody K11, an indirect Sandwich ELISA was developed for the quantitative detection of isoD7-A down to 1.6 pg/ml.
[0219] The development of a total A ELISA, which detects A independent from an isoAsp7 modification, allows on the one hand the determination of the percentage isoAsp7-content in amyloid plaques. On the other hand, the ELISA enables us to determine the influence of K11 antibody treatment (see Example 7+8) on non isoAsp7-modified A peptides.
Example 7: Application of K11 in a 5FAD Mouse Model
Methods
[0220] The ability of K11 to reduce A plaque load in a 5FAD mouse model was evaluated. To do this, K11 was expressed with an IgG2a subtype in Hek293 cells and purified by protein G affinity chromatography.
[0221] In order to determine the appropriate K11 treatment dosage, three month old 5FAD mice were treated in a first trial intraperitoneally once a week with 500 g, 150 g K11 or 500 g isotype control in PBS. In this initial trial, mice were sacrificed after 12 weeks of treatment. One hemisphere was used for immunohistological staining (for method see Example 5), the other one for ELISA analysis, and the cerebellum and brainstem were used for IgG2a quantification (see Example 8). The last antibody application occurred 7 days before brain preparation.
[0222] Regions of interest (ROI) in hippocampal brain slices were selected by staining with 2 g/ml 6E10 (for general A) and 2 g/ml isoAsp7-A specific antibody K11 (for isoAsp7-A). All pictures were recorded by using the microscope Biorevo BZ-9000 (Keyence) with transmitted light modus and an exposure time of 1/200 s. Percental area of isoAsp7-Abeta (ROI isoD7 in %) was quantified based on total area of ROI by using the program BZ II Analyzer.
[0223] In order to prepare mouse brain for ELISA analysis, the left hemisphere was homogenized in T-Per buffer (Thermo Fisher Scientific) with Protease Inhibitor Cocktail Tablets (Roche) by using a Precellys Homogenizer (VWR), followed by sonification for 10 s. The homogenate was centrifuged for 1 hour at 100,000g. The resulting pellet was dissolved to 150 mg/ml in 5 M Guanidine hydrochloride (5 M GdmCl), followed by an incubation step in an overhead shaker for 3 hours at room temperature. After a centrifugation step (1 h at 100,000g), supernatant was collected and stored at 20 C. until use. For details on how the ELISA measurements were performed, see Example 6.
Results
[0224] By using the isoAsp7- and total A specific ELISAs, a dose dependent reduction of isoAsp7- and total A plaque load in comparison to the isotype control group was shown (
[0225] Immunohistological evaluation after plaque staining with K11 also shows a clear reduction of A plaque load in comparison to the isotype control group (
Example 8: Brain Penetration of K11 in 5FAD Mice
[0226] Since cerebellum and brainstem have no or very low plaque load in 5FAD mice, they have been used for quantification of IgG2a content. Therefore, cerebellum and brainstem were homogenized in ELISA Blocker+Tween (Thermo Fisher Scientific) by using a Precellys Homogenizer (VWR), followed by 30 minutes centrifugation at 25,000g. Protein concentration in the resulting supernatants was determined by using BCA assay (Thermo Fisher Scientific). IgG2a concentration was quantified by a mouse IgG2a specific ELISA. Therefore, rat anti mouse IgG2a (BD Bioscience) was diluted in PBS to 1 g/ml and immobilized on polystyrene 96-well microtiter plates overnight at 4 C. Blocking occurred for 2 hours at room temperature with ELISA Blocker (Thermo Fisher Scientific). For preparation of the standard curve, recombinant IgG2a subtype K11 was serially diluted with ELISA Blocker+Tween (Thermo Fisher Scientific) from 500 ng/ml down to 0.7 ng/ml and added to the wells in duplicate. Two wells filled with ELISA Blocker+Tween represent the standard curve value 0 pg/ml. After an incubation period of 2 hours at room temperature, plates were washed three times with TBS-T. For detection of bound IgG2a molecules, goat anti mouse HRP (KPL) was diluted 1:5000 in ELISA Blocker +Tween and incubated for 1 hour at 4 C. with the samples. For color reaction and calculation of standard curve see isoAsp7-A specific ELISA (Example 6).
Results
[0227]
Example 9: Application of K11 in a 5FAD Mouse Model38 Weeks of Treatment
Methods
[0228] In contrast to Example 7, three month old 5FAD mice were treated for 38 weeks with 300 g K11, 300 g 3D6 and 300 g isotype control. Positive control antibody 3D6 was purified after expression in the Murine Hybridoma Cell Line RB96 3D6.32.2.4 (ATCC). Because 12 month old 5FAD mice show significant memory deficits in comparison to wildtype animals, in addition to ELISAs (see Example 6), behavior tests were performed. To preclude any influence of our isotype control antibody, wildtype mice have also been treated with 300 g isotype control per week.
Elevated Plus Maze (EPM)
[0229] EPM is a test for the measurement of anxiety, based on the test animal's aversion to open spaces. Test animals were placed with their head to the end of a defined closed arm of an elevated, plus-shaped (+) apparatus with two open and two enclosed arms (Bioserve GmbH, Bonn, Germany). During the following 10 minutes, every movement of test animals has been recorded. The time the animals spent in the open arms was summed up in order to calculate % in exposed area.
[0230] A movement was defined as arm entry when the complete animal (except tail) was present in the open arm.
Fear Conditioning (FC)
[0231] FC is a test for the measurement of learning in which an aversive stimulus (electrical shock) is associated with a particular neutral stimulus (a tone). Successful learning will lead to the evocation of state of fear (freezing) by the neutral stimulus alone. Test animals were placed in an automated FearConditioning System (TSE Systems, Bad Homburg, Germany) and submitted to the following procedure: pause (180 s), sound (28 s), electric stimulus (0.7 mA for 2 s). After 24 h, test animals were again placed in the FearConditioning System, left there for 210 s and have been removed. One hour later, animals came back in the container in order to expose them to 180 s pause, followed by 180 s of sound (neutral stimulus). Freezing times during 180 s pause were counted and subtracted from the freezing times during 180 s sound.
Pole Test
[0232] This is a test for the measurement of motor coordination Animals were placed with their head directed to the top of a 50 cm high pole (diameter 1.5 cm). Immediately after unhanding the animal, the amount of time required for the animals to turn around (defined as every single paw is directed to the ground) and reach the ground with every paw were recorded.
Morris Water Maze (MWM) Test
[0233] This is a test for the measurement of spatial learning and memory. Test animals were placed in a circular pool and were required to find an invisible platform that allows them to escape the water. Thereby, the animals use distal cues on the edge of the pool as points of reference to orient themselves. The circular pool is divided into 4 equal quadrants, which can be visually distinguished by the cues. Test animals were placed into the first quadrant and the time was counted until they reached the platform. If they did not reach the platform after 60 s, the mice were led to it. After at least a 5 min rest, test animals were placed into the second quadrant and exposed to the same procedure. The animals were allowed to rest again, followed by putting them in quadrant 3, followed by another rest and then putting them again in quadrant 2. At the end, the time it took the test animals reach the platform was recorded and summed up for every mouse in 4 trials per day.
Results
[0234] T-Per (Tissue Protein Extraction Reagent, Thermo Fisher Scientific) contains a mild detergent and was shown to extract target proteins from various cellular compartments, for example from plasma membrane. Mainly monomeric and oligomeric A peptides are supposed to be present in the T-Per fraction. GdmCl is a strong denaturant of folded protein structures. A peptides from fibrillary structures will be dissolved in the 5 M GdmCl fraction.
[0235]
[0236] The EPM test shows significant differences between wildtype and 5FAD mice treated with isotype control (
[0237] 5FAD animals treated with isotype control show significantly lower freezing times in comparison to the wildtype group in the Fear Conditioning test (
[0238] The Pole test shows significant differences between wildtype and 5FAD mice treated with isotype control (
[0239] 5FAD animals treated with isotype control needed significantly more time until they reached the platform in the MWM test in comparison to the wildtype animals (
Example 10: Inhibition of A Aggregation
Methods
[0240] Peptides were dissolved in hexafluoroisopropanol (HFIP) in order to yield their monomeric form. HFIP was evaporated overnight, A peptides were then dissolved in 1 volume 0.1 M NaOH, followed by addition of 18 volumes PBS and 1 volume 0.1 M HCl. Antibodies K11, 3D6 and isotype control were added subsequently to a final concentration of 5 M, leading to a final concentration of 10 M A peptides. After addition of 200 M ThT (Thioflavin T), fluorescence at 435/485 nm (excitation/emission) was measured in a microplate reader (FluoStar Optima, BMG Labtech) at 37 C. under shaking conditions (600 rpm).
Results
[0241]
Example 11: Humanization of Clone K11 by CDR Grafting
Methods
[0242] The definition of the CDRs in the variable domains of K11 light and heavy chain is in accordance with the Enhanced Chothia Numbering Scheme (http://www.bioinf.org.uk/abs/).
[0243] For grafting, appropriate human framework sequences were identified. These were the human framework sequences with the highest similarity to the non-human antibody and they were identified by performing a Blast analysis on the IMGT germline library (http://www.imgt.org/blast/). The CDRs of the mouse antibody clone K11 were combined with the respective human antibody frameworks to create a humanized antibody. The heavy chain constant region of human IgG1 was used for the intact antibodies. The light chain variable domain was fused to the human kappa chain constant region (Table 5).
TABLE-US-00024 TABLE 5 Antibody framework subfamilies of mouse K11 and humanized K11 antibodies. mouse human 1 human 2 VL IGKV8-21*01 IGKV4-1*01 IGKV3-20*01 VH IGHV2-9*02 IGHV4-4*01 IGHV4-59*01
Example 12: Characterization of Recombinantly Expressed Humanized Antibody K11 Variants
Methods
Cloning
[0244] The sequences of the light and heavy chain of the humanized antibodies were cloned separately into the mammalian expression vector pVITRO-neo. To identify the optimal combination of VL and VH frameworks, different plasmid combinations were used to perform transient expressions in HEK293F cells.
Transient Transfection and Purification
[0245] Transfection was performed in a 15 ml culture medium containing 210.sup.6 HEK293 cells/ml by using 3 g/ml of polyethylenimine (PEI) mixed with a single plasmid combination (1 g/ml for each plasmid). At day six, the supernatant was collected and purified by Protein A chromatography.
Surface Plasmon Resonance measurement
[0246] To prevent mass transfer and avidity effects during measurement, the following procedure was used. First a polyclonal anti-human antibody was coupled to an SPR-Chip and subsequently loaded with the humanized antibody until the RU was more than 1000.
[0247] Kinetic measurement was performed at different concentrations (of 5 to 1000 nM) of isoD7-A(1-18) peptide. The results are evaluated according to a simple 1:1 interaction model (Langmuir fit), which determines the k.sub.off and k.sub.on rate constants (Table 6).
Results
[0248]
TABLE-US-00025 TABLE 6 Antigen binding of different humanized K11 antibody variants Light chain Heavy chain K.sub.D value hLC11-IGKV4-1 hHC11-IGHV4-4 5.67 nM (SEQ ID NO: 57) (SEQ ID NO: 65) hLC11-IGKV4-1 hHC11-IGHV4-59 14.2 nM (SEQ ID NO: 57) (SEQ ID NO: 67) hLC11-IGKV3-20*01 hHC11-IGHV4-4 10.2 nM (SEQ ID NO: 59) (SEQ ID NO: 65) hLC11-IGKV3-20*01 hHC11-IGHV4-59 18.3 nM (SEQ ID NO: 59) (SEQ ID NO: 67)
[0249] The humanization of K11 by CDR-grafting yielded antibodies that successfully conserved the binding affinity towards SEQ ID NO: 44 of the ancestral mouse antibody K11 (6.3 nM according to Table 2).