INSECTICIDAL COMBINATIONS

20200255482 ยท 2020-08-13

Assignee

Inventors

Cpc classification

International classification

Abstract

New insecticidal nucleotides, peptides, polypeptides, and proteins, and their expression in plants; methods of producing new peptides; new processes and production techniques; new formulations; new organisms; and a process which increases the insecticidal peptide production yield from yeast expression systems. The present invention is also directed to insecticidal peptides we call cysteine rich insecticidal peptides (CRIPS), and mixtures and/or compositions thereof with pore-forming insecticidal proteins (PFIPs). The present invention also describes mixtures and compositions of CRIPs with Bacillus thuringiensis (Bt), and the genes and/or proteins therefrom, in various formulations and combinations, of both genes and peptides, useful for the control of insects.

Claims

1. A mixture comprising two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein the PFIP and CRIP are not fused together.

2. The mixture of claim 1, wherein the PFIP is a Bacillus thuringiensis (Bt) toxin.

3. The mixture of claim 2, wherein the Bt toxin is a parasporal crystal toxin, a secreted protein, a -exotoxin, a 41.9-kDa insecticidal toxin, a sphaericolysin, an alveolysin, or an enhancin-like protein.

4. The mixture of claim 3, wherein the parasporal crystal toxin is a -endotoxin.

5. The mixture of claim 4, wherein the -endotoxin is a Three-domain (3D) Cry family protein, a binary Bin-like family toxin, an ETX_MTX2-like family toxin, a Toxin-10 family toxin, an Aerolysin family toxin, or a cytolysin.

6. The mixture of claim 5, wherein the -endotoxin is a Three-domain (3D) Cry toxin, a mosquitocidal Cry toxin (Mtx), a binary-like (Bin) toxin, or a Cyt toxin.

7. The mixture of claim 6, wherein the -endotoxin is a Three-domain (3D) Cry toxin or a Cyt toxin.

8. The mixture of claim 7, wherein the -endotoxin is selected from the group consisting of: Cry1Aa1, Cry1Aa2, Cry1Aa3, Cry1Aa4, Cry1Aa5, Cry1Aa6, Cry1Aa7, Cry1Aa8, Cry1Aa9, Cry1Aa10, Cry1Aa11, Cry1Aa12, Cry1Aa13, Cry1Aa14, Cry1Aa15, Cry1Aa16, Cry1Aa17, Cry1Aa18, Cry1Aa19, Cry1Aa20, Cry1Aa21, Cry1Aa22, Cry1Aa23, Cry1Aa24, Cry1Aa25, Cry1Ab1, Cry1Ab2, Cry1Ab3, Cry1Ab4, Cry1Ab5, Cry1Ab6, Cry1Ab7, Cry1Ab8, Cry1Ab9, Cry1Ab10, Cry1Ab1, Cry1Ab12, Cry1Ab13, Cry1Ab14, Cry1Ab15, Cry1Ab16, Cry1Ab17, Cry1Ab18, Cry1Ab19, Cry1Ab20, Cry1Ab21, Cry1Ab22, Cry1Ab23, Cry1Ab24, Cry1Ab25, Cry1Ab26, Cry1Ab27, Cry1Ab28, Cry1Ab29, Cry1Ab30, Cry1Ab31, Cry1Ab32, Cry1Ab33, Cry1Ab34, Cry1Ab35, Cry1Ab36, Cry1Ab-like, Cry1Ab-like, Cry1Ab-like, Cry1Ab-like, Cry1Ac1, Cry1Ac2, Cry1Ac3, Cry1Ac4, Cry1Ac5, Cry1Ac6, Cry1Ac7, Cry1Ac8, Cry1Ac9, Cry1Ac10, Cry1Ac11, Cry1Ac12, Cry1Ac13, Cry1Ac14, Cry1Ac15, Cry1Ac16, Cry1Ac17, Cry1Ac18, Cry1Ac19, Cry1Ac20, Cry1Ac21, Cry1Ac22, Cry1Ac23, Cry1Ac24, Cry1Ac25, Cry1Ac26, Cry1Ac27, Cry1Ac28, Cry1Ac29, Cry1Ac30, Cry1Ac31, Cry1Ac32, Cry1Ac33, Cry1Ac34, Cry1Ac35, Cry1Ac36, Cry1Ac37, Cry1Ac38, Cry1Ac39, Cry1Ad1, Cry1Ad2, Cry1Ae1, Cry1Af1, Cry1Ag1, Cry1Ah1, Cry1Ah2, Cry1Ah3, Cry1Ai1, Cry1Ai2, Cry1Aj1, Cry1A-like, Cry1Ba1, Cry1Ba2, Cry1Ba3, Cry1Ba4, Cry1Ba5, Cry1Ba6, Cry1Ba7, Cry1Ba8, Cry1Bb1, Cry1Bb2, Cry1Bb3, Cry1Bc1, Cry1Bd1, Cry1Bd2, Cry1Bd3, Cry1Be1, Cry1Be2, Cry1Be3, Cry1Be4, Cry1Be5, Cry1Bf1, Cry1Bf2, Cry1Bg1, Cry1Bh1, Cry1Bi1, Cry1Bj1, Cry1Ca1, Cry1Ca2, Cry1Ca3, Cry1Ca4, Cry1Ca5, Cry1Ca6, Cry1Ca7, Cry1Ca8, Cry1Ca9, Cry1Ca10, Cry1Ca11, Cry1Ca12, Cry1Ca13, Cry1Ca14, Cry1Ca15, Cry1Cb1, Cry1Cb2, Cry1Cb3, Cry1Cb-like, Cry1Da1, Cry1Da2, Cry1Da3, Cry1Da4, Cry1Da5, Cry1Db1, Cry1Db2, Cry1Dc1, Cry1Dd1, Cry1Ea1, Cry1Ea2, Cry1Ea3, Cry1Ea4, Cry1Ea5, Cry1Ea6, Cry1Ea7, Cry1Ea8, Cry1Ea9, Cry1Ea10, Cry1Ea11, Cry1Ea12, Cry1Eb1, Cry1Fa1, Cry1Fa2, Cry1Fa3, Cry1Fa4, Cry1Fb1, Cry1Fb2, Cry1Fb3, Cry1Fb4, Cry1Fb5, Cry1Fb6, Cry1Fb7, Cry1Ga1, Cry1Ga2, Cry1Gb1, Cry1Gb2, Cry1Gc1, Cry1Ha1, Cry1Hb1, Cry1Hb2, Cry1Hc1, Cry1H-like, Cry1Ia1, Cry1Ia2, Cry1Ia3, Cry1Ia4, Cry1Ia5, Cry1Ia6, Cry1Ia7, Cry1Ia8, Cry1Ia9, Cry1Ia10, Cry1Ia11, Cry1Ia12, Cry1Ia13, Cry1Ia14, Cry1Ia15, Cry1Ia16, Cry1Ia17, Cry1Ia18, Cry1Ia19, Cry1Ia20, Cry1Ia21, Cry1Ia22, Cry1Ia23, Cry1Ia24, Cry1Ia25, Cry1Ia26, Cry1Ia27, Cry1Ia28, Cry1Ia29, Cry1Ia30, Cry1Ia31, Cry1Ia32, Cry1Ia33, Cry1Ia34, Cry1Ia35, Cry1Ia36, Cry1Ia37, Cry1Ia38, Cry1Ia39, Cry1Ia40, Cry1Ib1, Cry1Ib2, Cry1Ib3, Cry1Ib4, Cry1Ib5, Cry1Ib6, Cry1Ib7, Cry1Ib8, Cry1Ib9, Cry1Ib10, Cry1Ib11, Cry1Ic1, Cry1Ic2, Cry1Id1, Cry1Id2, Cry1Id3, Cry1Ie1, Cry1Ie2, Cry1Ie3, Cry1Ie4, Cry1Ie5, Cry1If1, Cry1Ig1, Cry1I-like, Cry1I-like, Cry1Ja1, Cry1Ja2, Cry1Ja3, Cry1Jb1, Cry1Jc1, Cry1Jc2, Cry1Jd1, Cry1Ka1, Cry1Ka2, Cry1La1, Cry1La2, Cry1La3, Cry1Ma1, Cry1Ma2, Cry1Na1, Cry1Na2, Cry1Na3, Cry1Nb1, Cry1-like, Cry2Aa1, Cry2Aa2, Cry2Aa3, Cry2Aa4, Cry2Aa5, Cry2Aa6, Cry2Aa7, Cry2Aa8, Cry2Aa9, Cry2Aa10, Cry2Aa11, Cry2Aa12, Cry2Aa13, Cry2Aa14, Cry2Aa15, Cry2Aa16, Cry2Aa17, Cry2Aa18, Cry2Aa19, Cry2Aa20, Cry2Aa21, Cry2Aa22, Cry2Aa23, Cry2Aa23, Cry2Aa25, Cry2Ab1, Cry2Ab2, Cry2Ab3, Cry2Ab4, Cry2Ab5, Cry2Ab6, Cry2Ab7, Cry2Ab8, Cry2Ab9, Cry2Ab10, Cry2Ab11, Cry2Ab12, Cry2Ab13, Cry2Ab14, Cry2Ab15, Cry2Ab16, Cry2Ab17, Cry2Ab18, Cry2Ab19, Cry2Ab20, Cry2Ab21, Cry2Ab22, Cry2Ab23, Cry2Ab24, Cry2Ab25, Cry2Ab26, Cry2Ab27, Cry2Ab28, Cry2Ab29, Cry2Ab30, Cry2Ab31, Cry2Ab32, Cry2Ab33, Cry2Ab34, Cry2Ab35, Cry2Ab36, Cry2Ac1, Cry2Ac2, Cry2Ac3, Cry2Ac4, Cry2Ac5, Cry2Ac6, Cry2Ac7, Cry2Ac8, Cry2Ac9, Cry2Ac10, Cry2Ac11, Cry2Ac12, Cry2Ad1, Cry2Ad2, Cry2Ad3, Cry2Ad4, Cry2Ad5, Cry2Ae1, Cry2Af1, Cry2Af2, Cry2Ag1, Cry2Ah1, Cry2Ah2, Cry2Ah3, Cry2Ah4, Cry2Ah5, Cry2Ah6, Cry2Ai1, Cry2Aj1, Cry2Ak1, Cry2Al1, Cry2Ba1, Cry2Ba2, Cry3Aa1, Cry3Aa2, Cry3Aa3, Cry3Aa4, Cry3Aa5, Cry3Aa6, Cry3Aa7, Cry3Aa8, Cry3Aa9, Cry3Aa10, Cry3Aa11, Cry3Aa12, Cry3Ba1, Cry3Ba2, Cry3Ba3, Cry3Bb1, Cry3Bb2, Cry3Bb3, Cry3Ca1, Cry4Aa1, Cry4Aa2, Cry4Aa3, Cry4Aa4, Cry4A-like, Cry4Ba1, Cry4Ba2, Cry4Ba3, Cry4Ba4, Cry4Ba5, Cry4Ba-like, Cry4Ca1, Cry4Ca2, Cry4Cb1, Cry4Cb2, Cry4Cb3, Cry4Cc1, Cry5Aa1, Cry5Ab1, Cry5Ac1, Cry5Ad1, Cry5Ba1, Cry5Ba2, Cry5Ba3, Cry5Ca1, Cry5Ca2, Cry5Da1, Cry5Da2, Cry5Ea1, Cry5Ea2, Cry6Aa1, Cry6Aa2, Cry6Aa3, Cry6Ba1, Cry7Aa1, Cry7Aa2, Cry7Ab1, Cry7Ab2, Cry7Ab3, Cry7Ab4, Cry7Ab5, Cry7Ab6, Cry7Ab7, Cry7Ab8, Cry7Ab9, Cry7Ac1, Cry7Ba1, Cry7Bb1, Cry7Ca1, Cry7Cb1, Cry7Da1, Cry7Da2, Cry7Da3, Cry7Ea1, Cry7Ea2, Cry7Ea3, Cry7Fa1, Cry7Fa2, Cry7Fb1, Cry7Fb2, Cry7Fb3, Cry7Ga1, Cry7Ga2, Cry7Gb1, Cry7Gc1, Cry7Gd1, Cry7Ha1, Cry7Ia1, Cry7Ja1, Cry7Ka1, Cry7Kb1, Cry7La1, Cry8Aa1, Cry8Ab1, Cry8Ac1, Cry8Ad1, Cry8Ba1, Cry8Bb1, Cry8Bc1, Cry8Ca1, Cry8Ca2, Cry8Ca3, Cry8Ca4, Cry8Ca5, Cry8Da1, Cry8Da2, Cry8Da3, Cry8Db1, Cry8Ea1, Cry8Ea2, Cry8Ea3, Cry8Ea4, Cry8Ea5, Cry8Ea6, Cry8Fa1, Cry8Fa2, Cry8Fa3, Cry8Fa4, Cry8Ga1, Cry8Ga2, Cry8Ga3, Cry8Ha1, Cry8Hb1, Cry8Ia1, Cry8Ia2, Cry8Ia3, Cry8Ia4, Cry8Ib1, Cry8Ib2, Cry8Ib3, Cry8Ja1, Cry8Ka1, Cry8Ka2, Cry8Ka3, Cry8Kb1, Cry8Kb2, Cry8Kb3, Cry8La1, Cry8Ma1, Cry8Ma2, Cry8Ma3, Cry8Na1, Cry8Pa1, Cry8Pa2, Cry8Pa3, Cry8Qa1, Cry8Qa2, Cry8Ra1, Cry8Sa1, Cry8Ta1, Cry8-like, Cry8-like, Cry9Aa1, Cry9Aa2, Cry9Aa3, Cry9Aa4, Cry9Aa5, Cry9Aa, like, Cry9Ba1, Cry9Ba2, Cry9Bb1, Cry9Ca1, Cry9Ca2, Cry9Cb1, Cry9Da1, Cry9Da2, Cry9Da3, Cry9Da4, Cry9Db1, Cry9Dc1, Cry9Ea1, Cry9Ea2, Cry9Ea3, Cry9Ea4, Cry9Ea5, Cry9Ea6, Cry9Ea7, Cry9Ea8, Cry9Ea9, Cry9Ea10, Cry9Ea11, Cry9Eb1, Cry9Eb2, Cry9Eb3, Cry9Ec1, Cry9Ed1, Cry9Ee1, Cry9Ee2, Cry9Fa1, Cry9Ga1, Cry9-like, Cry10Aa1, Cry10Aa2, Cry10Aa3, Cry10Aa4, Cry10A-like, Cry11Aa1, Cry11Aa2, Cry11Aa3, Cry11Aa4, Cry11Aa5, Cry11Aa-like, Cry11Ba1, Cry11Bb1, Cry11Bb2, Cry12Aa1, Cry13Aa1, Cry13Aa2, Cry14Aa1, Cry14Ab1, Cry15Aa1, Cry16Aa1, Cry17Aa1, Cry18Aa1, Cry18Ba1, Cry18Ca1, Cry19Aa1, Cry19Ba1, Cry19Ca1, Cry20Aa1, Cry20Ba1, Cry20Ba2, Cry20-like, Cry21Aa1, Cry21Aa2, Cry21Aa3, Cry21Ba1, Cry21Ca1, Cry21Ca2, Cry21Da1, Cry21Ea1, Cry21Fa1, Cry21Ga1, Cry21Ha1, Cry22Aa1, Cry22Aa2, Cry22Aa3, Cry22Ab1, Cry22Ab2, Cry22Ba1, Cry22Bb1, Cry23Aa1, Cry24Aa1, Cry24Ba1, Cry24Ca1, Cry24Da1, Cry25Aa1, Cry26Aa1, Cry27Aa1, Cry28Aa1, Cry28Aa2, Cry29Aa1, Cry29Ba1, Cry30Aa1, Cry30Ba1, Cry30Ca1, Cry30Ca2, Cry30Da1, Cry30Db1, Cry30Ea1, Cry30Ea2, Cry30Ea3, Cry30Ea4, Cry30Fa1, Cry30Ga1, Cry30Ga2, Cry31Aa1, Cry31Aa2, Cry31Aa3, Cry31Aa4, Cry31Aa5, Cry31Aa6, Cry31Ab1, Cry31Ab2, Cry31Ac1, Cry31Ac2, Cry31Ad1, Cry31Ad2, Cry32Aa1, Cry32Aa2, Cry32Ab1, Cry32Ba1, Cry32Ca1, Cry32Cb1, Cry32Da1, Cry32Ea1, Cry32Ea2, Cry32Eb1, Cry32Fa1, Cry32Ga1, Cry32Ha1, Cry32Hb1, Cry32Ja1, Cry32Ja1, Cry32Ka1, Cry32La1, Cry32Ma1, Cry32Mb1, Cry32Na1, Cry32Oa1, Cry32Pa1, Cry32Qa1, Cry32Ra1, Cry32Sa1, Cry32Ta1, Cry32Ua1, Cry32Va1, Cry32Wa1, Cry32Wa2, Cry32Xa1, Cry32Ya1, Cry33Aa1, Cry34Aa1, Cry34Aa2, Cry34Aa3, Cry34Aa4, Cry34Ab1, Cry34Ac1, Cry34Ac2, Cry34Ac3, Cry34Ba1, Cry34Ba2, Cry34Ba3, Cry35Aa1, Cry35Aa2, Cry35Aa3, Cry35Aa4, Cry35Ab1, Cry35Ab2, Cry35Ab3, Cry35Ac1, Cry35Ba1, Cry35Ba2, Cry35Ba3, Cry36Aa1, Cry37Aa1, Cry38Aa1, Cry39Aa1, Cry40Aa1, Cry40Ba1, Cry40Ca1, Cry40Da1, Cry41Aa1, Cry41Ab1, Cry41Ba1, Cry41Ba2, Cry41Ca1, Cry42Aa1, Cry43Aa1, Cry43Aa2, Cry43Ba1, Cry43Ca1, Cry43Cb1, Cry43Cc1, Cry43-like, Cry44Aa1, Cry45Aa1, Cry45Ba1, Cry46Aa1, Cry46Aa2, Cry46Ab1, Cry47Aa1, Cry48Aa1, Cry48Aa2, Cry48Aa3, Cry48Ab1, Cry48Ab2, Cry49Aa1, Cry49Aa2, Cry49Aa3, Cry49Aa4, Cry49Ab1, Cry50Aa1, Cry50Ba1, Cry50Ba2, Cry51Aa1, Cry51Aa2, Cry52Aa1, Cry52Ba1, Cry52Ca1, Cry53Aa1, Cry53Ab1, Cry54Aa1, Cry54Aa2, Cry54Ab1, Cry54Ba1, Cry54Ba2, Cry55Aa1, Cry55Aa2, Cry55Aa3, Cry56Aa1, Cry56Aa2, Cry56Aa3, Cry56Aa4, Cry57Aa1, Cry57Ab1, Cry58Aa1, Cry59Ba1, Cry59Aa1, Cry60Aa1, Cry60Aa2, Cry60Aa3, Cry60Ba1, Cry60Ba2, Cry60Ba3, Cry61Aa1, Cry61Aa2, Cry61Aa3, Cry62Aa1, Cry63Aa1, Cry64Aa1, Cry64Ba1, Cry64Ca1, Cry65Aa1, Cry65Aa2, Cry66Aa1, Cry66Aa2, Cry67Aa1, Cry67Aa2, Cry68Aa1, Cry69Aa1, Cry69Aa2, Cry69Ab11, Cry70Aa1, Cry70Ba1, Cry70Bb1, Cry71Aa1, Cry72Aa1, Cry72Aa2, Cry73Aa1, Cry74Aa, Cry75Aa1, Cry75Aa2, Cry75Aa3, Cry76Aa1, Cry77Aa1, or Cry78Aa1, Cyt1Aa1, Cyt1Aa2, Cyt1Aa3, Cyt1Aa4, Cyt1Aa5, Cyt1Aa6, Cyt1Aa7, Cyt1Aa8, Cyt1Aa-like, Cyt1Ab1, Cyt1Ba1, Cyt1Ca1, Cyt1Da1, Cyt1Da2, Cyt2Aa1, Cyt2Aa2, Cyt2Aa3, Cyt2Aa4, Cyt2Ba1, Cyt2Ba2, Cyt2Ba3, Cyt2Ba4, Cyt2Ba5, Cyt2Ba6, Cyt2Ba7, Cyt2Ba8, Cyt2Ba9, Cyt2Ba10, Cyt2Ba11, Cyt2Ba12, Cyt2Ba13, Cyt2Ba14, Cyt2Ba15, Cyt2Ba16, Cyt2Ba-like, Cyt2Bb1, Cyt2Bc1, Cyt2B-like, Cyt2Ca1, and Cyt3Aa1.

9. The mixture of claim 8, wherein the Cry toxin or Cyt toxin has an amino acid sequence according to SEQ ID NOs: 1366-1446.

10. The mixture of claim 3, wherein the Bt toxin is a secreted protein.

11. The mixture of claim 10, wherein the secreted protein is a vegetative insecticidal proteins (Vip), a secreted insecticidal protein (Sip), a Bin-like family protein, or an ETX_MTX2-family protein.

12. The mixture of claim 11, wherein the secreted protein is a Vip.

13. The mixture of claim 12, wherein the Vip is a Vip 1 family protein, a Vip 2 family protein, a Vip 3 family protein, or a Vip 4 family protein.

14. The mixture of claim 13, wherein the Vip is selected from the group consisting of: Vip1Aa1, Vip1Aa2, Vip1Aa3, Vip1Ab1, Vip1Ac1, Vip1Ad1, Vip1Ba1, Vip1Ba2, Vip1Bb1, Vip1Bb2, Vip1Bb3, Vip1Bc1, Vip1Ca1, Vip1Ca2, Vip1Da1, Vip2Aa1, Vip2Aa2, Vip2Aa3, Vip2Ab1, Vip2Ac1, Vip2Ac2, Vip2Ad1, Vip2Ae1, Vip2Ae2, Vip2Ae3, Vip2Af1, Vip2Af2, Vip2Ag1, Vip2Ag2, Vip2Ba1, Vip2Ba2, Vip2Bb1, Vip2Bb2, Vip2Bb3, Vip2Bb4, Vip3Aa1, Vip3Aa2, Vip3Aa3, Vip3Aa4, Vip3Aa5, Vip3Aa6, Vip3Aa7, Vip3Aa8, Vip3Aa9, Vip3Aa10, Vip3Aa11, Vip3Aa12, Vip3Aa13, Vip3Aa14, Vip3Aa15, Vip3Aa16, Vip3Aa17, Vip3Aa18, Vip3Aa19.0, Vip3Aa19, Vip3Aa20, Vip3Aa21, Vip3Aa22, Vip3Aa23, Vip3Aa24, Vip3Aa25, Vip3Aa26, Vip3Aa27, Vip3Aa28, Vip3Aa29, Vip3Aa30, Vip3Aa31, Vip3Aa32, Vip3Aa33, Vip3Aa34, Vip3Aa35, Vip3Aa36, Vip3Aa37, Vip3Aa38, Vip3Aa39, Vip3Aa40, Vip3Aa41, Vip3Aa42, Vip3Aa43, Vip3Aa44, Vip3Aa45, Vip3Aa46, Vip3Aa47, Vip3Aa48, Vip3Aa49, Vip3Aa50, Vip3Aa51, Vip3Aa52, Vip3Aa53, Vip3Aa54, Vip3Aa55, Vip3Aa56, Vip3Aa57, Vip3Aa58, Vip3Aa59, Vip3Aa60, Vip3Aa61, Vip3Aa62, Vip3Aa63, Vip3Aa64, Vip3Aa65, Vip3Aa66, Vip3Ab1, Vip3Ab2, Vip3Ac1, Vip3Ad1, Vip3Ad2, Vip3Ad3, Vip3Ad4, Vip3Ad5, Vip3Ad6, Vip3Ae1, Vip3Af1, Vip3Af2, Vip3Af3, Vip3Af4, Vip3Ag1, Vip3Ag2, Vip3Ag3, Vip3Ag4, Vip3Ag5, Vip3Ag6, Vip3Ag7, Vip3Ag8, Vip3Ag9, Vip3Ag10, Vip3Ag11, Vip3Ag12, Vip3Ag13, Vip3Ag14, Vip3Ag15, Vip3Ah1, Vip3Ah2, Vip3Ai1, Vip3Aj1, Vip3Aj2, Vip3Ba1, Vip3Ba2, Vip3Bb1, Vip3Bb2, Vip3Bb3, Vip3Bc, Vip3Ca1, Vip3Ca2, Vip3Ca3, Vip3Ca4, and Vip4Aa1.

15. The mixture of claim 14, wherein the Vip protein has an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1447-1552.

16. The mixture of claim 2, wherein the Bt toxin is selected from the group consisting of: Bacillus thuringiensis var. israelensis (Bti) toxin; Bacillus thuringiensis var. kurstaki (Btk) toxin; Bacillus thuringiensis var. tenebrionis (Btt) toxin; Bacillus thuringiensis var. aizawai toxin; Bacillus thuringiensis var. aizawai/pacificus toxin; Bacillus thuringiensis var. alesti toxin; Bacillus thuringiensis var. amagiensis toxin; Bacillus thuringiensis var. andalousiensis toxin; Bacillus thuringiensis var. argentinensis toxin; Bacillus thuringiensis var. asturiensis toxin; Bacillus thuringiensis var. azorensis toxin; Bacillus thuringiensis var. balearica toxin; Bacillus thuringiensis var. berliner toxin; Bacillus thuringiensis var. bolivia toxin; Bacillus thuringiensis var. brasilensis toxin; Bacillus thuringiensis var. cameroun toxin; Bacillus thuringiensis var. canadensis toxin; Bacillus thuringiensis var. chanpaisis toxin; Bacillus thuringiensis var. chinensis toxin; Bacillus thuringiensis var. colmeri toxin; Bacillus thuringiensis var. coreanensis toxin; Bacillus thuringiensis var. dakota toxin; Bacillus thuringiensis var. darmstadiensis toxin; Bacillus thuringiensis var. dendrolimus toxin; Bacillus thuringiensis var. entomocidus toxin; Bacillus thuringiensis var. entomocidus/subtoxicus toxin; Bacillus thuringiensis var. finitimus toxin; Bacillus thuringiensis var. fukuokaensis toxin; Bacillus thuringiensis var. galechiae toxin; Bacillus thuringiensis var. galleriae toxin; Bacillus thuringiensis var. graciosensis toxin; Bacillus thuringiensis var. guiyangiensis toxin; Bacillus thuringiensis var. higo toxin; Bacillus thuringiensis var. huazhongensis toxin; Bacillus thuringiensis var. iberica toxin; Bacillus thuringiensis var. indiana toxin; Bacillus thuringiensis var. israelensis/tochigiensis toxin; Bacillus thuringiensis var. japonensis toxin; Bacillus thuringiensis var. jegathesan toxin; Bacillus thuringiensis var. jinghongiensis toxin; Bacillus thuringiensis var. kenyae toxin; Bacillus thuringiensis var. kim toxin; Bacillus thuringiensis var. kumamtoensis toxin; Bacillus thuringiensis var. kunthalanags3 toxin; Bacillus thuringiensis var. kunthalaRX24 toxin; Bacillus thuringiensis var. kunthalaRX27 toxin; Bacillus thuringiensis var. kunthalaRX28 toxin; Bacillus thuringiensis var. kyushuensis toxin; Bacillus thuringiensis var. leesis toxin; Bacillus thuringiensis var. londrina toxin; Bacillus thuringiensis var. malayensis toxin; Bacillus thuringiensis var. medellin toxin; Bacillus thuringiensis var. mexicanensis toxin; Bacillus thuringiensis var. mogi toxin; Bacillus thuringiensis var. monterrey toxin; Bacillus thuringiensis var. morrisoni toxin; Bacillus thuringiensis var. muju toxin; Bacillus thuringiensis var. navarrensis toxin; Bacillus thuringiensis var. neoleonensis toxin; Bacillus thuringiensis var. nigeriensis toxin; Bacillus thuringiensis var. novosibirsk toxin; Bacillus thuringiensis var. ostriniae toxin; Bacillus thuringiensis var. oswaldocruzi toxin; Bacillus thuringiensis var. pahangi toxin; Bacillus thuringiensis var. pakistani toxin; Bacillus thuringiensis var. palmanyolensis toxin; Bacillus thuringiensis var. pingluonsis toxin; Bacillus thuringiensis var. pirenaica toxin; Bacillus thuringiensis var. poloniensis toxin; Bacillus thuringiensis var. pondicheriensis toxin; Bacillus thuringiensis var. pulsiensis toxin; Bacillus thuringiensis var. rongseni toxin; Bacillus thuringiensis var. roskildiensis toxin; Bacillus thuringiensis var. san diego toxin; Bacillus thuringiensis var. seoulensis toxin; Bacillus thuringiensis var. shandongiensis toxin; Bacillus thuringiensis var. silo toxin; Bacillus thuringiensis var. sinensis toxin; Bacillus thuringiensis var. sooncheon toxin; Bacillus thuringiensis var. sotto toxin; Bacillus thuringiensis var. sotto/dendrolimus toxin; Bacillus thuringiensis var. subtoxicus toxin; Bacillus thuringiensis var. sumiyoshiensis toxin; Bacillus thuringiensis var. sylvestriensis toxin; Bacillus thuringiensis var. thailandensis toxin; Bacillus thuringiensis var. thompsoni toxin; Bacillus thuringiensis var. thuringiensis toxin; Bacillus thuringiensis var. tochigiensis toxin; Bacillus thuringiensis var. toguchini toxin; Bacillus thuringiensis var. tohokuensis toxin; Bacillus thuringiensis var. tolworthi toxin; Bacillus thuringiensis var. toumanoffi toxin; Bacillus thuringiensis var. vazensis toxin; Bacillus thuringiensis var. wratislaviensis toxin; Bacillus thuringiensis var. wuhanensis toxin; Bacillus thuringiensis var. xiaguangiensis toxin; Bacillus thuringiensis var. yosoo toxin; Bacillus thuringiensis var. yunnanensis toxin; Bacillus thuringiensis var. zhaodongensis toxin; and Bacillus thuringiensis var. konkukian toxin.

17. The mixture of claim 1, wherein the PFIP is a Bacillus thuringiensis (Bt) toxin.

18. The mixture of claim 17, wherein the Bt toxin is a Bacillus thuringiensis var. israelensis (Bti) toxin.

19. The mixture of claim 18, wherein Bti toxin is a Bacillus thuringiensis ssp. israelensis Strain BMP 144 Bti toxin.

20. The mixture of claim 17, wherein the Bt toxin is a Bacillus thuringiensis var. kurstaki (Btk) toxin.

21. The mixture of claim 20, wherein Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin.

22. The mixture of claim 17, wherein the Bt toxin is a Bacillus thuringiensis var. tenebrionis (Btt) toxin.

23. The mixture of claim 22, wherein Btt toxin is a Bacillus thuringiensis ssp. tenebrionis strain NB-176 Btt toxin.

24. The mixture of any one of claims 1-23, wherein the CRIP is an atracotoxin (ACTX), a ctenitoxin (CNTX), an Av2 toxin, an Av3 toxin, or an Av3-Variant Polypeptide (AVP).

25. The mixture of claim 24, wherein the CRIP is an ACTX.

26. The mixture of claim 25, wherein the ACTX is a U-ACTX peptide, an Omega-ACTX peptides, a Kappa-ACTX peptide, or a variant thereof.

27. The mixture of claim 26, wherein the ACTX is a U-ACTX-Hv1a, a U+2-ACTX-Hv1a, a rU-ACTX-Hv1a, a rU-ACTX-Hv1b, a r-ACTX-Hv1c, a -ACTX-Hv1a, a -ACTX-Hv1a+2, or a variant thereof.

28. The mixture of claim 27, wherein the ACTX has an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 5-6, 24, 534-635, 650-673, 724-728, 763-773, 866-867, 874-876, 878-886, 913-925, 958-992, 1038-42, 1104-1106, 1110-1118, 1141-1157, 1159-1210, 1553-1593, or 1776-1777.

29. The mixture of claim 28, wherein the ACTX has an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 5, 6, 1776, or 1777.

30. The mixture of claim 29, wherein the ACTX has an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 5.

31. The mixture of claim 24, wherein the CRIP is a ctenitoxin (CNTX).

32. The mixture of claim 31, wherein the CNTX is -CNTX-Pn1a.

33. The mixture of claim 32, wherein the -CNTX-Pn1a has an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1778.

34. The mixture of claim 24, wherein the Av2 toxin has an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1779.

35. The mixture of claim 34, wherein the Av3 toxin has an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1780.

36. The mixture of claim 24, wherein the Av3-Variant Polypeptide (AVP) has an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 1781 or 1782.

37. The mixture of claim 1, wherein the CRIP is an U+2-ACTX-Hv1a having an amino acid sequence set forth in SEQ ID NO: 5; a -CNTX-Pn1a having an amino acid sequence set forth in SEQ ID NO: 1778; or an Av3-Variant Polypeptide (AVP) having an amino acid sequence set forth in SEQ ID NO: 1782.

38. The mixture of claim 1, wherein the ratio of PFIP to CRIP is about 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000.

39. The mixture of claim 38, wherein the ratio of Bti toxin to ACTX is from about 1:1 to about 1:5000.

40. The mixture of claim 39, wherein the ratio of Bti toxin to ACTX is about 1:4000.

41. The mixture of claim 38, wherein the ratio of Btk toxin to ACTX is from about 1:1 to about 1:10.

42. The mixture of claim 41, wherein the ratio of Btk toxin to ACTX is about 1:9.2

43. The mixture of claim 38, wherein the ratio of Btk toxin to Av3 is from about 1:1 to about 1:1.5.

44. The mixture of claim 38, wherein the ratio of Btk toxin to AVP is about 1:1.375.

45. The mixture of claim 38, wherein the ratio of Btt toxin to ACTX is from about 1:1 to about 1:10.

46. The mixture of claim 45, wherein the ratio of Btt toxin to ACTX is about 1:8.75.

47. A composition comprising the mixture of claim 1, and an excipient.

48. The mixture of claim 1, wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. tenebrionis (Btt) toxin; and wherein the second type of insecticidal peptide is an ACTX peptide.

49. The mixture of claim 48, wherein the Btt toxin is a Bacillus thuringiensis ssp. tenebrionis strain NB-176 Btt toxin; and wherein the ACTX peptide is a U+2-ACTX-Hv1a toxin (SEQ ID NO: 5).

50. The mixture of claim 1, wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. kurstaki (Btk) toxin; and wherein the second type of insecticidal peptide is an ACTX peptide.

51. The mixture of claim 50, wherein the Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin; and wherein the ACTX peptide is a U+2-ACTX-Hv1a toxin (SEQ ID NO: 5).

52. The mixture of claim 1, wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. kurstaki (Btk toxin); and wherein the second type of insecticidal peptide is a CNTX.

53. The mixture of claim 52, wherein the Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin; and wherein the CNTX is a -CNTX-Pn1a toxin (SEQ ID NO: 1778).

54. The mixture of claim 1, wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. kurstaki (Btk) toxin; and wherein the second type of insecticidal peptide is a Av3-Variant Polypeptide (AVP).

55. The mixture of claim 1, wherein the Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin; and wherein the AVP is an Av3-Variant Polypeptide (AVP) having an amino acid sequence as set forth in SEQ ID NO: 1782.

56. The mixture of claim 1, wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. israelensis (Bti) toxin; and wherein the second type of insecticidal peptide is an ACTX peptide.

57. The mixture of claim 56, wherein the Bti toxin is a Bacillus thuringiensis ssp. israelensis Strain BMP 144 Bti toxin; and wherein the ACTX peptide is a U+2-ACTX-Hv1a toxin (SEQ ID NO: 5).

58. A method of using the mixture of claim 1 to control insects comprising, providing a mixture of at least two types of peptides, wherein the first type of peptide is a PFIP, and the second type of peptide is a CRIP, wherein the PFIP is selected from one or any combination of the PFIPs of claims 2-23; and wherein the CRIP is selected from the one or any combination of the CRIPs of claims 24-36; wherein the PFIP is not fused to the CRIP; and then applying said mixture to the locus of an insect.

59. The method of claim 58, wherein the insects are selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydia pomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

60. A method of using the mixture of claim 1 to control Bacillus thuringiensis-toxin-resistant insects comprising, providing a mixture of at least two types of peptides, wherein the first type of peptide is a PFIP, and the second type of peptide is a CRIP, wherein the PFIP is selected from one or any combination of the PFIPs of claims 2-23; and wherein the CRIP is selected from the one or any combination of the CRIPs of claims 24-36; wherein the PFIP is not fused to the CRIP; and then applying said mixture to the locus of an insect.

61. The method of claim 60, wherein the Bacillus thuringiensis-toxin-resistant insects are selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

62. A method of protecting a plant from an insect comprising, providing a plant which expresses two or more polypeptides, wherein one type of polypeptide is a PFIP, or a polynucleotide encoding the same; and the other type of polypeptide is a CRIP, or polynucleotide encoding the same; and wherein the PFIP is not fused to the CRIP.

63. The method of claim 62, wherein the insect is selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydia pomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

64. A method of protecting a plant from a Bacillus thuringiensis-toxin-resistant insect comprising, providing a plant which expresses two or more polypeptides, wherein one type of polypeptide is a PFIP, or a polynucleotide encoding the same; and the other type of polypeptide is a CRIP, or polynucleotide encoding the same; and wherein the PFIP is not fused to the CRIP.

65. The method of claim 64, wherein the Bacillus thuringiensis-toxin-resistant insects are selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

66. A method for controlling insects comprising, providing to said insect a transgenic plant that comprises in its genome a stably incorporated nucleic acid construct, wherein said stably incorporated nucleic acid construct comprises a first polynucleotide operable to encode a PFIP, and a second polynucleotide operable to encode a CRIP.

67. A method of combating, controlling, or inhibiting a pest comprising, applying a pesticidally effective amount of the mixture of claim 1 to the locus of the pest, or to a plant or animal susceptible to an attack by the pest.

68. The method of claim 67, wherein the pest is selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydia pomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

69. The method of claim 68, wherein the pest is selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens, Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0030] FIG. 1 is a diagram of invention of N-terminal fusion of ERSP (Endoplasmic Reticulum Signal Peptide in diagonal stripes) to a CRIP (Cysteine Rich Insecticidal Protein) such as ICK (Inhibitor Cysteine Knot) motif in vertical stripes).

[0031] FIG. 2 is a diagram of invention of N-terminal fusion of ERSP (diagonal stripes) to an CRIP motif insecticidal protein (vertical stripes) that is fused with a STA (Translational Stabilizing Protein in horizontal stripes). There are two possible orientations shown in FIG. 2.

[0032] FIG. 3 is a diagram of invention of N-terminal fusion of ERSP (diagonal stripes) fused to a CRIP motif (vertical stripes) that is fused with a translational stabilizing protein (STA) shown in horizontal stripes. The STA is separated from the CRIP motif by an intervening sequence called an intervening linker peptide (LINKER) shown in checkerboard. Two possible orientations are shown in FIG. 3.

[0033] FIG. 4 is a diagram similar to FIG. 3 with the (LINKER-CRIP) motif with the subscript letter N to show that the LINKER-CRIP motif can be used once or repeated several time, preferably from 1-10 repeats and even more up to 15, 20 or 25 times are possible.

[0034] FIG. 5 is a diagram that shows that the CRIP-LINKER or ICK-LINKER group can also function as a STA-LINKER group. In other words, the combination of CRIP-LINKER or ICK-LINKER can function as a STA-LINKER. In other words one can use two ICK motifs with one LINKER and dispense with the need for a Translational Stabilizing Protein or STA.

[0035] FIG. 6 is a diagram of a covalent cross-linking of the cysteines in an inhibitor cysteine knot (ICK) motif protein. The arrows in the diagram represent sheets; the numbers represent the ICK motif-forming cystine amino acids, numbered in the order of their occurrence in the primary structure from N to C terminus. The thick curved line represents the primary structure of the protein; the thin straight lines represent the covalent cross-linking of the specific cysteines to create an ICK motif. Sometimes the sheet encompassing cysteine number 2 is not present.

[0036] FIG. 7 is a graph of the ELISA detected levels of ACTX (as a percentage of Total Soluble Protein (% TSP) resulting from expression from plant transgenes encoding ACTX as a translational fusion with the various other structural elements.

[0037] FIG. 8 is a graph of iELISA detected % TSPs of tobacco transiently expressed GFP fused U-ACTX-Hv1a with different accumulation localization. APO: apoplast localization; CYTO: cytoplasm localization; ER: endoplasm reticulum localization.

[0038] FIG. 9 is a graph of iELISA detected % TSPs of tobacco leaves transiently expressing GFP fused U-ACTX-Hv1a using the FECT expression vectors encoding translational fusions with three different ERSP sequences: BAAS signal peptide (BGIH), Extensin signal peptide (EGIH) and modified Extensin signal peptide (E*GIH).

[0039] FIG. 10 is a diagram of the concentration process of trypsin treated and non-trypsin treated Jun a 3 fused Omega-ACTX-Hv1a protein extracted from the transiently transformed tobacco leaves.

[0040] FIG. 11 depicts HPLC chromatographs for the samples containing omega-ACTX-Hv1a samples loaded on the HPLC system to produce the chromatographs were as follows: A. 25 g synthetic omega-ACTX-Hv1a; B. 500 L of Sample B 1 kD filtration retentate; C. 500 L of Sample A 1 kD filtration retentate.

[0041] FIG. 12 is a graphical representation of the distribution of the normalized peptide yields of both U+2-ACTX-Hv1a (sometimes referred to herein as U+2) and native U-ACTX-Hv1a (sometimes referred to herein as native U), produced in Kluyveromyces lactis (K. lactis) strains. The U+2 data is shown in black and the native U data is in gray. The x-axis shows the normalized yield in units of milligrams per liter per light absorbance unit at wavelength of 600 nm (mg/L.Math.A.) The left y-scale shows the fraction of U+2 strains. The right y-scale shows the fraction of native U strains.

[0042] FIG. 13 is another graphical representation of the distribution of the normalized peptide yields from U+2 and native U-ACTX-Hv1a K. lactis strains. Here the y-axis shows the normalized yield (normalized for cell density in the respective cultures as described below) in milligrams per liter per light absorbance unit at wavelength of 600 nm (mg/L.Math.A.) for individual strains, and the x-axis corresponds to the percentile rank of the observed yield for each strain, in relation to the yield observed for all other K. lactis strains engineered to produce the same peptide isoform.

[0043] FIG. 14 is a graphical representation of the dose-response of housefly injection bioassays with U+2 and native U-ACTX-Hv1a. The U+2 data is marked with black round dots and the native U data is marked with gray triangles. The x-scale shows the dose in units of picomoles per gram of housefly. The y-scale shows the mortality percentage.

[0044] FIG. 15 is a graphical representation of the distribution of the peptide yields from U+2 and native U-ACTX-Hv1a produced from Pichia pastoris (P. pastoris) strains. The U+2 data is shown in black and the native U data is in gray. The x-axis shows the yield in milligrams per liter and the y-scale shows the fraction of total U+2 or native U production from P. pastoris strains.

[0045] FIG. 16 is another graphical representation of the distribution of the peptide yields of U+2 and native U-ACTX-Hv1a produced from P. pastoris strains. Here the y-axis shows the yield in milligrams per liter for individual strains, and the x-axis corresponds to the percentile rank of the observed yield for each strain (in relation to the yields observed for all other P. pastoris strains engineered to produce the same peptide isoform).

[0046] FIG. 17 is a graphical representation of the distribution of the peptide yields of sea anemone toxin, Av3 and Av3+2, produced from the K. lactis expression strains. The native toxin is named Av3 from the sea anemone named Anemonia viridis. The modified toxin here is labeled Av3+2. Like the example above we produced the toxic peptides in strains of Kluyveromyces lactis or K. lactis. The x-axis shows the peptide yield in mAu.Math.sec/A for individual strains, and the y-axis shows the fraction of the strains. In FIG. 17 the native Av3 strain is shown in light grey, the modified high production strain Av3+2 is shown in black.

[0047] FIG. 18 shows the difference in the peptide yields of Av3+2 and native Av3 produced from the corresponding K. lactis strains by plotting the peptide yields as a function of the percentile rank of the transformants which produce the same peptide. Here the y-axis shows the normalized yield in mAu.Math.sec/A for individual strains, and the x-axis corresponds to the percentile rank of the observed yield for each strain, in relation to the yield observed for all other K. lactis strains engineered to produce the same peptide isoform.

[0048] FIG. 19 depicts a graph of a foliar bioassay 24 hour percent mortality vs. age of larvae after application and exposure to ICK peptides or Bt proteins.

[0049] FIG. 20 shows a graph of a foliar bioassay measuring percent mortality at 18, 24 and 48 hour post application using Bt proteins or ICK peptides or combination of Bt+ICK peptides on 72 hour larvae.

[0050] FIG. 21 shows a graph of a foliar feeding bioassay measuring foliar damage by insects resistant to Bt, at 24 hr and 48 hr after exposure to Bt proteins or Non-ICK CRIP or their combinations.

[0051] FIG. 22 depicts a graph of a foliar feeding bioassay measuring percent mortality at 24 and 48 hour post application using Bt proteins or ICK peptides or their combination on Bt protein resistant P. xylostella larvae.

[0052] FIG. 23 shows a graph depicting the 24-hour mortality of mosquito larvae after a after a diet incorporation assay using (1) U+2-ACTX-Hv1a with Bti; (2) Bti toxin alone; (3) U+2-ACTX-Hv1a alone; and (4) water (as an untreated control).

[0053] FIG. 24 depicts a graph showing the 3-day mortality of the Lepidopteran species, the beet armyworm (Spodoptera exigua) after a diet incorporation assay with Bacillus thuringiensis var. kurstaki toxins (Btk) combined with -CNTX-Pn1a. Here, the treatments were (1) -CNTX-Pn1a alone; (2) Btk toxin alone; (3) a combination of -CNTX-Pn1a and Btk toxin; or (4) a control (0.125% Vintre, a surfactant).

[0054] FIG. 25 depicts a graph showing the 3-day mortality of the Lepidopteran species, the beet armyworm (Spodoptera exigua), after a diet incorporation assay with Btk combined with Av3b-Variant Polypeptides (AVPs). Here, (1) AVP alone; (2) Btk toxin alone; (3) a combination of both AVP and Btk toxin; or (4) a control (0.125% Vintre, a surfactant) were tested.

[0055] FIG. 26 depicts a graph showing the 4-day mortality of the Coleopteran species, the Darkling Beetle (Alphitobius diaperinus) after a diet incorporation assay with (1) U+2-ACTX-Hv1a alone; (2) Btt toxin alone; (3) a combination of both U+2-ACTX-Hv1a and Btt toxin; or (4) an untreated control (water).

[0056] FIG. 27 depicts a graph showing the 4-day mortality of the Colorado potato beetle (Leptinotarsa decemlineata) when sprayed with (1) U+2-ACTX-Hv1a alone; (2) Btt toxin alone; (3) a combination of both U+2-ACTX-Hv1a and Btt toxin; or (4) an untreated control (water).

BRIEF DESCRIPTION OF THE SEQUENCE LISTING

[0057] This invention includes a sequence listing of 1637 sequences.

[0058] SEQ ID NOs: 1-28, 1553-1570, and 1593 are mentioned or referred to in Part 1.

[0059] SEQ ID NOs: 29-32, and 1571-1592 are mentioned or referred to in Part 2.

[0060] SEQ ID NOs: 33-1042 are mentioned or referred to in Part 3.

[0061] SEQ ID NOs: 1043-1221 are sequences derived from or having a spider origin.

[0062] SEQ ID NOs: 1222-1262 are sequences derived from or having a sea anemone origin.

[0063] SEQ ID NOs: 1263-1336 are sequences derived from or having a scorpion origin.

[0064] SEQ ID NOs: 1337-1365 are sequences derived from or having a scorpion origin.

[0065] SEQ ID NOs: 1366-1446 are sequences derived from or having a Cry or Cyt origin.

[0066] SEQ ID NOs: 1447-1552 are sequences derived from or having a VIP origin.

[0067] SEQ ID NOs: 1553-1775 are sequences derived from or having an arachnid origin

[0068] SEQ ID NOs: 1776 and 1777 are wild-type Kappa-AcTx-Hv1c and wild-type Omega-HXTX-Ar1d amino acid sequences, respectively.

[0069] SEQ ID NO: 1778 is -CNTX-Pn1a.

[0070] SEQ ID NO: 1779-1782 are amino acid sequences of sea anemone toxins and variants thereof.

DETAILED DESCRIPTION

Definitions

[0071] The term 5-end and 3-end refers to the directionality, i.e., the end-to-end orientation of a nucleotide polymer (e.g., DNA). The 5-end of a polynucleotide is the end of the polynucleotide that has the fifth carbon.

[0072] ACTX or ACTX peptide means a Family of insecticidal ICK peptides that have been isolated from an Australian funnel-web spiders belonging to the Atracinae subfamily. One such spider is known as the Australian Blue Mountains Funnel-web Spider, which has the scientific name Haydronyche versuta. Two examples of ACTX peptides from this species are the Omega and U peptides.

[0073] Alpha-MF signal or MF secretion signal refers to a protein that directs nascent recombinant polypeptides to the secretory pathway.

[0074] Agent refers to one or more chemical substances, molecules, nucleotides, polynucleotides, peptides, polypeptides, proteins, poisons, insecticides, pesticides, organic compounds, inorganic compounds, prokaryote organisms, or eukaryote organisms, and agents produced therefrom.

[0075] Agriculturally-acceptable carrier covers all adjuvants, inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in pesticide formulation technology; these are well known to those skilled in pesticide formulation.

[0076] Agroinfection means a plant transformation method where DNA is introduced into a plant cell by using Agrobacteria A. tumefaciens or A. rhizogenes.

[0077] BAAS means barley alpha-amylase signal peptide. It is an example of an ERSP.

[0078] Biomass refers to any measured plant product.

[0079] Binary vector or binary expression vector means an expression vector which can replicate itself in both E. coli strains and Agrobacterium strains. Also, the vector contains a region of DNA (often referred to as t-DNA) bracketed by left and right border sequences that is recognized by virulence genes to be copied and delivered into a plant cell by Agrobacterium.

[0080] Bt, also known as Bacillus thuringiensis or B. thuringiensis, means a gram-positive soil bacterium that has been used worldwide for more than sixty years to control agricultural, forestry, and public health insect pests.

[0081] Bt proteins and Bt peptides or Bt toxic peptides are used interchangeably and refer to peptides produced by Bt. Such peptides are frequently written as cry, cyt or VIP proteins encoded by the cry, cyt and vip genes. Bt proteins are more usually attributed to insecticidal crystal proteins encoded by the cry genes, and are also examples of PFIPS (Pore Forming Insecticidal Proteins) see definition below. Examples PFIPS and other Bt proteins are provided in the sequence listing. For example, in some embodiments, a Bt toxic peptide can be Cry1, Cry1A, Cry1B, Cry1C, Cry1Ca, Cry1Cb, Cry1E, Cry1F, Cry1G, Cry2, Cry3, Cry3A, Cry3B, Cry3C, Cry4, Cry5, Cry6, Cry7, Cry8, Cry8Aa, Cry9, Cry10, Cry11, Cry12, Cry13, Cry14, Cry16, Cry17, Cry18, Cry21, Cry22, Cry23, Cry23A, Cry26, Cry28, Cry29Aa, Cry31, Cry34, Cry35, Cry37, Cry37A, Cry43, Cry48, Cry49, CryET70, CryET76, CryET80, Cyt1, and Cyt2.

[0082] C-terminal refers to the free carboxyl group (i.e., COOH) that is positioned on the terminal end of a polypeptide.

[0083] Chimeric gene means a DNA sequence that encodes a gene derived from portions of one or more coding sequences to produce a new gene.

[0084] Cleavable linker means a short peptide sequence in the protein that is the target site of proteases that can cleave and separate the protein into two parts or a short DNA sequence that is placed in the reading frame in the ORF and encoding a short peptide sequence in the protein that is the target site of protease that can cleave and separate the protein into two parts.

[0085] Cloning refers to the process and/or methods concerning the insertion of a DNA segment (e.g., usually a gene of interest, for example a gene encoding a heterologous polypeptide of interest) from one source and recombining it with a DNA segment from another source (e.g., usually a vector, for example, a plasmid) and directing the recombined DNA, or recombinant DNA to replicate, usually by transforming the recombined DNA into a bacteria or yeast host.

[0086] Conditioned medium means the cell culture medium which has been used by cells and is enriched with cell derived materials but does not contain cells.

[0087] Conversion or converted refers to the process of making a high-production peptide.

[0088] CRIP and CRIPS is an abbreviation for Cysteine Rich Insecticidal Protein or Proteins. Cysteine rich insecticidal peptides (CRIPS) are peptides rich in cysteine which form disulfide bonds. CRIPS contain at least four (4), sometimes six (6), and sometimes eight (8) cysteine amino acids among proteins or peptides having at least 10 amino acids where the cysteines form two (2), three (3) or four (4) disulfide bonds. The disulfide bonds contribute to the folding, three-dimensional structure, and activity of the insecticidal peptide. The cysteine-cysteine disulfide bonds and the three dimensional structure they form play a significant role in the toxicity of these insecticidal peptides. A CRIP is exemplified by both inhibitor cystine knot or ICK peptides (usually having 6-8 cysteines) and by examples of toxic peptides having disulfide bonds but that are not considered ICK peptides (Non-ICK CRIPS). Examples of an ICK would be an ACTX peptide from a spider and defined above. Examples of a Non-ICK CRIP would be a peptide like Av2 and Av3 which are peptides first identified from sea anemones. These peptides are examples of a class of compounds that modulate sodium channels in the insect peripheral nervous system (PNS). Non-ICK CRIPS can have 4-8 cysteines which form 2-4 disulfide bonds. These cysteine-cysteine disulfide bonds stabilized toxic peptides (CRIPS) can have remarkable stability when exposed to the environment. Many CRIPS are isolated from venomous animals such as spiders, scorpions, snakes and sea snails and sea anemones and they are toxic to insects. Additional description is provided below.

[0089] Cysteine-Rich Bioactive Peptides (CRBPs) refers to peptides, polypeptides, and/or proteins that possess cysteine residues capable of forming disulfide bonds; these disulfide bonds create a scaffolding motif that is observed in a wide variety of unrelated protein families. In some embodiments, a CRBP comprises 2 to 8 cystines. In some embodiments, a CRBP comprises 2 to 6 cystines. In some embodiments, a CRBP has a molecular weight of 10 kDa or lower.

[0090] Cystine refers to an oxidized cysteine-dimer. Cystines are sulfur-containing amino acids obtained via the oxidation of two cysteine molecules, and are linked with a disulfide bond.

[0091] Defined medium means a medium that is composed of known chemical components but does not contain crude proteinaceous extracts or by-products such as yeast extract or peptone.

[0092] Disulfide bond means a covalent bond between two cysteine amino acids derived by the coupling of two thiol groups on their side chains.

[0093] Double expression cassette refers to two heterologous polypeptide expression cassettes contained on the same vector.

[0094] Double transgene peptide expression vector or double transgene expression vector means a yeast expression vector that contains two copies of the heterologous polypeptide expression cassette.

[0095] DNA refers to deoxyribonucleic acid, comprising a polymer of one or more deoxyribonucleotides or nucleotides (i.e., adenine [A], guanine [G], thymine [T], or cytosine [C]), which can be arranged in single-stranded or double-stranded form. For example, one or more nucleotides creates a polynucleotide.

[0096] dNTPs refers to the nucleoside triphosphates that compose DNA and RNA.

[0097] ELISA or iELISA means a molecular biology protocol in which the samples are fixed to the surface of a plate and then detected as follows: a primary antibody is applied followed by a secondary antibody conjugated to an enzyme which converts a colorless substrate to colored substrate which can be detected and quantified across samples. During the protocol, antibodies are washed away such that only those that bind to their epitopes remain for detection. The samples, in our hands, are proteins isolated from plants, and ELISA allows for the quantification of the amount of expressed transgenic protein recovered.

[0098] Enhancer element refers to a DNA sequence operably linked to a promoter, which can exert increased transcription activity on the promoter relative to the transcription activity that results from the promoter in the absence of the enhancer element.

[0099] Expression cassette refers to a segment of DNA that contains one or more (1) promoter and/or enhancer elements; (2) an appropriate mRNA stabilizing polyadenylation signal; and/or (3) the DNA sequence of interest, for example, a polynucleotide encoding a heterologous polypeptide (e.g., a CRBP). Additional elements that can included in an expression cassette are cis-acting elements such as an internal ribosome entry site (IRES); introns; and posttranscriptional regulatory elements.

[0100] Expression ORF means a nucleotide encoding a protein complex and is defined as the nucleotides in the ORF.

[0101] ER or Endoplasmic reticulum is a subcellular organelle common to all eukaryotes where some post translation modification processes occur.

[0102] ERSP or Endoplasmic reticulum signal peptide is an N-terminus sequence of amino acids that during protein translation of the transgenic mRNA molecule is recognized and bound by a host cell signal-recognition particle, which moves the protein translation ribosome/mRNA complex to the ER in the cytoplasm. The result is the protein translation is paused until it docks with the ER where it continues and the resulting protein is injected into the ER.

[0103] ersp refers to a polynucleotide encoding the peptide, ERSP.

[0104] ER trafficking means transportation of a cell expressed protein into ER for post-translational modification, sorting and transportation.

[0105] FECT means a transient plant expression system using Foxtail mosaic virus with elimination of coating protein gene and triple gene block.

[0106] GFP means a green fluorescent protein from the jellyfish Aequorea victoria.

[0107] High Production peptide or HP peptide means a peptide which is capable of being made, or is converted, according to the procedures described herein and which, once converted can be produced at increased yields, or higher rates of production, or in greater than normal amounts, in a biological system. The higher rates of production can be from 20 to 400% or greater than can be achieved with a peptide before conversion, using the same or similar production methods that were used to produce the peptide before conversion.

[0108] Hybrid peptide, aka hybrid toxin, aka hybrid-ACTX-Hv1a, aka native hybrid ACTX-Hv1a, as well as U peptide, aka U toxin, aka native U, aka U-ACTX-Hv1a, aka native U-ACTX-Hv1a, all refer to an ACTX peptide, which was discovered from a spider known as the Australian Blue Mountains Funnel-web Spider, Hydronyche versuta, and is a positive allosteric modulators of the nicotinic acetylcholine receptor, and may also be a dual antagonist to insect voltage-gated Ca.sup.2+ channels and voltage-gated K.sup.+ channels. See Chambers et al., Insecticidal spider toxins are high affinity positive allosteric modulators of the nicotinic acetylcholine receptor. FEBS Lett. 2019 June; 593(12):1336-1350; and Windley et al., Lethal effects of an insecticidal spider venom peptide involve positive allosteric modulation of insect nicotinic acetylcholine receptors. Neuropharmacology. 2017 December; 127:224-242, the disclosures of which are incorporated herein by reference in their entireties.

[0109] IGER means a name for a short peptide, based on its actual sequence of one letter codes. It is an example of an intervening linker.

[0110] ICK motif, or ICK motif protein, or inhibitor cystine knot motif, or Toxic insect ICK peptides, or ICK peptides, or CK peptides, or cystine knot motif, or cystine knot peptides, refers to a 16 to 60 amino acid peptide with at least 6 half-cystine core amino acids having three disulfide bridges, wherein the 3 disulfide bridges are covalent bonds and of the six half-cystine residues the covalent disulfide bonds are between the first and fourth, the second and fifth, and the third and sixth half-cystines, of the six core half-cystine amino acids starting from the N-terminal amino acid. In general this type of peptide comprises a beta-hairpin secondary structure, normally composed of residues situated between the fourth and sixth core half-cystines of the motif, the hairpin being stabilized by the structural crosslinking provided by the motif's three disulfide bonds. Note that additional cysteine/cystine or half-cystine amino acids may be present within the inhibitor cystine knot motif. Examples are provided in the sequence listing.

[0111] ick means a nucleotide encoding an ICK motif protein.

[0112] ICK motif protein expression ORF or expression ORF means a nucleotide encoding an ICK motif protein complex and is defined as the nucleotides in the ORF.

[0113] ICK motif protein expression vector or ICK expression vector, or ICK motif expression vector, means a binary vector which contains an expression ORF. The binary vector also contains the necessary transcription promoter and terminator sequence surrounding the expression ORF to promote expression of the ORF and the protein it encodes.

[0114] Insect means any arthropod and nematode, including acarids, and insects known to infest all crops, vegetables, and trees and includes insects that are considered pests in the fields of forestry, horticulture and agriculture. Examples of specific crops that might be protected with the methods disclosed herein are soybean, corn, cotton, alfalfa and the vegetable crops. A list of specific crops and insects appears towards the end of this document.

[0115] As used herein, the term insecticidal is generally used to refer to the ability of a polypeptide or protein used herein, to increase mortality or inhibit growth rate of insects. As used herein, the term nematicidal refers to the ability of a polypeptide or protein used herein, to increase mortality or inhibit the growth rate of nematodes. In general, the term nematode comprises eggs, larvae, juvenile and mature forms of said organism.

[0116] Insect gut environment or gut environment means the specific pH and proteinase conditions found within the fore, mid or hind gut of an insect or insect larva.

[0117] Insect hemolymph environment means the specific pH and proteinase conditions of found within an insect or insect larva.

[0118] Insecticidal activity means that on or after exposure of the insect to compounds or peptides, the insect either dies, stops or slows its movement or its feeding, stops or slows its growth, fails to pupate, cannot reproduce or cannot produce fertile offspring.

[0119] Insecticidal peptide or Insecticidal protein or toxic peptide or toxic protein means a protein having insecticidal activity when ingested by, in contact with, or injected into an insect. For example, Insecticidal protein can refer to any protein, peptide, polypeptide, amino acid sequence, configuration, or arrangement, comprising one or more insecticidal peptides. For example, an insecticidal protein can refer to an ICK; or an ICK fused with one or more proteins such as a stabilizing domain (STA); an endoplasmic reticulum signaling protein (ERSP); an insect cleavable or insect non-cleavable linker; or an ICK fused to one or more ICKs; and/or any other combination thereof.

[0120] Insecticidal peptide production strain screen means a screening process that identifies the higher-yielding insecticidal peptide production yeast strains from the lower yielding strains. In the described methods herein, it refers to screens that use reverse-phase HPLC or the housefly injection bioassay.

[0121] Integrative expression vector or integrative vector means a yeast expression vector which can insert itself into a specific locus of the yeast cell genome and stably becomes a part of the yeast genome.

[0122] Intervening linker means a short peptide sequence in the protein separating different parts of the protein, or a short DNA sequence that is placed in the reading frame in the ORF to separate the upstream and downstream DNA sequences such that during protein translation the proteins encoded in the DNA can achieve their independent secondary and tertiary structure formation. The intervening linker can be either resistant or susceptible to cleavage in plant cellular environments, in the insect and/or lepidopteran gut environment, and in the insect hemolymph and lepidopteran hemolymph environment.

[0123] Knockdown dose 50 or KD.sub.50 refers to the median dose required to cause paralysis or cessation of movement in 50% of a population, for example a population of Musca domestica (common housefly) and/or Aedes aegypti (mosquito).

[0124] Known peptide means a peptide known to have biological activity and may be a mature peptide or any version or fragment thereof including pre and pro peptides and conjugates of active peptides. A preferred known peptide is one with insecticidal activity.

[0125] L in the proper context means an intervening linker peptide, which links a translational stabilizing protein with an ICK motif protein or a multiple ICK motif protein domain, and links same or different multiple ICK motif protein. When referring to amino acids, L can also mean leucine.

[0126] LAC4 promoter or Lac4 promoter refers to a DNA segment comprised of the promoter sequence derived from the K. lactis -galactosidase gene. The LAC4 promoters is strong and inducible reporter that is used to drive expression of exogenous genes transformed into yeast.

[0127] LAC4 terminator or Lac4 terminator refers to a DNA segment comprised of the transcriptional terminator sequence derived from the K. lactis -galactosidase gene.

[0128] LD.sub.50 refers to lethal dose 50 which means the dose required to kill 50% of a population.

[0129] Linker, or LINKER or in some contexts L refers to a short peptide sequence comprising a binary or tertiary region, wherein each region is cleavable by at least two types of proteases: one of which is an insect and/or nematode protease and the other one of which is a human protease, such that the linker can be separated by both types of protease that can cleave and separate the protein into two parts or a short DNA sequence that is placed in the reading frame in the ORF and encoding a short peptide sequence in the protein that is the target site of an insect and/or nematode and an animal (e.g. human) protease that can cleave and separate the protein into two parts. In some embodiments, the linker links a translational stabilizing protein with an ICK motif protein or a multiple ICK motif protein domain, and links same or different multiple ICK motif proteins. The linker can have one of (at least) three roles: to cleave in the insect gut environment, to cleave in the plant cell, or to be designed not to intentional cleave.

[0130] l or linker means a nucleotide coding for an intervening linker peptide.

[0131] Lepidopteran gut environment means the specific pH and proteinase conditions of found within the fore, mid or hind gut of a lepidopteran insect or larva.

[0132] Lepidopteran hemolymph environment means the specific pH and proteinase conditions of found within lepidopteran insect or larva.

[0133] Motif refers to a polynucleotide or polypeptide sequence that is implicated in having some biological significance and/or exerts some effect or is involved in some biological process.

[0134] Multiple cloning site or MCS refers to a segment of DNA found on a vector that contains numerous restriction sites in which a DNA sequence of interest can be inserted.

[0135] Multiple ICK motif protein domain means a protein composed of multiple ICK motif proteins which are linked by multiple intervening linker peptides. The ICK motif proteins in the multiple ICK motif protein domain can be same or different, and the intervening linker peptides in this domain can also be the same or different.

[0136] Mutant refers to an organism, DNA sequence, peptide sequence, or polypeptide sequence, that has an alteration (for example, in the DNA sequence), which causes said organism and/or sequence to be different from the naturally occurring or wild-type organism and/or sequence.

[0137] N-terminal refers to the free amine group (i.e., NH.sub.2) that is positioned on beginning or start of a polypeptide.

[0138] Non-ICK CRIPS can have 4-8 cysteines which form 2-4 disulfide bonds. Non-ICK peptides include cystine knot peptides that are not ICK peptides. Non-ICK peptides may have different connection orders of the cystine bonds than ICKs. Examples of a Non-ICK CRIP are peptides like Av2 and Av3 which are peptides first identified from sea anemones. These anemone peptides are examples of a class of compounds that modulate sodium channels in the insect peripheral nervous system (PNS).

[0139] Non-Polar amino acid is an amino acid that is weakly hydrophobic and includes glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine. Glycine or gly is the most preferred non-polar amino acid for the dipeptides of this invention.

[0140] Normalized peptide yield means the peptide yield in the conditioned medium divided by the corresponding cell density at the point the peptide yield is measured. The peptide yield can be represented by the mass of the produced peptide in a unit of volume, for example, mg per liter or mg/L, or by the UV absorbance peak area of the produced peptide in the HPLC chromatograph, for example, mAu.Math.sec. The cell density can be represented by visible light absorbance of the culture at wavelength of 600 nm (OD600).

[0141] One letter code means the peptide sequence which is listed in its one letter code to distinguish the various amino acids in the primary structure of a protein. alanine=A, arginine=R, asparagine=N, aspartic acid=D, asparagine or aspartic acid=B, cysteine=C, glutamic acid=E, glutamine=Q, glutamine or glutamic acid=Z, glycine=G, histidine=H, isoleucine=I, leucine=L, lysine=K, methionine=M, phenylalanine=F, proline=P, serine=S, threonine=T, tryptophan=W, tyrosine=Y, valine=V.

[0142] Omega peptide aka omega toxin, aka omega-ACTX-Hv1a, aka native omegaACTX-Hv1a, all refer to an ACTX peptide which was first isolated from a spider known as the Australian Blue Mountains Funnel-web Spider, Haydronyche versuta. Omega peptide is a positive allosteric modulators of the nicotinic acetylcholine receptor, and may also be a dual antagonist to insect voltage-gated Ca.sup.2+ channels and voltage-gated K.sup.+ channels. See Chambers et al., Insecticidal spider toxins are high affinity positive allosteric modulators of the nicotinic acetylcholine receptor. FEBS Lett. 2019 June; 593(12):1336-1350; and Windley et al., Lethal effects of an insecticidal spider venom peptide involve positive allosteric modulation of insect nicotinic acetylcholine receptors. Neuropharmacology. 2017 December; 127:224-242, the disclosures of which are incorporated herein by reference in their entireties.

[0143] ORF or Open reading frame or peptide expression ORF means that DNA sequence encoding a protein which begins with an ATG start codon and ends with a TGA, TAA or TAG stop codon. ORF can also mean the translated protein that the DNA encodes.

[0144] Operably linked means that the two adjacent DNA sequences are placed together such that the transcriptional activation of one can act on the other. Operably linked with regard to peptide and/or polypeptide molecules means that two or more peptide and/or polypeptide molecules are connected in such a way as to yield a single polypeptide chain, or connected in such a way inasmuch that one peptide exerts some effect on the other.

[0145] PEP means Plant Expressed Peptide.

[0146] Peptide expression cassette, or expression cassette means a DNA sequence which is composed of all the DNA elements necessary to complete transcription of an insecticidal peptide in a biological expression system. In the described methods herein, it includes a transcription promoter, a DNA sequence to encode an -mating factor signal sequence and a Kex 2 cleavage site, an insecticidal peptide transgene, a stop codon and a transcription terminator.

[0147] Peptide expression vector means a host organism expression vector which contains a heterologous insecticidal peptide transgene.

[0148] Peptide expression yeast strain, peptide expression strain or peptide production strain means a yeast strain which can produce a heterologous insecticidal peptide.

[0149] Peptide made special means a peptide previously having low peptide yield from a biological expression system that becomes an HP peptide because of the methods described herein used to increase its yield.

[0150] Peptide transgene or insecticidal peptide transgene means a DNA sequence that encodes an insecticidal peptide and can be translated in a biological expression system.

[0151] Peptide yield means the insecticidal peptide concentration in the conditioned medium which is produced from the cells of a peptide expression yeast strain. It can be represented by the mass of the produced peptide in a unit of volume, for example, mg per liter or mg/L, or by the UV absorbance peak area of the produced peptide in the HPLC chromatograph, for example, mAu.Math.sec.

[0152] Peritrophic membrane means a lining inside the insect gut that traps large food particles can aid in their movement through the gut while allowing digestion, but also protecting the gut wall.

[0153] Pest includes, but is not limited to: insects, fungi, bacteria, nematodes, mites, ticks, and the like.

[0154] Pesticidally-effective amount refers to an amount of the pesticide that is able to bring about death to at least one pest, or to noticeably reduce pest growth, feeding, or normal physiological development. This amount will vary depending on such factors as, for example, the specific target pests to be controlled, the specific environment, location, plant, crop, or agricultural site to be treated, the environmental conditions, and the method, rate, concentration, stability, and quantity of application of the pesticidally-effective polypeptide composition. The formulations may also vary with respect to climatic conditions, environmental considerations, and/or frequency of application and/or severity of pest infestation.

[0155] PFIP or pore forming insecticidal protein means a protein that can form a pore or channel in the cells that line an insect gut, such as gut epithelium cells. Examples of PFIPS are Bt proteins such as cry, crt and VIP. Other PFIP examples can be found in the sequence listing.

[0156] Plant transgenic protein means a protein from a heterologous species that is expressed in a plant after the DNA or RNA encoding it was delivered into one or more of the plant cells.

[0157] Plant shall mean whole plants, plant tissues, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same. Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).

[0158] Plant-incorporated protectant or PIP means an insecticidal protein produced by transgenic plants, and the genetic material necessary for the plant to produce the protein.

[0159] Plant cleavable linker means a cleavable linker peptide, or a nucleotide encoding a cleavable linker peptide, which contains a plant protease recognition site and can be cleaved during the protein expression process in the plant cell.

[0160] Plant regeneration media means any media that contains the necessary elements and vitamins for plant growth and plant hormones necessary to promote regeneration of a cell into an embryo which can germinate and generate a plantlet derived from tissue culture. Often the media contains a selectable agent to which the transgenic cells express a selection gene that confers resistance to the agent.

[0161] Plant transgenic protein means a protein from a heterologous species that is expressed in a plant after the DNA or RNA encoding it was delivered into one or more of the plant cells.

[0162] Plasmid refers to a DNA segment that acts as a carrier for a gene of interest (e.g. a gene encoding a heterologous polypeptide of interest) and, when transformed or transfected into an organism, can replicate and express the DNA sequence contained within the plasmid independently of the host organism. Plasmids are a type of vector, and can be cloning vectors (i.e., simple plasmids used to clone a DNA fragment and/or select a host population carrying the plasmid via some selection indicator) or expression plasmids (i.e., plasmids used to produce large amounts of polynucleotides and/or polypeptides).

[0163] Polar amino acid is an amino acid that is polar and includes serine, threonine, cysteine, asparagine, glutamine, histidine, tryptophan and tyrosine; preferred polar amino acids are serine, threonine, cysteine, asparagine and glutamine; with serine being most highly preferred.

[0164] Post-transcriptional gene silencing, or PTGS, means a cellular process within living cells that suppress the expression of a gene.

[0165] Post-transcriptional regulatory elements are DNA segments and/or mechanisms that affect mRNA after it has been transcribed. Mechanisms of post-transcriptional mechanisms include splicing events; capping, splicing, and addition of a Poly (A) tail, and other mechanisms known to those having ordinary skill in the art.

[0166] Protein has the same meaning as peptide and/or polypeptide in this document.

[0167] Recombinant DNA or rDNA refers to DNA that is comprised of two or more different DNA segments.

[0168] Recombinant vector means a DNA plasmid vector into which foreign DNA has been inserted.

[0169] Regulatory elements refers to promoters; enhancers; internal ribosomal entry sites (IRES); polyadenylation signals; poly-U sequences; and/or other elements that influence gene expression, for example, in a tissue-specific manner; temporal-dependent manner; to increase or decrease expression; and/or to cause constitutive expression.

[0170] Restriction enzyme or restriction endonuclease refers to an enzyme that cleaves DNA at a specified restriction site. For example, a restriction enzyme can cleave a plasmid at an EcoRI, SacII or BstXI restriction site allowing the plasmid to be linearized, and the DNA of interest to be ligated.

[0171] Restriction site refers to a location on DNA comprising a sequence of 4 to 8 nucleotides, and whose sequence is recognized by a particular restriction enzyme.

[0172] Secondary invertebrate pest control agent (SIPCA) refers to additional agents that can be combined in a composition with a primary agent (e.g., an ICK or an insecticidal protein comprising one or more ICKs), and that exert insecticidal, nematicidal, and/or otherwise pesticidal effects on target insects.

[0173] Selection gene means a gene which confers an advantage for a genomically modified organism to grow under the selective pressure.

[0174] Subcloning or subcloned refers to the process of transferring DNA from one vector to another, usually advantageous vector. For example, polynucleotide encoding a mutant Av3 polypeptide can be subcloned into a pLB102 plasmid subsequent to selection of yeast colonies transformed with pKLAC1 plasmids.

[0175] SSI or site-specific integration refers to the process directing a transgene to a target site in a host-organism's genome; thus, SSI allows the integration of genes of interest into pre-selected genome locations of a host-organism.

[0176] STA or Translational stabilizing protein or stabilizing protein or fusion protein means a protein with sufficient tertiary structure that it can accumulate in a cell without being targeted by the cellular process of protein degradation. The protein can be between 5 and 50 amino acids (e.g., another ICK-motif protein), 50 to 250 amino acids (GNA), 250 to 750 amino acids (e.g., chitinase) and 750 to 1500 amino acids (e.g., enhancin). The translational stabilizing protein is coded by a DNA sequence for a protein that is operably linked with a sequence encoding an insecticidal protein in the ORF. The operably-linked STA can either be upstream or downstream of the insecticidal protein and can have any intervening sequence between the two sequences as long as the intervening sequence does not result in a frame shift of either DNA sequence. The translational stabilizing protein can also have an activity which increases delivery of the ICK motif protein across the gut wall and into the hemolymph of the insect. Such a delivery can be achieved by actively trafficking the entire ORF across the gut wall, or by cleavage within the gut environment to separate the ICK motif protein while the translational stabilizing protein damages the peritrophic membrane and/or gut wall to increase diffusion of the ICK motif protein into the hemolymph.

[0177] sta means a nucleotide encoding a translational stabilizing protein.

[0178] Structural motif refers to the three-dimensional arrangement of peptides and/or polypeptides, and/or the arrangement of operably linked polypeptide segments. For example, the polypeptide comprising ERSP-STA-L-ICK has an ERSP motif, an STA motif, a LINKER motif, and an ICK polypeptide motif.

[0179] TMOF or TMOF motif or TMOF proteins means trypsin modulating oostatic factor protein sequences. Examples are provided in the sequence listing. Numerous examples and variants are provided herein. SEQ ID NO: 708 is the wild type TMOF sequence. Other non-limiting variants are provided in SEQ. ID. NOs: 709-721. Other examples would be known or could be created by one skilled in the art.

[0180] Transfection and transformation both refer to the process of introducing exogenous and/or heterologous DNA or RNA (e.g., a vector containing a polynucleotide that encodes a heterologous polypeptide of interest) into a host organism (e.g., a prokaryote or a eukaryote). Generally, those having ordinary skill in the art sometimes reserve the term transformation to describe processes where exogenous and/or heterologous DNA or RNA are introduced into a bacterial cell; and reserve the term transfection for processes that describe the introduction of exogenous and/or heterologous DNA or RNA into eukaryotic cells. However, as used herein, the term transformation and transfection are used synonymously, regardless of whether a process describes the introduction exogenous and/or heterologous DNA or RNA into a prokaryote (e.g., bacteria) or a eukaryote (e.g., yeast, plants, or animals).

[0181] Transgene means a heterologous DNA sequence encoding a protein which is transformed into a plant.

[0182] Transgenic host cell means a cell which is transformed with a gene and has been selected for its transgenic status via an additional selection gene.

[0183] Transgenic plant means a plant that has been derived from a single cell that was transformed with foreign DNA such that every cell in the plant contains that transgene.

[0184] Transient expression system means an Agrobacterium tumefaciens-based system which delivers DNA encoding a disarmed plant virus into a plant cell where it is expressed. The plant virus has been engineered to express a protein of interest at high concentrations, up to 40% of the TSP. In the technical proof, there are two transient expression systems used, a TRBO and a FECT system and the plant cells are leaf tissue of a tobacco plant Nicotiana benthamiana.

[0185] TRBO means a transient plant expression system using Tobacco mosaic virus with removal of the viral coating protein gene.

[0186] Trypsin cleavage means an in vitro assay that uses the protease enzyme trypsin (which recognizes exposed lysine and arginine amino acid residues) to separate a cleavable linker at that cleavage site. It also means the act of the trypsin enzyme cleaving that site.

[0187] TSP or total soluble protein means the total amount of protein that can be extracted from a plant tissue sample and solubilized into the extraction buffer.

[0188] U peptide, U protein aka U toxin, aka native U, aka U-ACTX-Hv1a, aka native U-ACTX-Hv1a, as well as Hybrid peptide, aka hybrid toxin, aka hybrid-ACTX-Hv1a, aka native hybridACTX-Hv1a, all refer to a native protein or native toxin, that can be found in nature or is otherwise known, in the case of U-ACTX-Hv1a, aka native U-ACTX-Hv1a, the protein is a native spider toxin, that was first discovered from a spider with origins in the Australian Blue Mountains and is a positive allosteric modulators of the nicotinic acetylcholine receptor, and may also be a dual antagonist to insect voltage-gated Ca.sup.2+ channels and voltage-gated K.sup.+ channels. See Chambers et al., Insecticidal spider toxins are high affinity positive allosteric modulators of the nicotinic acetylcholine receptor. FEBS Lett. 2019 June; 593(12):1336-1350; and Windley et al., Lethal effects of an insecticidal spider venom peptide involve positive allosteric modulation of insect nicotinic acetylcholine receptors. Neuropharmacology. 2017 December; 127:224-242, the disclosures of which are incorporated herein by reference in their entireties. The spider from which the toxin was discovered is known as the Australian Blue Mountains Funnel-web Spider, which has the scientific name Haydronyche versuta.

[0189] U+2 peptide, U+2 protein, U+2 toxin, or U+2, or U+2-ACTX-Hv1a, all refer to either a toxin, which has an additional dipeptide operatively linked to the native peptide, and may refer to the spider toxin which is sometimes called the U peptide and other names noted above. The additional dipeptide that is operatively linked to the U peptide and thus indicated as +2 or plus 2 can be selected among several peptides, any of which may result in a U+2 peptide with unique properties as discussed herein. These are also sometimes called high production peptides. When the term U+2-ACTX-Hv1a is used, it refers to a specific high production toxic peptide, comprising a naturally occurring peptide from the Australian Blue Mountains Funnel-web Spider, which has the scientific name Hydronyche versuta.

[0190] Vector refers to the DNA segment that accepts a foreign gene of interest (e.g., ick). The gene of interest is known as an insert or transgene.

[0191] VIP proteins were discovered from screening the supernatant of vegetatively gown strains of Bt for possible insecticidal activity. They have little or no similarity to cry proteins and they were named Vegetative Insecticidal Proteins or VIP. Of particular use and preference for use with this document are what have been called VIP3, Vip3 proteins or Vip toxins which have Lepidopteran activity. They are thought to have a similar mode of action as Bt cry peptides. In this document VIP proteins are categorized as a PFIP type of protein.

[0192] Wild type or WT refers to the phenotype and/or genotype (i.e., the appearance or sequence) of an organism, polynucleotide sequence, and/or polypeptide sequence, as it is found and/or observed in its naturally occurring state or condition.

[0193] Yeast expression vector, or expression vector, or vector, means a plasmid which can introduce a heterologous gene and/or expression cassette into yeast cells to be transcribed and translated.

[0194] Yield refers to the production of a peptide, and increased yields can mean increased amounts of production, increased rates of production, and an increased average or median yield and increased frequency at higher yields. The term yield when used in reference to plant crop growth and/or production, as in yield of the plant refers to the quality and/or quantity of biomass produced by the plant.

[0195] Throughout this specification, unless specifically stated otherwise or the context requires otherwise, reference to a single step, composition of matter, group of steps or group of compositions of matter shall be taken to encompass one and a plurality (i.e., one or more) of those steps, compositions of matter, groups of steps or group of compositions of matter.

[0196] The present disclosure is performed without undue experimentation using, unless otherwise indicated, conventional techniques of molecular biology, microbiology, virology, recombinant DNA technology, solid phase and liquid nucleic acid synthesis, peptide synthesis in solution, solid phase peptide synthesis, immunology, cell culture, and formulation. Such procedures are described, for example, in Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, New York, Second Edition (1989), whole of Vols I, II, and III; DNA Cloning: A Practical Approach, Vols. I and II (D. N. Glover, ed., 1985), IRL Press, Oxford, whole of text; Oligonucleotide Synthesis: A Practical Approach (M. J. Gait, ed, 1984) IRL Press, Oxford, whole of text, and particularly the papers therein by Gait, pp 1-22; Atkinson et al, pp 35-81; Sproat et al, pp 83-115; and Wu et al, pp 135-151; 4. Nucleic Acid Hybridization: A Practical Approach (B. D. Hames & S. J. Higgins, eds., 1985) IRL Press, Oxford, whole of text; Immobilized Cells and Enzymes: A Practical Approach (1986) IRL Press, Oxford, whole of text; Perbal, B., A Practical Guide to Molecular Cloning (1984); Methods In Enzymology (S. Colowick and N. Kaplan, eds., Academic Press, Inc.), whole of series; J. F. Ramalho Ortigao, The Chemistry of Peptide Synthesis In: Knowledge database of Access to Virtual Laboratory website (Interactiva, Germany); Sakakibara, D., Teichman, J., Lien, E. Land Fenichel, R. L. (1976). Biochem. Biophys. Res. Commun. 73 336-342; Merrifield, R. B. (1963). J. Am. Chem. Soc. 85, 2149-2154; Barany, G. and Merrifield, R. B. (1979) in The Peptides (Gross, E. and Meienhofer, 3. eds.), vol. 2, pp. 1-284, Academic Press, New York. 12. Wiinsch, E., ed. (1974) Synthese von Peptiden in Houben-Weyls Metoden der Organischen Chemie (Muler, E., ed.), vol. 15, 4th edn., Parts 1 and 2, Thieme, Stuttgart; Bodanszky, M. (1984) Principles of Peptide Synthesis, Springer-Verlag, Heidelberg; Bodanszky, M. & Bodanszky, A. (1984) The Practice of Peptide Synthesis, Springer-Verlag, Heidelberg; Bodanszky, M. (1985) Int. J. Peptide Protein Res. 25, 449-474; Handbook of Experimental Immunology, Vols. I-IV (D. M. Weir and C. C. Blackwell, eds., 1986, Blackwell Scientific Publications); and Animal Cell Culture: Practical Approach, Third Edition (John R. W. Masters, ed., 2000); each of these references are incorporated herein by reference in their entireties.

[0197] Throughout this specification, unless the context requires otherwise, the word comprise, or variations such as comprises or comprising, will be understood to imply the inclusion of a stated step or element or integer or group of steps or elements or integers but not the exclusion of any other step or element or integer or group of elements or integers.

PART I. PLANT INCORPORATED PEPTIDES OR PLANT EXPRESSED PEPTIDES PIPS AND PEPS

[0198] Plant-incorporated protectants, or PIPs have presented one solution to the insect pressure faced by farmers. Modern agriculture employs genes from the Bacillus thuringiensis expressed as plant transgenic proteins to act as PIPs, but natural resistant insect strains have been detected in the field and threaten this class. Additional PIPs with novel modes of action need to be developed to manage the development of resistance. A novel class of proteins with insecticidal activity having the potential to become PIPs, are called Cysteine Rich Insecticidal Proteins (CRIPS) these proteins have 4, 6 or 8 cysteines and 2, 3 or 4 disulfide bonds. One example of this class of compounds are said to be of the type called inhibitor cysteine knot (ICK) motif protein. ICK motif proteins that have insecticidal activity have potential to be insecticidal proteins and PIPs.

[0199] ICK motif proteins are a class of proteins with at least six cysteine residues that form a specific ICK tertiary structure. Covalent cross-linking of the cysteine residues in the ICK motif proteins form disulfide bridges that result in a tertiary structures that makes the protein relatively resistant to proteases and sometimes to extreme physical conditions (pH, temperature, UV light, etc.), and confers activity against ion channels, which might specific to insects. Many ICK motif proteins have evolved in the venom of invertebrates and vertebrates that use the ICK motif proteins as a toxin to immobilize or kill their predators or prey. Such insecticidal peptides often have scorpion, spider and sometimes snake origins. In nature, toxic peptides can be directed to the insect's gut or to internal organs by injection. In the case of a PIP, the delivery is usually via the insect's consumption of transgenic protein expressed in plant tissue. Upon this consumption of the toxin from its food, for example an insect feeding upon a transgenic plant, the ICK motif protein may have the ability to inhibit the growth, impair the movement, or even kill an insect.

[0200] Toxic peptides however often lose their toxicity when they are expressed in plants. Unless the ICK motif protein is expressed as a properly folded protein it cannot successfully protect a plant or crop from insect damage. In some cases a plant expressed peptide will need to be activated by cleavage within the insect or during expression process in a plant in order to be active. There is a need for methods and modified peptides and nucleic acids that enable peptides to not only be expressed in a plant but to be expressed, folded properly and in some cases cleaved properly such that the peptide retains its activity against an insect even after expression in a plant. In this section we present several ways to produce active peptides adapted for expression in plants.

[0201] We describe various combinations of different peptides operably linked together to make novel protein complexes. The following protein complexes are described. A peptide comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to Cysteine Rich Insecticidal Peptide (CRIP) such as an Inhibitor Cystine Knot (ICK) motif protein, which is designated as ERSP-ICK, wherein said ERSP is the N-terminal of said peptide, and where the ERSP peptide is between 3 to 60 amino acids in length, between 5 to 50 amino acids in length, between 20 to 30 amino acids in length and or where the peptide is BAAS, or tobacco extensin signal peptide, or a modified tobacco extensin signal peptide, or Jun a 3 signal peptide of Juniperus ashei or J ashei.

[0202] A peptide comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to a Cysteine Rich Insecticidal Peptide (CRIP) such as an Inhibitor Cystine knot (ICK) motif protein, which is designated as ERSP-ICK, wherein the ICK motif protein is between 16 and 60 amino acids in length, between 26 and 48 amino acids in length, between 30 and 44 amino acids in length and or where the ICK motif protein is U-ACTX-Hv1a, or Omega-ACTX-Hv1a, or Kappa-ACTX-Hv1c.

[0203] A peptide comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to an Inhibitor Cystine knot (ICK) motif protein, designated as ERSP-ICK, wherein said ERSP and Inhibitor Cystine knot (ICK) motif protein are combinations of any of the sizes and lengths described herein and/or are comprised of any of the identified sequences taught in this document.

[0204] A nucleotide that codes for any of the peptides that are described herein as Endoplasmic Reticulum Signal Peptides (ERSP) and/or Cysteine Rich Insecticidal Peptide (CRIP) such as an Inhibitor Cystine Knot (ICK) motif proteins. An expression ORF comprising any of the nucleotides that code for these peptides. An expression ORF comprising any of the nucleotides that code for these peptides transformed into a transgenic plant genome. A peptide wherein said ICK motif protein is an insecticidal protein. A peptide wherein said insecticidal peptide is any of the ICK motif proteins or peptide described herein. A peptide wherein said insecticidal peptide is any peptide selected from any of the peptides or sources of peptides including Atrax or Hadronyche. An insecticidal peptide selected from any of the peptides in the Sequence Listing and fragments thereof including mature, pre, and pro peptide versions of said peptides and sequence numbers. A peptide wherein said insecticidal peptide is any peptide selected described or selected from an ACTX protein. A TMOF protein.

[0205] The use of any of the peptides or nucleotides described herein to make or transform a plant or plant genome in order to express properly folded toxic peptides in a transformed plant. The use of any of the peptides or nucleotides described herein to make or transform a plant or plant genome in order to express properly folded toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase the plant's resistance to insect damage.

[0206] A method of using the nucleotides of any of the peptides or expression ORFs in a CRIP, an ICK a Non-ICK, motif protein expression vectors to create transgenic plants. An ICK motif protein expression vector comprising any of the nucleotides which express any peptides described herein. An ICK motif protein expression vector incorporated into a transformed plant, comprising nucleotides that code for any of the peptides disclosed herein or that could be made by one skilled in the art given the teaching disclosed herein. A procedure for the generation of transformed plants having or expressing any of the peptides described herein. A plant made by any of the products and processes described herein.

[0207] A protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to an Inhibitor Cystine knot (ICK) motif protein or cysteine rich peptide, operably linked to an intervening linker peptide (L or Linker), which is designated as ERSP-Linker-ICK, (ERSP-L-ICK), or ERSP-ICK-Linker (ERSP-ICK-L), wherein said ERSP is the N-terminal of said protein and said L or Linker, may be either on the N-terminal side (upstream) of the ICK motif protein or the C-terminal side (downstream) of the ICK motif protein. A protein designated as ERSP-L-ICK, or ERSP-ICK-L, comprising any of the ERSPs or ICK motif proteins described herein and wherein said L can be an uncleavable linker peptide, or a cleavable linker peptide, which may be cleavable in a plant cells during protein expression process or may be cleavable in an insect gut environments and hemolymph environments, and comprised of any of the intervening linker peptide (LINKER) described, or taught by this document including the following sequences: IGER (SEQ ID NO: 1) EEKKN, (SEQ ID NO: 2) and ETMFKHGL (SEQ ID NO: 3).

[0208] A nucleotide that codes for any of the peptides described as Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and or intervening linker peptide (LINKER) and any and all nucleotides that code for any of these proteins that are used to create transgenic plants.

[0209] The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or intervening linker peptide (LINKER) to make or transform a plant or plant genome in order to express properly folded toxic peptides in a transformed plant. The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or intervening linker peptide to make or transform a plant or plant genome in order to express properly folded toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase the plant's resistance to insect damage.

[0210] A method of using the nucleotides or expression ORFs that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or intervening linker peptide (LINKER) to create transgenic plants. An expression ORF comprising any of the nucleotides which are in an ICK expression vector express any peptides described herein. ERSP, ICK motif protein and/or LINKER. A functional expression ORF in an ICK motif protein expression vector incorporated into a transformed plant, comprising nucleotides that code for any of the peptides disclosed herein that code for ERSP, ICK motif protein and/or LINKER or that could be made by one skilled in the art given the teaching disclosed herein. A procedure for the generation of transformed plants having or expressing any of the peptides described herein. ERSP, ICK motif protein and/or LINKER. A plant made by any of the products and processes described herein.

[0211] A protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to an Inhibitor Cystine knot (ICK) motif protein operably linked to a Translational Stabilizing Protein (STA), which is designated as ERSP-STA-ICK or ERSP-ICK-STA, wherein said ERSP is the N-terminal of said protein and said STA may be either on the N-terminal side (upstream) of the ICK motif protein of the C-terminal side (downstream) of the ICK motif protein. A protein designated as ERSP-STA-ICK or ERSP-ICK-STA, comprising any of the ERSPs or ICK motif proteins described herein and where STA is comprised of any of the translational stabilizing proteins described, or taught by this document including GFP (Green Fluorescent Protein), GNA (snowdrop lectin), Jun a 3, (Juniperus ashei) and many other ICK motif proteins.

[0212] A nucleotide that codes for any of the peptides described as Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or Translational Stabilizing Protein (STA) and any and all nucleotides having any of these functional groups that code for any of these proteins that are used to create transgenic plants.

[0213] The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or Translational Stabilizing Protein (STA) to make or transform a plant or plant genome in order to express properly folded toxic peptides in a transformed plant. The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or Translational Stabilizing Protein (STA) to make or transform a plant or plant genome in order to express properly folded toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase the plant's resistance to insect damage.

[0214] A method of using the nucleotides or expression ORFs that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein and/or Translational Stabilizing Protein (STA) in an ICK expression vector to create transgenic plants. An expression ORF comprising any of the nucleotides which express ERSP, ICK motif protein and/or STA. A functional expression ORF in an ICK motif protein expression vector that is incorporated into a transformed plant, comprising nucleotides that code for that code for ERSP, ICK motif protein and/or STA or that could be made by one skilled in the art given the teaching disclosed herein. A procedure for the generation of transformed plants having or expressing ERSP, ICK motif protein and/or STA. A plant made by any of the products and processes described herein.

[0215] A protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to an Inhibitor Cystine Knot (ICK) motif protein operably linked to a Translational Stabilizing Protein (STA) operably linked to an Intervening Linker Peptide (LINKER) which is designated as ERSP-STA-LINKER-ICK, ERSP-ICK-LINKER-STA, ERSP-STA-L-ICK or ERSP-ICK-L-STA, wherein said ERSP is the N-terminal of said protein and said STA may be either on the N-terminal side (upstream) of the ICK motif protein of the C-terminal side (downstream) of the ICK motif protein and said LINKER is between STA and the ICK motif protein. A protein designated as ERSP-STA-LINKER-ICK or ERSP-ICK-LINKER-STA, comprising any of the ERSPs, ICK motif proteins, Intervening Linker Peptides and Translational Stabilizing Proteins described herein.

[0216] A nucleotide that codes for any of the peptides described as Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein, Intervening Linker Peptide (LINKER) and/or Translational Stabilizing Protein (STA) and any and all nucleotides that code for any of these proteins that are used to create transgenic plants.

[0217] The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein, Intervening Linker Peptide and/or Translational Stabilizing Protein (STA) to make or transform a plant or plant genome in order to express properly folded toxic peptides in a transformed plant. The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein, Intervening Linker Peptide (LINKER) and/or Translational Stabilizing Protein (STA) to make or transform a plant or plant genome in order to express properly folded toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase the plant's resistance to insect damage.

[0218] A method of using the nucleotides or expression ORFs in an ICK expression vector that code for Endoplasmic Reticulum Signal Peptide (ERSP), Inhibitor Cystine knot (ICK) motif protein, Intervening Linker Peptide and/or Translational Stabilizing Protein (STA) to create transgenic plants. An expression ORF comprising any of the nucleotides in an ICK expression vector which express ERSP, ICK motif protein, LINKER and/or STA. A functional expression ORF in an ICK expression vector incorporated into a transformed plant, comprising nucleotides that code for that code for ERSP, ICK motif protein, LINKER and/or STA or that could be made by one skilled in the art given the teaching disclosed herein. A procedure for the generation of transformed plants having or expressing ERSP, ICK motif protein, LINKER and/or STA. A plant made by any of the products and processes described herein.

[0219] A protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to multiple Inhibitor Cystine knot (ICK) motif protein domain, which are operably linked by Intervening Linker Peptides (LINKER), operably linked to a Translational Stabilizing Protein (STA) operably linked to an Intervening Linker Peptide, which is designated as ERSP-STA-(LINKER.sub.i-ICK.sub.j).sub.N or ERSP-(ICK.sub.j-LINKER.sub.i).sub.N-STA and sometimes as ERSP-STA-(L.sub.i-ICK.sub.j).sub.N or ERSP-(ICK.sub.j-L.sub.i).sub.N-STA, wherein said ERSP is the N-terminal of said protein and said STA may be either on the N-terminal side (upstream) of the multiple ICK motif protein domain ((LINKER.sub.i-ICK.sub.j).sub.N) or the C-terminal side (downstream) of the multiple ICK motif protein domain ((ICK.sub.j-LINKER.sub.i).sub.N) and said multiple Intervening Peptides (LINKER.sub.i) is between STA and the multiple ICK motif protein domain and between the ICK motif proteins in the multiple ICK motif protein domain. A protein designated as ERSP-STA-(LINKER.sub.i-ICK.sub.j).sub.N or ERSP-(ICK.sub.j-LINKER.sub.i).sub.N-STA, comprising any of the ERSPs, ICK motif proteins, Intervening Linker Peptides and Translational Stabilizing Proteins described herein.

[0220] A nucleotide that codes for any of the peptides described as Endoplasmic Reticulum Signal Peptide (ERSP), multiple Inhibitor Cystine knot (ICK) motif protein domain, Intervening Linker Peptide (LINKER) and/or Translational Stabilizing Protein (STA) and any and all nucleotides that code for any of these proteins that are used to create transgenic plants.

[0221] The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), multiple Inhibitor Cystine knot (ICK) motif protein domain, Intervening Linker Peptide, (LINKER) and/or Translational Stabilizing Protein (STA) to make or transform a plant or plant genome in order to express properly folded toxic peptides in a transformed plant. The use of any of the peptides or nucleotides that code for Endoplasmic Reticulum Signal Peptide (ERSP), multiple Inhibitor Cystine knot (ICK) motif protein domain, Intervening Linker Peptide (LINKER) and/or Translational Stabilizing Protein (STA) to make or transform a plant or plant genome in order to express properly folded toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase the plant's resistance to insect damage.

[0222] A method of using the nucleotides or expression ORFs that code for Endoplasmic Reticulum Signal Peptide (ERSP), multiple Inhibitor Cystine knot (ICK) motif protein domain, Intervening Linker Peptide (LINKER) and/or Translational Stabilizing Protein (STA) to create transgenic plants. An expression ORF comprising any of the nucleotides which express ERSP, multiple ICK motif protein domain, L or LINKER and/or STA. A functional expression ORF incorporated into a transformed plant, comprising nucleotides that code for ERSP, multiple ICK motif protein domain, LINKER and/or STA or that could be made by one skilled in the art given the teaching disclosed herein. A procedure for the generation of transformed plants having or expressing ERSP, multiple ICK motif protein domain, LINKER and/or STA. A plant made by any of the products and processes described herein.

[0223] A chimeric gene comprising a promoter active in plants operatively linked to the nucleic acids or expression ORF of the nucleotides described herein. A method of making, producing or using these chimeric genes that are described herein. A recombinant vector comprising the chimeric genes described herein. A method of making, producing or using the recombinant vectors described herein. A transgenic host cell comprising the chimeric genes described herein. A method of making, producing or using the transgenic host cell described herein. A transgenic host cell as described herein can be, e.g., a transgenic plant cell. A method of making, producing or using the transgenic plant cell described herein. A transgenic plant comprising the transgenic plant cell described herein. A method of making, producing or using the transgenic plants described herein. A transgenic plant as described herein which made from a corn, soybean, cotton, rice, wheat, sorghum, switchgrass, sugarcane, alfalfa, potatoes, tomatoes, tobacco, any of green leafy vegetables, or any of fruit trees. Seed from a transgenic plant as described herein wherein said seed comprises a chimeric gene as described herein. A method of making, producing or using the transgenic plant described herein. A method of making, producing or using the seeds described herein.

[0224] Plant expressed inhibitory cysteine knot (ICK) motif proteins from spiders and scorpions have been described (Khan et al, Transgenic Res., 2006, 15: 349-357; Hernandez-Campuzano et al, Toxicon. 2009 January; 53(1):122-8). We describe how to make plant expressed ICK motif proteins that are active and accumulate in plants to insecticidal dose levels. We show that prior descriptions of plant expressed ICK motif proteins were actually descriptions of inactive proteins that had lost their natural toxicity. We describe methods to increase the efficacy of the plant expression, to increase the accumulation of plant expressed proteins and to dramatically increase the insecticidal activity of plant expressed proteins. We describe how to induce the plant expressed ICK motif proteins to enter the Endoplasmic Reticulum (ER) directed by an Endoplasmic Reticulum Signaling Protein (ERSP) in plant cells, in order for the correct covalent cross-linking of peptide disulfide bridges which generate the essential tertiary ICK motif structure required for insecticidal activity. We further describe the plant expressed, ER-trafficking ICK motif protein complex with a translational stabilizing protein domain (STA) added in order to increase the size of the resulting ICK fusion protein which enhances peptide accumulation in the plant. We further describe the plant expressed, ER-trafficking ICK motif protein, with a translational stabilizing protein added as above, and with an intervening linker peptide (LINKER) added, the latter of which may allow for potential cleavage and the recovery of the active form of the ICK motif protein having insecticidal activity. We further describe the plant expressed polypeptide, which contains ER-trafficking ICK motif protein domain with multiple ICK motif proteins separated by intervening linker peptides (LINKER), with an intervening linker peptide added, with a translation stabilizing protein added, latter of which allows the correctly folded ICK motif protein to accumulate in the plant to the insecticidal dose.

[0225] This invention describes the ICK motif protein with insecticidal activity that are plant expressed and which can successfully protect a plant or crop from insect damage. The ICK motif protein expression ORF described herein is a nucleotide which will enable the plant translated peptides to not only be expressed in a plant but also to be expressed and folded properly, and to be accumulated to the insecticidal dose in the plant. An example of a protein expression ORF can be an ICK motif protein expression ORF which is can be described below in equation style and is shown in diagram style in the drawings or figures. [0226] ersp-sta-(linker.sub.i-crip.sub.j).sub.N, or ersp-(crip.sub.j-linker.sub.i).sub.N-sta

[0227] The expression above is merely one example, and similar expressions could be written for other types of CRIP expression ORFs, for example an ICK expression ORF, could be written as: [0228] ersp-sta-(linker.sub.i-ick.sub.j).sub.N, or ersp-(ick.sub.j-linker.sub.i).sub.N-sta

[0229] These expressions, equations or linear diagrams describe a polynucleotide open reading frame (ORF) for one type of CRIP, one which expresses the ICK motif protein complex, which can be described as ERSP-STA-(LINKER.sub.I-ICK.sub.J).sub.N or ERSP-(ICK.sub.J-LINKER.sub.I).sub.N-STA, or as ERSP-STA-(L.sub.I-ICK.sub.J).sub.N or ERSP-(ICK.sub.J-L.sub.I).sub.N-STA, containing four possible peptide components with dash signs to separate each component. In the diagrams above, the nucleotide component of ersp is a polynucleotide segment encoding a plant endoplasmic reticulum trafficking signal peptide (ERSP). The component of sta is a polynucleotide segment encoding a translation stabilizing protein (STA), which helps the accumulation of the ICK motif protein expressed in plants but may not be necessary in the ICK motif protein expression ORF. The component of linker.sub.i is a polynucleotide segment encoding an intervening linker peptide (L OR LINKER) to separate the ICK motif proteins from each other and from the translation stabilizing protein, and the subscription i indicates that different types of linker peptides can be used in the CRIP or ICK motif protein expression ORF. In the case that sta is not used in the ICK motif protein expression ORF, ersp can directly be linked to the polynucleotide encoding an ICK motif protein without a linker. The component of ick.sub.i is a polynucleotide segment encoding an ICK motif protein (ICK), and the subscription j indicates different ICK motif proteins; (linker.sub.i-ick.sub.j).sub.N indicates that the structure of the nucleotide encoding an intervening linker peptide and an ICK motif protein can be repeated N times in the same open reading frame in the same ICK motif protein expression ORF, where N can be any integrate number from 1 to 10. N can be from 1 to 10, specifically N can be 1, 2, 3, 4, or 5, and in some embodiments N is 6, 7, 8, 9 or 10. The repeats may contain polynucleotide segments encoding different intervening linkers (LINKER) and different ICK motif proteins. The different polynucleotide segments including the repeats within the same ICK motif protein expression ORF are all within the same translation frame.

[0230] Any combination of the four principal components, ersp, sta, linker and crip or ick as in the diagram of the ICK motif protein expression ORF, may be used to create a PEP type ICK motif protein expression ORF as long as a minimum of ersp and at least one copy of crip or ick are used.

[0231] I. The ERSP or ersp Component of the PEPs.

[0232] The ICK motif protein expression ORF starts with an ersp at its 5 terminus. For the ICK motif protein to be properly folded and functional when it is expressed from a transgenic plant, it must have an ersp nucleotide fused in frame with the polynucleotide encoding an ICK motif protein. During cellular translation process, translated ERSP can direct the ICK motif protein being translated to insert into the Endoplasmic Reticulum (ER) of the plant cell by binding with a cellular component called a signal-recognition particle. Within the ER the ERSP peptide is cleaved by signal peptidase and the ICK motif protein is released into the ER, where the ICK motif protein is properly folded during the post-translation modification process, for example, the formation of disulfide bonds. Without any additional retention protein signals, the protein is transported through the ER to the Golgi apparatus, where it is finally secreted outside the plasma membrane and into the apoplastic space. ICK motif protein can accumulate at apoplastic space efficiently to reach the insecticidal dose in plants. FIG. 1 shows a representative diagram of a simple two component peptide or nucleotide composed of an ERSP functionally linked to an ICK motif. The ICK could be a suitable CRIP. More complex proteins and polynucleotides utilizing ERSP are diagrammed in FIGS. 2-5 and these figures are further discussed in the discussion of the STA or Translational Stabilizing Protein.

[0233] The ERSP peptide is at the N-terminal region of the plant translated ICK motif protein complex and the ERSP portion is composed of about 3 to 60 amino acids. In some embodiments it is 5 to 50 amino acids. In some embodiments it is 10 to 40 amino acids but most often is composed of 15 to 20; 20 to 25; or 25 to 30 amino acids. The ERSP is a signal peptide so called because it directs the transportation of a protein. Signal peptides may also be called targeting signals, signal sequences, transit peptides, or localization signals. The signal peptides for ER trafficking are often 15 to 30 amino acid residues in length and have a tripartite organization, comprised of a core of hydrophobic residues flanked by a positively charged aminoterminal and a polar, but uncharged carboxyterminal region. (Zimmermann, et al, Protein translocation across the ER membrane, Biochimica et Biohysica Acta, 2011, 1808: 912-924).

[0234] Many ERSPs are known. Many plant ERSPs are known. It is NOT required that the ERSP be derived from a plant ERSP, non-plant ERSPs will work with the procedures described herein. Many plant ERSPs are however well known and we describe some plant derived ERSPs here. BAAS, for example, is derived from the plant, Hordeum vulgare, and has the amino acid sequence as follows:

TABLE-US-00001 (SEQIDNO:4) MANKHLSLSLFLVLLGLSASLASG

[0235] Plant ERSPs, which are selected from the genomic sequence for proteins that are known to be expressed and released into the apoplastic space of plants, and a few examples are BAAS, carrot extensin, tobacco PR1. The following references provide further descriptions, and are incorporated by reference herein in their entirety. De Loose, M. et al. The extensin signal peptide allows secretion of a heterologous protein from protoplasts Gene, 99 (1991) 95-100. De Loose, M. et al. described the structural analysis of an extensin-encoding gene from Nicotiana plumbaginifolia, the sequence of which contains a typical signal peptide for translocation of the protein to the endoplasmic reticulum. Chen, M. H. et al. Signal peptide-dependent targeting of a rice alpha-amylase and cargo proteins to plastids and extracellular compartments of plant cells Plant Physiology, 2004 July; 135(3): 1367-77. Epub 2004 Jul. 2. Chen, M. H. et al. studied the subcellular localization of -amylases in plant cells by analyzing the expression of -amylase, with and without its signal peptide, in transgenic tobacco. These references and others teach and disclose the signal peptide that can be used in the methods, procedures and peptide, protein and nucleotide complexes and constructs described herein.

[0236] II. The CRIP and ICK Motif Protein Component or crip and ick of the PEPs.

[0237] In our ICK motif protein expression ORF diagram, ick means a polynucleotide encoding an ICK motif protein, or inhibitor cystine knot motif protein, which is a 16 to 60 amino acid peptide with at least 6 half-cysteine core amino acids having three disulfide bridges, wherein the 3 disulfide bridges are covalent bonds and of the six half-cystine residues the covalent disulfide bonds are between the first and fourth, the second and fifth, and the third and sixth half-cystines, of the six core half-cystine amino acids starting from the N-terminal amino acid. The ICK motif protein also comprises a beta-hairpin secondary structure, normally composed of residues situated between the fourth and sixth core half-cysteines of the motif, the hairpin being stabilized by the structural crosslinking provided by the motif's three disulfide bonds. Note that additional cysteine/cysteine or half-cystine amino acids may be present within the inhibitor cysteine knot motif, as shown in FIG. 6. The CRIP or ICK motif can be repeated in order to increase toxic peptide accumulation in the plant. See FIG. 4 and FIG. 5. This ability to repeat the CRIP or ICK motif, from 1 to 10 times and sometimes up to 15, 20 or 25 times is also shown in the equation like diagram of a CRIP or ICK protein expression ORF described herein as ersp-sta-(linker.sub.i-ick.sub.j).sub.N, or ersp-(ick.sub.j-linker.sub.i).sub.N-sta where the number of repeating LINKER-ICK motifs is given by the subscript number N and N is commonly 1-10 but can go even higher in some plants.

[0238] A similar expression like ersp-sta-(linker.sub.i-ick.sub.j).sub.N, or ersp-(ick.sub.j-linker.sub.i).sub.N-sta could be written and would describe other CRIP peptides. In this section an example of one expression ORF is one used to increase peptide expression in plants and is best exemplified with an ICK protein. In the diagram above, a polynucleotide open reading frame (ORF) which expresses an ICK motif protein complex, which can be described as ERSP-STA-(LINKER.sub.I-ICK.sub.J).sub.N or ERSP-(ICK.sub.J-LINKER.sub.I).sub.N-STA, or as ERSP-STA-(L.sub.I-ICK.sub.J).sub.N or ERSP-(ICK.sub.J-L.sub.I).sub.N-STA, containing four possible peptide components with dash signs to separate the each component is used. An alternate method of showing this type of construct can be found in the figures. In the diagram and the figures, the nucleotide component of ersp is a polynucleotide segment encoding a plant endoplasmic reticulum trafficking signal peptide (ERSP). The component of sta is a polynucleotide segment encoding a translation stabilizing protein (STA), which helps the accumulation of the ICK motif protein expressed in plants but may not be necessary in the ICK motif protein expression ORF. The component of l.sub.i is a polynucleotide segment encoding an intervening linker peptide (L OR LINKER) to separate the ICK motif proteins from each other and from the translation stabilizing protein, and the subscription i indicates that different types of linker peptides can be used in the ICK motif protein expression ORF. In the case that sta is not used in the ICK motif protein expression ORF, ersp can directly be linked to the polynucleotide encoding an ICK motif protein without a linker. The component of ick.sub.i is a polynucleotide segment encoding an ICK motif protein (ICK), and the subscription j indicates different ICK motif proteins; (linker.sub.i-ick.sub.j).sub.N indicates that the structure of the nucleotide encoding an intervening linker peptide and an ICK motif protein can be repeated N times in the same open reading frame in the same ICK motif protein expression ORF, where N can be any integrate number from 1 to 10, but can go even higher to 15, 20 and 25, these repeats may contain polynucleotide segments encoding different intervening linkers and different ICK or CRIP motif proteins. The different polynucleotide segments including the repeats within the same ICK or CRIP motif protein expression ORF are all within the same translation frame.

[0239] This motif is common in peptides isolated from the venom of numerous species. Invertebrate species include spiders, scorpions, cone snail, sea anemone etc., other examples are numerous, even snake venom has been known to have peptides having the ICK motif. An example within spiders that we used is from a class of ACTX peptides from the Australian Blue Mountains Funnel-web Spider, but the procedures described herein are useful and may be applied to any protein with the ICK motif.

[0240] Examples of peptide toxins with the ICK motif can be found in the following references. The N-type calcium channel blocker -Conotoxin was reviewed by Lew, M. J. et al. Structure-Function Relationships of -Conotoxin GVIA Journal of Biological Chemistry, Vol. 272, No. 18, Issue of May 2, pp. 12014-12023, 1997. A summary of numerous arthropod toxic peptides from different spider and scorpion species was reviewed in, Quintero-Hernandez, V. et al. Scorpion and Spider Venom Peptides: Gene Cloning and Peptide Expression Toxicon, 58, pp. 644-663, 2011. The three-dimensional structure of Hanatoxin1 using NMR spectroscopy was identified as an inhibitor cysteine knot motif in Takahashi, H. et al. Solution structure of hanatoxin1, a gating modifier of voltage-dependent K+ channels: common surface features of gating modifier toxins Journal of Molecular Biology, Volume 297, Issue 3, 31 Mar. 2000, pp. 771-780. The isolation and identification of cDNA encoding a scorpion venom ICK toxin peptide, Opicalcine1, was published by Zhu, S. et al. Evolutionary origin of inhibitor cystine knot peptides FASEB J., 2003 Sep. 17, (12):1765-7, Epub 2003 Jul. 3. The sequence-specific assignment and the secondary structure identification of BgK, a K.sup.+ channel-blocking toxin from the sea anemone Bunodosoma granulifera, was disclosed by Dauplais, M. et al. On the convergent evolution of animal toxins Journal of Biological Chemistry. 1997 Feb. 14; 272(7): 4302-9. A review of the composition and pharmacology of spider venoms with emphasis on polypeptide toxin structure, mode of action, and molecular evolution showing cysteine bridges, cysteine knot formations and the knotting-type fold was published by Escoubas, P. et al. Structure and pharmacology of spider venom neurotoxins Biochimie, Vol. 82, Issues 9-10, 10 Sep. 2000, pp. 893-907. The purified peptide, iberiotoxin, an inhibitor of the Ca.sup.2+-activated K.sup.+ channel, from scorpion (Buthus tamulus) venom was disclosed in Galvez, A. et al. Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus Journal of Biological Chemistry, 1990 Jul. 5; 265(19): 11083-90. The purified peptide, charybdotoxin, an inhibitor of the Ca.sup.2+-activated K.sup.+ channel, from the venom of the scorpion Leiurus quinquestriatus was disclosed in Gimenez-Gallego, G. et al. Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium-activated potassium channels Proc Natl Acad Sci, 1988 May; 85(10): 3329-3333. From these and other publications, one skilled in the art should be able to readily identify proteins and peptides having what we describe as the ICK motif, ICK motif protein or the inhibitor cystine knot motif.

[0241] The ICK motif protein can be any protein with the ICK motif and is between 16 and 60 amino acids in length, with at least 6 cysteine residues that create covalent cross-linking disulfide bonds in the proper order. See FIG. 6. Some ICK motif peptides have between 26-60 amino acids in length. Some ICK motif proteins are between 16-48 amino acids in length. Some ICK motif proteins are between 26-48 amino acids in length. Some ICK motif proteins are between 30-44 amino acids in length. ICK motif proteins with natural insecticidal activity are preferred but ICK motif proteins with other types of activity such as salt and frost resistance are known to those skilled in the art and are claimed herein. Examples of insecticidal ICK motif proteins include the ACTX peptides and genes, and including all of the peptides and their coding genes known as Magi6.

[0242] An example of a protein expression ORF could be an ICK motif protein expression ORF diagrammed below as: [0243] ersp-sta-(linker.sub.i-ick.sub.j).sub.N, or ersp-(ick.sub.j-linker.sub.i).sub.N-sta

[0244] A similar expression could be written for other CRIP peptides. In this section this example of an expression ORF is one used to high peptide expression and is best exemplified with an ICK protein. The diagram above a polynucleotide open reading frame (ORF) which expresses an ICK motif protein complex, which can be described as ERSP-STA-(LINKER.sub.I-ICK.sub.J).sub.N or ERSP-(ICK.sub.J-LINKER.sub.I).sub.N-STA, or as ERSP-STA-(L.sub.I-ICK.sub.J).sub.N or ERSP-(ICK.sub.J-L.sub.I).sub.N-STA, containing four possible peptide components with dash signs to separate the each component, In this diagram, the nucleotide component of ersp is a polynucleotide segment encoding a plant endoplasmic reticulum trafficking signal peptide (ERSP). The component of sta is a polynucleotide segment encoding a translation stabilizing protein (STA), which helps the accumulation of the ICK motif protein expressed in plants but may not be necessary in the ICK motif protein expression ORF. The component of l.sub.i is a polynucleotide segment encoding an intervening linker peptide (L OR LINKER) to separate the ICK motif proteins from each other and from the translation stabilizing protein, and the subscription i indicates that different types of linker peptides can be used in the ICK motif protein expression ORF. In the case that sta is not used in the ICK motif protein expression ORF, ersp can directly be linked to the polynucleotide encoding an ICK motif protein without a linker. The component of ick.sub.i is a polynucleotide segment encoding an ICK motif protein (ICK), and the subscription j indicates different ICK motif proteins; (linker.sub.i-ick.sub.j).sub.N indicates that the structure of the nucleotide encoding an intervening linker peptide and an ICK motif protein can be repeated N times in the same open reading frame in the same ICK motif protein expression ORF, where N can be any integrate number from 1 to 10, and the repeats may contain polynucleotide segments encoding different intervening linkers and different ICK or CRIP motif proteins. The different polynucleotide segments including the repeats within the same ICK or CRIP motif protein expression ORF are all within the same translation frame.

[0245] Examples of insecticidal ICK motif proteins include the ACTX peptides and genes and include all of the peptides and their coding genes as described in the references provided above and herein. Specific examples of ICK motif proteins and peptides disclosed for purposes of providing examples and not intended to be limiting in any way, are the peptides and their homologies as described above, and in particular peptides and nucleotides which originate from the venoms of Australian Funnel-web spiders. The following documents are incorporated by reference in the United States in their entirety, are known to one skilled in the art, and have all been published. They disclose numerous ICK motif proteins which, their full peptide sequence, their full nucleotide sequence, are specifically disclosed and are incorporated by reference, and in addition the full disclosures are incorporated by reference including all of their sequence listings. See the following: U.S. Pat. No. 7,354,993 B2, issued Apr. 8, 2008, specifically the peptide and nucleotide sequences listed there as sequences 1-39, from U.S. Pat. No. 7,354,993 B2, and those named U-ACTX polypeptides, and these and other toxins that can form 2 to 4 intra-chain disulfide bridges, and variants thereof, and the peptides appearing on columns 4 to 9 and in FIG. 2 of U.S. Pat. No. 7,354,993 B2. Other specific sequences can be found in EP patent 1 812 464 B1, published and granted Aug. 10, 2008, see Bulletin 2008/41, specifically the peptide and nucleotide sequences listed in the sequence listing, and those the other toxins that can form 2 to 4 intra-chain disulfide bridges, and those sequences listed there as 1-39, and sequences named U-ACTX polypeptides, and variants thereof, and the peptides appearing in paragraphs 0023 to 0055, and appearing in FIG. 1 of EP patent 1 812 464 B1.

[0246] Described and incorporated by reference to the peptides identified herein are homologous variants of sequences mentioned, having homology to such sequences or referred to herein, which are also identified and claimed as suitable for making special according to the processes described herein, including all homologous sequences having at least any of the following percent identities to any of the sequences disclosed here or to any sequence incorporated by reference: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater identity or 100% identity to any and all sequences identified in the patents noted above, and to any other sequence identified herein, including each and every sequence in the sequence listing of this application. When the term homologous or homology is used herein with a number such as 50% or greater, then what is meant is percent identity or percent similarity between the two peptides. When homologous or homology is used without a numeric percent then it refers to two peptide sequences that are closely related in the evolutionary or developmental aspect in that they share common physical and functional aspects, like topical toxicity and similar size (i.e., the homolog being within 100% greater length or 50% shorter length of the peptide specifically mentioned herein or identified by reference herein as above).

[0247] Described and incorporated by reference to the peptides identified herein are toxic peptides including the following: peptides and its variants found in, isolated from, or derived from spiders of the genus Atrax or Hadronyche, including the genus species, Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, Atrax infensus, including toxins known as U-ACTX polypeptides, U-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, or mutants or variants, especially peptides of any of these types and especially those less than about 200 amino acids but greater than about 10 amino acids, and especially peptides less than about 150 amino acids but greater than about 20 amino acids, especially peptides less than about 100 amino acids but greater than about 25 amino acids, especially peptides less than about 65 amino acids but greater than about 25 amino acids, especially peptides less than about 55 amino acids but greater than about 25 amino acids, especially peptides of about 37 or 39 or about 36 to 42 amino acids, especially peptides with less than about 55 amino acids but greater than about 25 amino acids, especially peptides with less than about 45 amino acids but greater than about 35 amino acids, especially peptides with less than about 115 amino acids but greater than about 75 amino acids, especially peptides with less than about 105 amino acids but greater than about 85 amino acids, especially peptides with less than about 100 amino acids but greater than about 90 amino acids, including peptide toxins of any of the lengths mentioned here that can form 2, 3 and or 4 or more intrachain disulfide bridges, including toxins that disrupt calcium channel currents, including toxins that disrupt potassium channel currents, especially toxins that disrupt insect calcium channels or Us thereof, especially toxins or variants thereof of any of these types, and any combination of any of the types of toxins described herein that have oral or topical insecticidal activity, can be made special by the processes described herein.

[0248] The U peptides from the Australian Funnel Web Spider, genus Atrax and Hadronyche are particularly suitable and work well when treated by the methods, procedures or processes described by this invention. Examples of such suitable peptides tested and with data are provided herein. The following species are also specifically known to carry toxic peptides suitable for plant expression as PIPs by the process of this invention. The following species are specifically named: Atrax formidabillis, Atrax infensus, Atrax robustus, Hadronyche infensa, Hadronyche versuta. Any toxic peptides derived from any of the genus listed above and/or genus species and homologous to the U peptide are suitable for plant expression as PIPs according to the process in this invention.

[0249] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.

[0250] As noted above, many peptides are suitable candidates as the subject of the process for the plant expression as PIP. The sequences noted above, below and in the sequence listing are especially suitable peptides that can be expressed in plants as PIP, and some of these have been expressed in plants as PIP according to this invention with the results shown in the examples below.

TABLE-US-00002 (SEQIDNO:5) GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0251] Named U+2-ACTX-Hv1a, it has disulfide bridges at positions: 5-20, 12-25, 19-39. The molecular weight is 4564.85 Daltons. Another example of an ICK motif insecticidal protein:

TABLE-US-00003 (SEQIDNO:6) QYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0252] Named U-ACTX-Hv1a, it has disulfide bridges at positions: 3-18, 10-23, 17-37. The molecular weight is 4426.84 Daltons.

[0253] Additional examples include many sequences in the sequence listing.

[0254] III. The Translational Stabilizing Protein Component, STA or sta.

[0255] One of the ICK motif protein expression ORFs, ERSP-ICK, is sufficient to express a properly folded ICK motif peptide in the transformed plant, but in order for effective protection of a plant from pest damage, the plant expressed ICK motif protein needs to be accumulated to the insecticidal level. With transformation of a properly constructed ICK motif protein expression ORF, a transgenic plant can express and accumulate greater amounts of the correctly folded ICK motif protein. When a plant accumulates greater amounts of properly folded toxic peptides it can more easily resist or kill the insects that attack and eat the plants. The translational stabilizing protein can be used to significantly increase the accumulation of the toxic peptide in the plant and thus the potency of the PIP, especially when the PIP has a translational stabilizing protein of its own. See various representations of how the STA may be used in expression ORFs in FIGS. 2-5, and in various linear diagrams or equation like expressions used below. The translational stabilizing protein can be a domain of another protein or it can comprise an entire protein sequence. The translational stabilizing protein is a protein with sufficient tertiary structure that it can accumulate in a cell without being targeted by the cellular process of protein degradation. The protein can be between 5 and 50aa (e.g. another ICK-motif protein), 50 to 250aa (GNA), 250 to 750aa (e.g. chitinase) and 750 to 1500aa (e.g. enhancin).

[0256] In addition to FIGS. 2-5 the following linear diagram below describes one of the examples of the ICK motif protein expression ORF that encodes a stabilizing protein fused with ICK motif protein: [0257] ersp-sta-l-ick

[0258] The protein, or protein domain can contain proteins that have no useful characteristics other than translation stabilization, or they can have other useful traits in addition to translational stabilization. Useful traits can include: additional insecticidal activity, such as activity that is destructive to the peritrophic membrane, activity that is destructive to the gut wall, and/or activity that actively transports the ICK motif protein across the gut wall. One embodiment of the translational stabilizing protein can be a polymer of fusion proteins involving ICK motif proteins. A specific example of a translational stabilizing protein is provided here to illustrate the use of a translational stabilizing protein. The example is not intended to limit the disclosure or claims in any way. Useful translational stabilizing proteins are well known in the art, and any proteins of this type could be used as disclosed herein. Procedures for evaluating and testing production of peptides are both known in the art and described herein. One example of one translational stabilizing protein is SEQ ID NO: 7, one letter code, as follows:

TABLE-US-00004 (SEQIDNO:7) ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG KLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNG IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

[0259] Named GFP. The molecular weight is 26736.02 Daltons.

[0260] In some embodiments the STA can even be CRIP or ICK as shown in FIG. 5. In these embodiments there is no separate STA protein, the STA protein is the same as the CRIP or ICK used. It could be the identical ICK that is bound with the LINKER, or there could be different ICKs one type bound to the LINKER and the other type acting as the STA. These alternative arrangements are also discussed in the section on LINKERS.

[0261] Additional examples of translational stabilizing proteins can be found in the following references, incorporated by reference in their entirety: Kramer, K. J. et al. Sequence of a cDNA and expression of the gene encoding epidermal and gut chitinases of Manduca sexta Insect Biochemistry and Molecular Biology, Vol. 23, Issue 6, September 1993, pp. 691-701. Kramer, K. J. et al. isolated and sequenced a chitinase-encoding cDNA from the tobacco hornworm, Manduca sexta. Hashimoto, Y. et al. Location and nucleotide sequence of the gene encoding the viral enhancing factor of the Trichoplusia ni granulosis virus Journal of General Virology, (1991), 72, 2645-2651. Hashimoto, Y. et al. cloned the gene encoding the viral enhancing factor of a Trichoplusia ni granulosis virus and determined the complete nucleotide sequence. Van Damme, E. J. M. et al. Biosynthesis, primary structure and molecular cloning of snowdrop (Galanthus nivalis L.) lectin European Journal of Biochemistry, 202, 23-30 (1991). Van Damme, E. J. M. et al. isolated Poly(A)-rich RNA from ripening ovaries of snowdrop lectin (GNA), yielding a single 17-kDa lectin polypeptide upon translation in a wheat-germ cell-free system, called agglutin. These references and others teach and disclose translational stabilizing proteins that can be used in the methods, procedures and peptide, protein and nucleotide complexes and constructs described herein.

[0262] IV. The Intervening Linker Peptide Component, LINKER, Linker, L or if Polynucleotide: linker or l of the PEPs

[0263] The ICK motif protein expression ORF described in this invention also incorporates polynucleotide sequences encoding intervening linker peptides between the polynucleotide sequences encoding the ICK motif protein (ick) and the translational stabilizing protein (sta), or between polynucleotide sequences encoding multiple ICK motif proteins domain ((l-ick).sub.N or (ick-l).sub.N) if the expression ORF involves multiple ICK motif protein domain expression. The intervening linker peptides (LINKERS) separate the different parts of the expressed ICK motif protein complex and help proper folding of the different parts of the complex during the expression process. In the expressed ICK motif protein complex, different intervening linker peptides can be involved to separate different functional domains. Various representations of proteins with LINKERS are shown in (FIGS. 3-5.) The LINKER is attached to a CRIP such as an ICK and this bivalent group can be repeated up to 10 (N=1-10) and possibly even more than 10 times in order to facilitate the accumulation of properly folded insecticidal peptide in the plant that is to be protected.

[0264] The intervening linker peptide is usually between 1 and 30 amino acids in length. It is not necessary an essential component in the expressed ICK motif protein complex in plants. A cleavable linker peptide can be designed to the ICK motif protein expression ORF to release the properly folded ICK motif protein from the expressed ICK motif protein complex in the transformed plant to improve the protection the ICK motif protein to the plant from pest damage. One type of the intervening linker peptide is the plant cleavable linker peptide. This type of linker peptides can be completely removed from the expressed ICK motif protein expression complex during the post-translational expression process in the plant cells. Therefore the properly folded ICK motif protein linked by this type of intervening linker peptides can be released in the plant cells from the expressed ICK motif protein complex during the post-translational expression process. Here we show numerous examples of LINKERS.

[0265] Another type of the cleavable intervening linker peptide is not cleavable during the expression process in plants. However, it has a protease cleavage site specific to serine, threonine, cysteine, aspartate proteases or metalloproteases. The type of cleavable linker peptide can be digested by proteases found in the insect and lepidopteran gut environment and/or the insect hemolymph and lepidopteran hemolymph environment to release the ICK motif protein in the insect gut or hemolymph. Here we show numerous examples of LINKERS. These linkers are presented as examples only and should not be considered limiting the invention. Using the information taught by this disclosure it should be a matter of routine for one skilled in the art to make or find other examples of LINKERS that will be useful in this invention.

[0266] An example of a cleavable type of intervening linker that illustrates the invention is listed in SEQ ID NO: 1, but cleavable linkers are not limited to this example. SEQ ID NO: 1 (one letter code) is IGER and here we name it IGER. The molecular weight of this intervening linker or LINKER is 473.53 Daltons.

[0267] An intervening linker peptide (LINKER) can also be one without any type of protease cleavage site, i.e. an uncleavable intervening linker peptide. An example of this is the linker ETMFKHGL (SEQ ID NO: 3).

[0268] Other examples of intervening linker peptides can be found in the following references, which are incorporated by reference herein in their entirety: A plant expressed serine proteinase inhibitor precursor was found to contain five homogeneous protein inhibitors separated by six same linker peptides in Heath et al. Characterization of the protease processing sites in a multidomain proteinase inhibitor precursor from Nicotiana alata European Journal of Biochemistry, 1995; 230: 250-257. A comparison of the folding behavior of green fluorescent proteins through six different linkers is explored in Chang, H. C. et al. De novo folding of GFP fusion proteins: high efficiency in eukaryotes but not in bacteria Journal of Molecular Biology, 2005 Oct. 21; 353(2): 397-409. An isoform of the human GalNAc-Ts family, GalNAc-T2, was shown to retain its localization and functionality upon expression in N. benthamiana plants by Daskalova, S. M. et al. Engineering of N. benthamiana L. plants for production of N-acetylgalactosamine-glycosylated proteins BMC Biotechnology, 2010 Aug. 24; 10: 62. The ability of endogenous plastid proteins to travel through stromules was shown in Kwok, E. Y. et al. GFP-labelled Rubisco and aspartate aminotransferase are present in plastid stromules and traffic between plastids Journal of Experimental Botany, 2004 March; 55(397): 595-604. Epub 2004 Jan. 30. A report on the engineering of the surface of the tobacco mosaic virus (TMV), virion, with a mosquito decapeptide hormone, trypsin-modulating oostatic factor (TMOF) was made by Borovsky, D. et al. Expression of Aedes trypsin-modulating oostatic factor on the virion of TMV: A potential larvicide Proc Natl Acad Sci, 2006 Dec. 12; 103(50): 18963-18968. These references and others teach and disclose the intervening linkers that can be used in the methods, procedures and peptide, protein and nucleotide complexes and constructs described herein.

[0269] The ICK motif protein expression ORF described above can be cloned into any plant expression vector for the ICK motif protein expression in plant transiently or stably.

[0270] Transient Plant Expression Systems

[0271] Transient plant expression systems can be used to promptly optimize the structure of the ICK motif protein expression ORF for some specific ICK motif protein expression in plants, including the necessity of some components, codon optimization of some components, optimization of the order of each components, etc. A transient plant expression vector is often derived from a plant virus genome. Plant virus vectors provide advantages in quick and high level of foreign gene expression in plant due to the infection nature of plant viruses. The full length of the plant viral genome can be used as a vector, but often a viral component is deleted, for example the coat protein, and transgenic ORFs are subcloned in that place. The ICK motif protein expression ORF can be subcloned into such a site to create a viral vector. These viral vectors can be introduced into plant mechanically since they are infectious themselves, for example through plant wound, spray-on etc. They can also be transformed into plants by agroinfection by cloning the virus vector into the T-DNA of the crown gall bacterium, Agrobacterium tumefaciens, or the hairy root bacterium, Agrobacterium rhizogenes. The expression of the ICK motif protein in this vector is controlled by the replication of the RNA virus, and the virus translation to mRNA for replication is controlled by a strong viral promoter, for example, 35S promoter from Cauliflower mosaic virus. Viral vectors with ICK motif protein expression ORF are usually cloned into T-DNA region in a binary vector that can replicate itself in both E. coli strains and Agrobacterium strains. The transient transformation of a plant can be done by infiltration of the plant leaves with the Agrobacterium cells which contain the viral vector for ICK motif protein expression. In the transient transformed plant, it is common for the foreign protein expression to be ceased in a short period of time due to the post-transcriptional gene silencing (PTGS). Sometimes a PTGS suppressing protein gene is necessary to be co-transformed into the plant transiently with the same type of viral vector that drives the expression of with the ICK motif protein expression ORF. This improves and extends the expression of the ICK motif protein in the plant. The most commonly used PTGS suppressing protein is P19 protein discovered from tomato bushy stunt virus (TBSV).

[0272] A demonstration of transient plant expression can be found in FIG. 7.

[0273] FIG. 7 shows transiently expressed Plant Transgenic Protein. FIG. 7 reports the relative accumulation of the ICK proteins compared to the % TSP, as detected by ELISA. There are four variations of ICK expression ORFs in FIG. 7 that illustrate the necessity of the ERSP to get proper folding of the ICK and the STA to get accumulation of the protein. Bar A reports a FECT expression system expressing SEQ ID NO: 8 the omega peptide (ICK) without any fusions. Bar B reports a TRBO expression system expressing SEQ ID NO: 9 a BAAS ERSP fused to the omega peptide (ICK). Bar C reports a FECT expression system expressing SEQ ID NO: 10 a GFP (STA) fused to IGER (Linker) fused to Hybrid toxin (ICK). Bar D reports a FECT expression system expressing SEQ ID NO: 11 a BAAS (ERSP) fused to a GFP (STA) fused to IGER (Linker) fused to Hybrid toxin (ICK). The detection levels for Bar A and B show negligible protein detection. In Bar A this is likely due to no proper folding of the ICK which occurs in the ER and in Bar B this is likely due to proper folding but no accumulation due to the lack of a STA. There are detectable levels in Bars C and D. When the experiment for Bar C [(SEQ ID NO: 10) a GFP (STA) fused to IGER (Linker) fused to Hybrid toxin (ICK)] was performed there was a high level of GFP fluorescence detected (data not shown) indicating much of the TSP was the fusion protein, however, when the ELISA was performed only 0.01% of the TSP was detected, and this is likely due to the lack of proper folding which did not occur as this protein was not targeted to the ER where folding occurs. The antibodies used in ELISA only detect the tertiary structure of a properly folded protein. When the experiment for Bar D [SEQ ID NO: 11 a BAAS (ERSP) fused to a GFP (STA) fused to IGER (Linker) fused to Hybrid toxin (ICK)] was performed there was some GFP fluorescence detected and an accumulation 0.1% of the TSP the ICK peptide fused to GFP. When the data for Bars A, B, C and D is taken together it is apparent that an ERSP in the ICK expression ORF is required to get proper folding and to increase the accumulation of the peptide a STA is required.

[0274] We have demonstrated and documented GFP emission of the green fluorescence of GFP-Hybrid fusion protein constructs in tobacco leaves transiently transformed using different FECT vectors designed for targeted expression. We have succeeded in using pFECT-BGIH vector for APO (apoplast localization) accumulation; pFECT-GIH vector for CYTO (cytoplasm localization) accumulation; and pFECT-BGIH-ER vector for ER (endoplasm reticulum localization) accumulation. Data not shown.

[0275] We have demonstrated and documented GFP emission of the green fluorescence of GFP-Hybrid fusion protein constructs in tobacco leaves transiently transformed using different types of ERSP. We have succeeded in demonstrating expression with pFECT-BGIH vector; expression with pFECT-EGIH vector; and expression with pFECT-E*GIH vector. Data not shown.

[0276] We have measured levels of peptide accumulation and this is shown in FIGS. 8 and 9. FIG. 8 is a graph of iELISA detected % TSPs of tobacco transiently expressed GFP fused U-ACTX-Hv1a with different accumulation localization. APO: apoplast localization; CYTO: cytoplasm localization; ER: endoplasm reticulum localization. FIG. 9 is a graph of iELISA detected % TSPs of tobacco leaves transiently expressing GFP fused U-ACTX-Hv1a using the FECT expression vectors encoding translational fusions with three different ERSP sequences: BAAS signal peptide (BGIH), Extensin signal peptide (EGIH) and modified Extensin signal peptide (E*GIH).

[0277] Integration of Protein Expression ORF into Plant Genome Using Stable Plant Transformation Technology

[0278] The ICK motif protein expression ORF can also be integrated into plant genome using stable plant transformation technology, and therefore ICK motif proteins can be stably expressed in plants and protect the transformed plants from generation to generation. For the stable transformation of plants, the ICK motif protein expression vector can be circular or linear. A few critical components must be included in the vector DNA. The ICK motif protein expression ORF for stable plant transformation should be carefully designed for optimal expression in plants based on the study in the transient plant expression as described above. The expression of ICK motif protein is usually controlled by a promoter that promotes transcription in some of all cells of the transgenic plant. The promoter can be a strong plant viral promoter, for example, the constitutive 35S promoter from Cauliflower Mosaic Virus (CaMV); it also can be a strong plant promoter, for example, the hydroperoxide lyase promoter (pHPL) from Arabidopsis thaliana; the Glycine max polyubiquitin (Gmubi) promoter from soybean; the ubiquitin promoters from different plant species (rice, corn, potato, etc.), etc. A plant transcriptional terminator often occurs after the stop codon of the ORF to halt the RNA polymerase and transcription of the mRNA. To evaluate the ICK motif protein expression, a reporter gene can be included in the ICK motif protein expression vector, for example, beta-glucuronidase gene (GUS) for GUS straining assay, green fluorescent protein (GFP) gene for green fluorescence detection under UV light, etc. For selection of transformed plants, a selection marker gene is usually included in the ICK motif protein expression vector. The marker gene expression product can provide the transformed plant with resistance to specific antibiotics, for example, kanamycin, hygromycin, etc., or specific herbicide, for example, glyphosate etc. If agroinfection technology is adopted for plant transformation, T-DNA left border and right border sequences are also included in the ICK motif protein expression vector to transport the T-DNA portion into the plant. The constructed ICK motif protein expression vector can be transform into plant cells or tissues using many transformation technologies. Agroinfection is a very popular way to transform a plant using an Agrobacterium tumefaciens strain or an Agrobacterium rhizogenes strain. Particle bombardment (also called Gene Gun, or Biolistics) technology is also very commonly used for plant transformation. Other less commonly used transformation methods include tissue electroporation, silicon carbide whiskers, direct injection of DNA, etc. After transformation, the transformed plant cells or tissues placed on plant regeneration media to regenerate successfully transformed plant cells or tissues into transgenic plants. The evaluation of the integration and expression of the ICK motif protein expression ORF in the transformed plant can be performed as follows.

[0279] Evaluation of a Transformed Plant

[0280] Evaluation of a transformed plant can be done in DNA level, RNA level and protein level. A stably transformed plant can be evaluated at all of these levels and a transiently transformed plant is usually only evaluated at protein level. To ensure that the ICK expression motif protein expression ORF integrates into the genome of a stably transformed plant, the genomic DNA can be extracted from the stably transformed plant tissues for the PCR evaluation or the Southern blot application. The expression of the ICK motif protein in the stably transformed plant can be evaluated in RNA level, i.e. the total mRNA can be extracted from the transformed plant tissues and the northern blot technique and the RT-PCR technology can applied to evaluate the mRNA level of the ICK motif protein qualitatively or quantitatively. The expression of the ICK motif protein in the transformed plant can also be evaluated in protein level directly. There are many ways to evaluate the ICK motif protein expressed in a transformed plant. If a reporter gene is transformed into the plant along with the ICK motif protein expression ORF, the reporter gene assay can be performed to initially evaluate the expression of the transformed ICK motif protein expression ORF, for example, GUS straining assay for GUS reporter gene expression, green fluorescence detection assay for GFP reporter gene expression, luciferase assay for luciferase reporter gene expression, etc. Moreover, the total expressed protein can be extracted from the transformed plant tissues for the direct evaluation of the expression of the ICK motif protein in the transformed plants. The extracted total expressed protein sample can be used in Bradford assay to evaluate the total protein level in the sample. Analytical HPLC chromatography technology, Western blot technique, or iELISA assay can be adopted to qualitatively or quantitatively evaluate the ICK motif protein in the extracted total protein sample from the transformed plant tissues. The ICK motif protein expression can also be evaluated by using the extracted total protein sample from the transformed plant tissues in an insect bioassay. Finally, the transformed plant tissue or the whole transformed plant can be tested in insect bioassays to evaluate the ICK motif protein expression and its protection for the plant.

[0281] We provide a detailed description and summary of Part I as follows:

[0282] We describe a protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to a Cysteine Rich Insecticidal Protein (CRIP) such as an Inhibitor Cysteine Knot (ICK) motif protein wherein said ERSP is the N-terminal of said protein (ERSP-ICK). The ERSP is any signal peptide which directs the expressed CRIP to the endoplasmic reticulum of plant cells. The CRIP can be an Inhibitor Cysteine Knot (ICK) protein or a Non-ICK protein. The ERSP is a peptide between 5 to 50 amino acids in length, originating from a plant, that is operably linked to a Translational Stabilizing Protein (STA), wherein said ERSP is the N-terminal of said protein and an intervening STA sequence may be either on the N-terminal side of the CRIP, which is optionally an ICK motif protein (ERSP-STA-ICK); or Non-ICK motif protein (ERSP-STA-Non-ICK) or on the C-terminal side of the ICK or Non-ICK motif protein (ERSP-ICK-STA) or (ERSP-Non-ICK-STA). The ERSP is a peptide between 3 to 60 amino acids in length, or a peptide between 5 to 50 amino acids in length, or a peptide between 20 to 30 amino acids in length. It can originate from a plant, Barley Alpha-Amylase Signal peptide (BAAS) with a SEQ ID NO: 4. The ERSP can be a peptide that is tobacco extensin signal peptide with a SEQ ID NO: 18. The ERSP can be a modified tobacco extensin signal peptide with a SEQ ID NO: 19, or a Jun a 3 signal peptide from Juniperus ashei with a SEQ ID NO: 27.

[0283] We describe a CRIP example that is an ICK motif protein is between 16 and 60 amino acids in length, between 26 and 48 amino acids in length, between 30 and 44 amino acids in length, where it is selected from any of the peptides or sources of peptides with inhibitory cysteine knot motif, or a insecticidal peptide and where it is any of the peptides or sources of peptides including Atrax or Hadronyche, any of the peptides originating from Hadronyche versuta, an ACTX peptide. The ICK motif protein is any insecticidal peptide and fragments thereof including mature, pre, and pro peptide versions of said peptides and sequence numbers as well as any mutations, or deletion, or addition of peptide segments but still maintenance of inhibitory cysteine knot structure. The ICK motif protein can be U-ACTX-Hv1a with SEQ ID NO: 6, Omega-ACTX-Hv1a with SEQ ID NO: 24, Kappa-ACTX-Hv1c. An expression ORF comprising any of the nucleotides that code for those peptides. An expression ORF comprising any of the nucleotides that code for the peptides integrated into a transgenic plant genome. The use of any of the peptides or nucleotides described herein to make or transform a plant or plant genome in order to express properly folded insecticidal peptides in a transformed plant and or to make or transform a plant or plant genome in order to express properly folded insecticidal peptides in the transformed plant and to cause the accumulation of the expressed and properly folded insecticidal peptides in said plant and to cause an increase the plant's resistance to insect damage. We describe procedures to use nucleotides to create transgenic plants and transformed plants having or expressing any of the peptides described herein. We describe a transformed plant made by any of these products and processes.

[0284] We describe a protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to a CRIP which is optionally an Inhibitor Cysteine Knot (ICK) motif protein or Non-ICK protein operably linked to a Translational Stabilizing Protein (STA), wherein said ERSP is the N-terminal of said protein and an intervening Translational Stabilizing Protein sequence may be either on the N-terminal side of the ICK motif protein (ERSP-STA-ICK or optionally a (ERSP-Non-ICK-STA) or the C-terminal side of the ICK motif protein (ERSP-ICK-STA) or ERSP-STA-Non-ICK).

[0285] We describe such a STA with a molecular weight of 12 kD and above, where said STA can be many proteins, including an ICK motif protein with molecular weight of 12 kD and above, or multiple ICK motif proteins connected with linker peptides (L) with molecular weight of 12 kD and above, for example ERSP-ICK-(L.sub.i-ICK.sub.j).sub.N, or ERSP-(ICK.sub.j-L.sub.i).sub.N-ICK. We explain the linker peptides can be the same or different. We say that one STA is an green fluorescence protein (GFP) originating from jellyfish with SEQ ID NO: 13 and the STA can be a snowdrop lectin, Galanthus nivalis agglutinin (GNA), with SEQ ID NO: 28 and that STA can be a Juniperus ashei protein, Jun a 3, with SEQ ID NO: 26.

[0286] We describe a LINKER is any peptide with 4-20 amino acids in length. We describe a LINKER that is any peptide containing a protease recognition site. We describe a LINKER as any peptide containing a plant protease cleavage site. We describe a LINKER is a peptide containing an amino acid sequence of IGER (SEQ ID NO: 1), EEKKN (SEQ ID NO: 2) and (SEQ ID NO: 3). We describe a LINKER as any peptide which can be cleaved in the insect digestive system, or in the insect hemolymph. We describe a LINKERs wherein said LINKER is a peptide containing a trypsin cleavage site.

[0287] We describe a nucleotide that codes for any of the proteins described including expression ORFs comprising any of the nucleotides that code for the peptides, as well as expression ORF comprising any of the nucleotides that code for the peptides, integrated into a transgenic plant genome, as well as transformed into a plant or plant genome in order to express properly folded insecticidal peptides in a transformed plant, as well as transformed into a plant or plant genome in order to express properly folded insecticidal peptides in the transformed plant and to cause the accumulation of the expressed and properly folded insecticidal peptides in said plant and to cause an increase the plant's resistance to insect damage. We describe transgenic plants that result from these descriptions and transformed plants having or expressing any of the peptides described herein.

[0288] We explain and describe an expression ORF comprising any of the nucleotides that code for the peptides herein as well an expression ORF integrated into a transgenic plant genome, and one reason this is done is to make or transform a plant or plant genome in order to express properly folded insecticidal peptides in a transformed plant and one reason this is done is to have the transformed plant cause the accumulation of the expressed and properly folded insecticidal peptides in said plant and to cause an increase the plant's resistance to insect damage. We teach how to make the transgenic plants using these procedures and expressing the peptides herein and any other peptides that one skilled in the art would use given the teaching herein and using any of the products and processes described herein.

[0289] We teach how to make a protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to an Inhibitor Cysteine Knot (ICK) motif protein operably linked to translational stabilizing protein (STA), operably linked to an intervening linker peptide (L), wherein said ERSP is the N-terminal of said protein, and said LINKER is between STA and the ICK motif protein, and said translational stabilizing protein may be either on the N-terminal side (upstream) of the ICK motif protein or the C-terminal side (downstream) of the ICK motif protein, and described as ERSP-STA-L-ICK, or ERSP-ICK-L-STA. And we explain the aforementioned ERSP, CRIP and ICK, LINKER, STA can be any of the peptides as described herein and any other peptides that one skilled in the art would use given the teaching herein and using any of the products and processes described herein.

[0290] We teach how to make a protein comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to a multiple Inhibitor Cysteine Knot (ICK) motif protein domain in which ICK motif proteins are linked to each other via intervening linker peptides (L), operably linked to a translational stabilizing protein (STA), operably linked to an intervening linker peptide (L), wherein said ERSP is the N-terminal of said protein, and said LINKER is between STA and the multiple ICK motif proteins domain, and said STA may be either on the N-terminal side (upstream) of the multiple ICK motif protein domain or the C-terminal side (downstream) of the multiple ICK motif protein domain, and described as ERSP-STA-(L.sub.i-ICK.sub.j).sub.N, or ERSP-(ICK.sub.j-L.sub.i).sub.N-STA.

[0291] We teach how to make the nucleotides that code for these proteins, the expression ORFs, to make a and to integrated into a transgenic plant genome, the chimeric genes, recombinant vectors, transgenic host cells, transgenic plant cells, transgenic plants, transgenic plants of which are corn, soybean, cotton, rice, wheat, sorghum, switchgrass, sugarcane, alfalfa, potatoes, tomatoes, tobacco, any of green leafy vegetables, or any of fruit trees, or any plants and species as mentioned herein, and a seed from a transgenic plant according to these procedures where the seed comprises the chimeric gene.

PART I. EXAMPLES

[0292] The Examples in this specification are not intended to, and should not be used to, limit the invention; they are provided only to illustrate the invention.

Example 1

[0293] Expression Comparison Between Two Transient Plant Expression Systems.

[0294] The transient plant transformation technologies were adopted to promptly optimize the ICK motif protein expression ORF for plant expression. Agroinfection technology with a plant viral vector has been used here for the transient plant transformation due to its high efficiency, easiness and inexpensiveness. Two viral transient plant expression systems were evaluated here for the ICK motif protein expression in plants. One was a tobacco mosaic virus overexpression system (TRBO, Lindbo J A, Plant Physiology, 2007, V145: 1232-1240). The TRBO DNA vector has a T-DNA region for agroinfection, which contains a CaMV 35S promoter that drives expression of the tobacco mosaic virus RNA without the gene encoding the viral coating protein. The other viral transient plant expression system was the FECT expression system (Liu Z & Kearney C M, BMC Biotechnology, 2010, 10:88). The FECT vector also contains a T-DNA region for agroinfection, which contains a CaMV 35S promoter that drives the expression of the foxtail mosaic virus RNA without the genes encoding the viral coating protein and the triple gene block. Both expression systems use the disarmed virus genome, therefore viral plant to plant transmission can be effectively prevented. To efficiently express the introduced heterologous gene, the FECT expression system additionally needs to co-express P19, a RNA silencing suppressor protein from tomato bushy stunt virus, to prevent the post-transcriptional gene silencing (PTGS) of the introduced T-DNA. (The TRBO expression system does not need co-expression of P19). The two transient plant expression systems were tested and compared by transient expression of ICK motif protein in Tobacco (Nicotiana benthamiana) as described below.

[0295] The ICK motif protein expression ORF was designed to encode a series of translationally fused structural motifs that can be described as follows: N-ERSP-Sta-L-ICK-C. Here the ICK motif protein for expression is U-ACTX-Hv1a, which has the following amino acid sequence (N to C, one letter code):

TABLE-US-00005 (SEQIDNO:12) QYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0296] The ERSP motif used here is the Barley Alpha-Amylase Signal peptide (BAAS), which comprises of 24 Amino acids as shown below (N to C, one letter code):

TABLE-US-00006 (SEQIDNO:4) MANKHLSLSLFLVLLGLSASLASG

[0297] The stabilizing protein (Sta) in this expression ORF was Green Fluorescent Protein (GFP), which has amino acid sequence as follows (N to C, one letter code):

TABLE-US-00007 (SEQIDNO:13) MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIS FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

[0298] The linker peptide between GFP and U-ACTX-Hv1a contains the trypsin cleavage site and has an amino acid sequence as shown below (N to C, one letter code):

TABLE-US-00008 (SEQIDNO:1) IGER

[0299] According to the ICK motif expression ORF formula, this specific ICK expression ORF can be described as BAAS-GFP-IGER-Hybrid, or BGIH. The BGIH ORF was chemically synthesized by adding Pac I restriction site at its 5 terminus and Avr II restriction site at its 3 terminus. The sequence of the synthetic BGIH is below:

TABLE-US-00009 (SEQIDNO:14) TTAATTAAATGGCTAATAAACACCTGAGTTTGTCACTATTCCTCGTGTTG CTCGGGTTATCTGCTTCACTTGCAAGCGGAGCTAGCAAAGGAGAAGAACT TTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATG GGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCTACATACGGA AAGCTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATG GCCAACACTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTT ATCCGGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAA GGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAA GACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCG AGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAA CTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACA AAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATG GATCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGAT GGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGCCCT TTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTG TAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAAATTGGT GAAAGACAATATTGTGTTCCAGTTGATCAACCATGTTCTCTTAATACTCA ACCATGTTGTGATGATGCTACTTGTACTCAAGAAAGAAATGAAAATGGAC ATACTGTTTATTATTGTAGAGCTTAACCTAGG

[0300] The BGIH ORF was cloned into the Pac I and Avr II restriction sites of the FECT expression vector to create a BGIH expression vector for the FECT transient plant expression system (pFECT-BGIH). To maximize BGIH expression in the FECT expression system, a FECT vector expressing the RNA silencing suppressor protein P19 (pFECT-P19) was generated for co-transformation. To create a BGIH expression vector for TRBO transient plant expression system, a routine PCR procedure was performed to add a Not I restriction site to the 3 terminus of the BGIH ORF described above. The new BGIH ORF was then cloned into Pac I and Not I restriction sites of the TRBO expression vector to create a BGIH expression vector for the TRBO transient plant expression system (pTRBO-BGIH).

[0301] An Agrobacterium tumefaciens strain, GV3101, was used for the transient expression of BGIH in tobacco leaves by the FECT and TRBO expression systems. To make competent GV3101 cells the following procedure was performed: an overnight culture of GV3101 was used to inoculate 200 mL Luria-Bertani (LB) medium. The cells were then allowed to grow to log phase with OD600 between 0.5 and 0.8. Then the cells were pelleted by centrifugation at 5000 rpm for 10 minutes at 4 C. The cells were then washed once with 10 mL prechilled TE buffer (Tris-HCl 10 mM, EDTA 1 mM, pH8.0), and then resuspended into 20 mL LB medium. The GV3101 cell resuspension was then aliquoted in 250 L fractions into 1.5 mL microtubes. The aliquots were then snap-frozen in liquid nitrogen and stored at 80 C. freezer for future transformation.

[0302] The pFECT-BGIH and pTRBO-BGIH vectors were then transformed into the competent GV3101 cells using a freeze-thaw method as follows: the stored competent GV3101 cells were thawed on ice and then mixed with 1-5 g pure DNA (pFECT-BGIH or pTRBO-BGIH vector). The cell-DNA mixture was then kept on ice for 5 minutes, then transferred to 80 C. for 5 minutes, and then incubated in a 37 C. water bath for 5 minutes. The freeze-thaw treated cells were then diluted into 1 mL LB medium and shaken on a rocking table for 2-4 hours at room temperature. A 200 L aliquot of the cell-DNA mixture was then spread onto LB agar plates with the appropriate antibiotics (10 g/mL rifampicin, 25 g/mL gentamycin, and 50 g/mL kanamycin were used for both pFECT-BGIH transformation and pTRBO-BGIH transformation) and incubated at 28 C. for two days. Resulting transformant colonies were then picked and culture in 6 mL aliquots of LB medium with the appropriate antibiotics for transformed DNA analysis and making glycerol stocks of the transformed GV3101 cells.

[0303] The transient transformation of tobacco leaves was performed using leaf injection with a 3 mL syringe without needle. The transformed GV3101 cells were streaked onto an LB plate with the appropriate antibiotics (as described above) and incubated at 28 C. for two days. A colony of transformed GV3101 cells was inoculated to 5 ml of LB-MESA medium (LB media supplemented with 10 mM MES, 20 M acetosyringone) and the same antibiotics described above, and grown overnight at 28 C. The cells of the overnight culture were collected by centrifugation at 5000 rpm for 10 minutes and resuspended in the induction medium (10 mM MES, 10 mM MgCl2, 100 M acetosyringone) at a final OD600 of 1.0. The cells were then incubated in the induction medium for 2 hour to overnight at room temperature and were then ready for transient transformation of tobacco leaves. The treated cells were infiltrated into the underside of attached leaves of Nicotiana benthamiana plants by injection, using a 3 mL syringe without a needle attached. For the FECT transient transformation, the pFECT-BGIH transformed GV3101 cells and pFECT-P19 transformed GV3101 cells were mixed together in equal amounts for infiltration of tobacco leaves by injection with a 3 mL syringe. For the TRBO transient transformation, only pTRBO-BGIH transformed GV3101 cells were infiltrated into tobacco leaves. The ICK motif protein expression in tobacco leaves was evaluated at 6-8 days post-infiltration.

[0304] The BGIH expression ORF contains a fusion protein of GFP (STA) and U-ACTX-Hv1a (ICK) with an IGER (SEQ ID NO: 1) linker peptide (LINKER) between them. As shown in FIG. 3, the green fluorescence of the expressed GFP portion of the transgenes was detected under U.V. light in tobacco leaves transformed with both the FECT and TRBO vectors. Interestingly, green fluorescence appeared evenly distributed in the FECT vector transformed tobacco leaves (with the exception of the vascular tissues), whereas green fluorescence in the TRBO vector transformed tobacco leaves appeared to accumulate in the vascular tissues which is due to TRBO retaining its viral movement protein and FECT not.

[0305] To quantitatively evaluate the ICK motif protein expression, the expressed proteins in the transformed tobacco leaves were extracted by following the procedure described here. 100 mg disks of transformed leaf tissue were collected by punching leaves with the large opening of a 1000 L pipette tip. The collected leaf tissue was place into a 2 mL microtube with 5/32 diameter stainless steel grinding balls, and frozen in 80 C. for 1 hour, and then homogenized using a Troemner-Talboys High Throughput Homogenizer. 750 L ice-cold TSP-SE1 extraction solutions (sodium phosphate solution 50 mM, 1:100 diluted protease inhibitor cocktail, EDTA 1 mM, DIECA 10 mM, PVPP 8%, pH 7.0) was added into the tube and vortexed. The microtube was then left still at room temperature for 15 minutes and then centrifuged at 16,000 g for 15 minutes at 4 C. 100 L of the resulting supernatant was taken and loaded into pre-Sephadex G-50-packed column in 0.45 m Millipore MultiScreen filter microtiter plate with empty receiving Costar microtiter plate on bottom. The microtiter plates were then centrifuged at 800 g for 2 minutes at 4 C. The resulting filtrate solution, herein called total soluble protein extract (TSP extract) of the tobacco leaves, was ready for the quantitative analysis.

[0306] The total soluble protein concentration of the TSP extract was estimated using Pierce Coomassie Plus protein assay. BSA protein standards with known concentrations were used to generate a protein quantification standard curve. 2 L of each TSP extract was mixed into 200 L of the chromogenic reagent (CPPA reagent) of the Coomassie Plus protein assay kits and let react for 10 minutes. The chromogenic reaction was then evaluated by reading OD595 using a SpectroMax-M2 plate reader using SoftMax Pro as control software. The concentrations of total soluble proteins were 0.7880.20 g/L and 0.5330.03 g/L in the TSP extract from FECT-BGIH expression leaves and TRBO-BGIH expression leaves respectively. These results were used for the calculation of percentage of the expressed U-ACTX-Hv1a in the TSP (% TSP) in the iELISA assay.

[0307] Indirect ELISA (iELISA) assay was performed as follows to quantitatively evaluate the ICK motif protein in the tobacco leaves transiently transformed with the FECT and TRBO expression systems. 5 L of the leaf TSP extract was diluted into 95 L CB2 solution (Immunochemistry Technologies) in the well of an Immulon 2HD 96-well plate, with serial dilutions performed as necessary. Leaf proteins were from the extract samples were then allowed to coat the well walls for 3 hours in the dark at room temperature, and then the CB2 solution was removed, and each well was washed twice with 200 L PBS (Gibco). 150 L blocking solution (Block BSA in PBS with 5% non-fat dry milk) was then added into each well and incubated for 1 hour, in the dark, at room temperature. After the removal of the blocking solution and a PBS wash of the wells, 100 L of rabbit anti-U-ACTX-Hv1a antibody (primary antibody) (1:250 dilution in blocking solution) was added to each well and incubated for 1 hour in the dark at room temperature. The primary antibody was then removed and each well was washed with PBS 4 times. Then 100 L of HRP-conjugated goat anti-rabbit antibody (secondary antibody, used at 1:1000 dilution in the blocking solution) was added into each well and incubated for 1 hour in the dark at room temperature. After removal of the secondary antibody and wash of the wells with PBS, 100 L substrate solution (a 1:1 mixture of ABTS peroxidase substrate solution A and solution B, KPL) was added to each well, and the chromogenic reaction was allowed to go until sufficient color development was apparent. Then 100 L of peroxidase stop solution was added to each well to stop the reaction. The light absorbance of each reaction mixture in the plate was read at 405 nm using a SpectroMax-M2 plate reader, with SoftMax Pro used as control software. Serially diluted known concentrations of pure U-ACTX-Hv1a samples were treated in the same manner as described above in the iELISA assay to generate a mass-absorbance standard curve for quantities analysis. The expressed U-ACTX-Hv1a was detected by iELISA at 3.091.83 ng/L in the leaf TSP extracts from the FECT-BGIH transformed tobacco; and 3.560.74 ng/L in the leaf TSP extract from the TRBO-BGIH transformed tobacco. Or the expressed U-ACTX-Hv1a is 0.40% total soluble protein (% TSP) for FECT-BGIH transformants and 0.67% TSP in TRBO-BGIH transformants.

[0308] In conclusion, both FECT and TRBO transient plant expression systems can be used to express the ICK motif protein in plant. The ICK motif protein expression level in both systems is very close. However, the expression in the FECT system distributes evenly in the agroinfiltrated leaves, whereas the expression in the TRBO system accumulates in the vascular tissue of the agroinfiltrated leaves.

Example 2

[0309] ICK Motif Protein Transient Expression in Tobacco Leaf with Accumulation at Different Subcellular Targets.

[0310] Plant expressed ICK motif protein needs to accumulate to a certain level in the plant to effectively protect the plant from insect damage. The accumulation level of the plant expressed ICK motif protein may be affected by its final localization in the plant cells. In this example, we investigated the effects of different subcellular localizations of the plant expressed ICK motif protein on the protein's accumulation level in the plant (using the FECT transient plant expression system). Three subcellular targets were investigated in this example, plant cell wall apoplast (APO), the endoplasmic reticulum (ER) and the cytoplasm (CYTO).

[0311] The APO targeted ICK motif protein expression ORF was designed to encode a series of translationally fused structural motifs that can be described as follows: N-ERSP-Sta-L-ICK-C. Again the ICK motif protein in this study was U-ACTX-Hv1a, and the BGIH expression ORF in the example 1 was used. The same vector as in the example 1, pFECT-BGIH, was used here.

[0312] The CYTO targeted ICK motif protein expression ORF was designed to encode a series of translationally fused structural motifs that can be described as follows: N-STA-L-ICK-C. In this study, the DNA sequence encoding the barley -amylase signal peptide was removed from the BGIH expression ORF and became the GIH expression ORF, whose open reading frame sequence is below:

TABLE-US-00010 (SEQIDNO:15) ATGGCTAGCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGT TGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGG GTGAAGGTGATGCTACATACGGAAAGCTTACCCTTAAATTTATTTGCACT ACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTTTCTCTTA TGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAACGGCATGACT TTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGG TGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAG ATGGAAACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAAT GTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCAA AATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCAGACCATTATC AACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCAT TACCTGTCGACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGCGTGA CCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCA TGGATGAGCTCTACAAAATTGGTGAAAGACAATATTGTGTTCCAGTTGAT CAACCATGTTCTCTTAATACTCAACCATGTTGTGATGATGCTACTTGTAC TCAAGAAAGAAATGAAAATGGACATACTGTTTATTATTGTAGAGCTTAA

[0313] The GIH expression ORF was cloned into the Pac I and Avr II restriction sites of the FECT expression vector to create a GIH expression vector for FECT transient plant expression system (pFECT-GIH) for the CYTO targeting expression of U-ACTX-Hv1a.

[0314] The ER targeted ICK motif protein expression ORF was designed by adding a DNA sequence encoding the ER targeting signal peptide at the C end of the BGIH expression ORF which was named as BGIH-ER expression ORF. The ER targeting signal peptide used here has the following amino acid sequence (one letter code for amino acid):

TABLE-US-00011 (SEQIDNO:16) KDEL

[0315] The DNA sequence of the BGIH-ER expression ORF is as follows:

TABLE-US-00012 (SEQIDNO:17) ATGGCTAATAAACACCTGAGTTTGTCACTATTCCTCGTGTTGCTCGGGTT ATCTGCTTCACTTGCAAGCGGAGCTAGCAAAGGAGAAGAACTTTTCACTG GAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAA TTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCTACATACGGAAAGCTTAC CCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACAC TTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGAT CATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGT ACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTG CTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAA GGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTA CAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAATG GAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTT CAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGT CCTTTTACCAGACAACCATTACCTGTCGACACAATCTGCCCTTTCGAAAG ATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCT GCTGGGATTACACATGGCATGGATGAGCTCTACAAAATTGGTGAAAGACA ATATTGTGTTCCAGTTGATCAACCATGTTCTATTAATACTCAACCATGTT GTGATGATGCTACTTGTACTCAAGAAAGAAATGAAAATGGACATACTGTT TATTATTGTAGAGCTAAAGATGAGCTCTAA

[0316] The BGIH-ER expression ORF was cloned into the Pac I and Avr II restriction sites of the FECT expression vector to create a BGIH-ER expression vector for FECT transient plant expression system (pFECT-BGIH-ER), for ER-targeted expression of U-ACTX-Hv1a.

[0317] All three vectors, pFECT-BGIH, pFECT-GIH and pFECT-BGIH-ER, were transformed into the Agrobacterium strain, GV3101, and the resulting transformed GV3101 cells were used for transient transformation into the leaves of Nicotiana benthamiana using the methods described in Example 1. All of the three expression ORFs should transiently express a fusion protein, comprising GFP-fused U-ACTX-Hv1a with a trypsin cleavable linker between the two structural domains.

[0318] After 6 days of transient tobacco transformation, the expression of GFP-fused U-ACTX-Hv1a was examined initially by detection of green fluorescence under UV light. Green fluorescence was detected at various levels in all of the transformed tobacco leaves. The transformed leaves with CYTO targeted accumulation of GFP fused U-ACTX-Hv1a showed the strongest green fluorescence, and those leaves with APO or ER targeted fusion protein accumulation showed weaker green fluorescence. Thus, the results indicated that CYTO targeted expression may facilitate greater accumulation of transgenic GFP fused U-ACTX-Hv1a protein than the APO and ER targeted expression in tobacco leaves. In three replications of this experiment, the transformed tobacco leaves with CYTO targeted expression always showed green fluorescence similar to or stronger than that of the leaves with APO targeted expression, and the weakest green fluorescence was detected in the tobacco leaves transformed with the ER targeted constructs. These initial results indicated that CYTO targeted expression may accumulate as much or more transgenic fusion protein than APO targeted expression, and that ER targeted expression yielded the least accumulation.

[0319] Total soluble protein samples were extracted from tobacco leaves transformed with the different FECT vectors (protocol was described in detail in Example 1). Pierce Coomassie Plus protein assay was performed as in the description in Example 1 to determine the concentrations of the total soluble protein in the TSP extracts, yielding the following concentration estimates: 0.310.04 g/L, 0.310.03 g/L and 0.340.05 g/L for APO targeted, CYTO targeted and ER targeted expressions respectively (N=3).

[0320] The indirect ELISA protocol was then performed using the TSP extracts as described in Example 1 to quantitate the expression level of the U-ACTX-Hv1a protein as a percentage of total soluble protein (% TSP), yielding the following percentage estimates: 0.1260.032%, 0.0490.085% and 0.0250.018% for APO targeted, CYTO targeted and ER targeted expressions respectively (N=3). FIG. 8 summarizes this quantification of expressed U-ACTX-Hv1a (as % TSP values) for the various transformed tobacco leaves described above. These results indicated that APO targeted transgene expression resulted in the greatest accumulation of correctly folded ICK motif protein expressed in the leaves.

[0321] Overall, although the tobacco leaves transformed to produce CYTO targeted, transgenic GFP fused U-ACTX-Hv1a presented the most potent green fluorescence signal, iELISA results detected the least U-ACTX-Hv1a peptide in these transgenic tobacco leaves, in fact, considerably less than what was detected for leaves transformed for ER targeted expression (which had weakest green fluorescence signal). In iELISA assays, the primary antibody (rabbit anti-U-ACTX-Hv1a antibody) can only bind on the correctly folded U-ACTX-Hv1a peptide.

Example 3

[0322] Alternate Signal Peptides for Expression of ICK Motif Proteins in Plants.

[0323] Because ER signal peptide may play a role in the protein expression level, two other ERSPs were tested using the FECT expression system described in the prior examples. The two ERSP candidates were tobacco extensin signal peptide, abbreviated as E in this study (Memelink et al, the Plant Journal, 1993, V4: 1011-1022), and one of its variants abbreviated as E* (Pogue G P et al, Plant Biotechnology Journal, 2010, V8: 638-654). Their amino acid sequences are listed below (N to C, one letter code, with non-identical residues in bold font):

TABLE-US-00013 Extensinsignalpeptide (SEQIDNO:18) (EMGKMASLFASLLVVLVSLSLASESSA Extensinsignalpeptidevariant(E*): (SEQIDNO:19) MGKMASLFATFLVVLVSLSLASESSA

[0324] A DNA sequence encoding E was designed for tobacco expression as follows:

TABLE-US-00014 (SEQIDNO:20) ATGGGTAAGATGGCTTCTCTGTTTGCTTCTCTGCTGGTTGTTCTGGTTT CTCTGTCTCTGGCTTCTGAATCTTCTGCT

[0325] The E DNA sequence was generated using oligo extension PCR with four synthetic DNA primers. Then, in order to add a Pac I restriction site at its 5 terminus and add part of 5 terminal DNA sequence of GFP at its 3 terminus, a further PCR was performed using the E DNA sequence as a template, yielding a 117 bp DNA fragment. This fragment was then used as the forward PCR primer to amplify the DNA sequence encoding the GFP-IGER linker-U-ACTX-Hv1a ORF from the vector pFECT-BGIH (refer to Example 1 and Example 2), thus producing a U-ACTX-Hv1a expression ORF encoding (from N to C terminus) extensin signal peptide-GFP-IGER linker-U-ACTX-Hv1a, following one of our ICK motif protein expression ORF design as ERSP-Sta-L-ICK. This expression ORF, named EGIH, has a Pac I restriction site at its 5 terminus and Avr II restriction site at the 3 terminus. EGIH has the following DNA sequence:

TABLE-US-00015 (SEQIDNO:21) TTAATTAAATGGGTAAGATGGCTTCTCTGTTTGCTTCTCTGCTGGTTGTT CTGGTTTCTCTGTCTCTGGCTTCTGAATCTTCTGCTGCTAGCAAAGGAGA AGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATG TTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCTACA TACGGAAAGCTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGT TCCATGGCCAACACTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTT CCCGTTATCCGGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATG CCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAA CTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATC GTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGA CACAAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGA CAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACATTG AAGATGGATCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATT GGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATC TGCCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTG AGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAA ATTGGTGAAAGACAATATTGTGTTCCAGTTGATCAACCATGTTCTCTTAA TACTCAACCATGTTGTGATGATGCTACTTGTACTCAAGAAAGAAATGAAA ATGGACATACTGTTTATTATTGTAGAGCTTAACCTAGG

[0326] The EGIH DNA sequence was cloned into Pac I and Avr II restriction sites of the FECT vector to generate the pFECT-EGIH vector for transient plant expression of GFP fused U-ACTX-Hv1a protein.

[0327] A DNA sequence encoding the variant extensin signal peptide (E*) was designed for tobacco expression as follows:

TABLE-US-00016 (SEQIDNO:22) ATGGGTAAGATGGCTTCTCTGTTTGCTACTTTTCTGGTTGTTCTGGTTTC TCTGTCTCTGGCTTCTGAATCTTCTGCT

[0328] An E*GIH DNA sequence, which encoded a translational fusion of (listed from N to C) variant extensin signal peptide-GFP-IGER linker-U-ACTX-Hv1a protein, was created using the same techniques as described above for the EGIH ORF. The resulting E*GIH ORF has the following DNA sequence:

TABLE-US-00017 (SEQIDNO:23) TTAATTAAATGGGTAAGATGGCTTCTCTGTTTGCTACTTTTCTGGTTGTT CTGGTTTCTCTGTCTCTGGCTTCTGAATCTTCTGCTGCTAGCAAAGGAGA AGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATG TTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCTACA TACGGAAAGCTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGT TCCATGGCCAACACTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTT CCCGTTATCCGGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATG CCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAA CTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATC GTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGA CACAAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGA CAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACATTG AAGATGGATCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATT GGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATC TGCCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTG AGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAA ATTGGTGAAAGACAATATTGTGTTCCAGTTGATCAACCATGTTCTCTTAA TACTCAACCATGTTGTGATGATGCTACTTGTACTCAAGAAAGAAATGAAA ATGGACATACTGTTTATTATTGTAGAGCTTAACCTAGG

[0329] The E*GIH DNA sequence was cloned into Pac I and Avr II restriction sites of the FECT vector to generate the pFECT-E*GIH vector for transient plant expression of GFP fused U-ACTX-Hv1a protein.

[0330] Three different FECT expression vectors, pFECT-BGIH, pFECT-EGIH and pFECT-E*GIH, were used to transiently express GFP fused U-ACTX-Hv1a protein in tobacco plants to evaluate how the protein expression level is affected by the different ERSPs. The three FECT expression vectors were transformed into Agrobacterium, GV3101, and then the transformed GV3101 was injected into tobacco leaves for transient expression of GFP fused U-ACTX-Hv1a protein in tobacco leaves using the techniques described in Example 1.

[0331] The expression levels of GFP fused U-ACTX-Hv1a from three different FECT expression vectors described above are first evaluated visually by detecting green fluorescence under UV light. Green fluorescence from the transiently transformed tobacco leaves from the three different FECT vectors is visible to the naked eye. All of the leaves showed similar levels of green fluorescence, suggesting that none of the three ERSPs tested contributed to a significant increase in the expression level of GFP fused U-ACTX-Hv1a protein.

[0332] Total soluble protein samples were extracted from the tobacco leaves transformed with the three ERSP FECT vectors as described above (protocol is described in detail in Example 1). Pierce Coomassie Plus protein assay was then performed (as described in Example 1) to determine the concentration of the total soluble protein in the resulting TSP samples, yielding values of 0.850.68 g/L, 0.700.47 g/L and 0.760.77 g/L for samples corresponding to the BGIH, EGIH and E*GIH expression ORFs respectively (N=4).

[0333] Indirect ELISA was then performed using the TSP extracts (as described in Example 1) to quantify the expression level of the U-ACTX-Hv1a protein as a percentage of the total soluble protein (% TSP), yielding values of 0.390.17% (N=3, as one data point was taken out as outliner), 0.480.26% (N=4), and 0.620.38% (N=4) for samples corresponding to the FECT vectors with BGIH, EGIH and E*GIH expression ORFs respectively. FIG. 9 summarizes the estimated U-ACTX-Hv1a levels as percentage in the total soluble protein (% TSP) for all of the samples taken from the tobacco leaves transformed with the three ERSP ORF described above. Although the data of % TSP from three FECT vector transformation looked different, they are not statistically different by Student's t-test. In other words, the three ERSPs did not make difference in the expression level of U-ACTX-Hv1a in the transiently transformed tobacco leaves.

Example 4

[0334] Stabilizing Protein Expressed as Fusion Protein to the ICK Motif Protein Helps the Accumulation of ICK Motif Protein in Transformed Plants.

[0335] The ICK motif protein for plant expression in this example was omega-ACTX-Hv1a, originating from the Australian Blue Mountains Funnel Web Spider, Hadronyche versuta. Omega-ACTX-Hv1a has the following amino acid sequence (one letter code):

TABLE-US-00018 (SEQIDNO:24) SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

[0336] The FECT expression system was used to express omega-ACTX-Hv1a in the tobacco plant, Nicotiana benthamiana. Two FECT vectors encoding different omega-ACTX-Hv1a expression ORFs were engineered. One of these expression ORFs encoded omega-ACTX-Hv1a with Barley Alpha-Amylase Signal peptide (BAAS) at its N terminus without any stabilizing protein. This expression ORF, referred to herein as BO, was subcloned to yield the FECT expression vector pFECT-BO. The other omega-ACTX-Hv1a expression ORF encodes a translational fusion of omega-ACTX-Hv1a to the protein Jun a 3 The mature Jun a 3 is a 30 kDa plant defending protein which is also an allergen for some people, is produced by Juniperus ashei trees and is used in this ORF as a translational stabilizing protein (STA.) Its amino acid sequence is listed below (one letter code):

TABLE-US-00019 (SEQIDNO:25) MARVSELAFLLAATLAISLHMQEAGVVKFDIKNQCGYTVWAAGLPGGGKR LDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVS GAVPATLAEYTQSDQDYYDVSLVDGFNIPLAINPTNAQCTAPACKADINA VCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATNYSKIFKNQCPQA YSYAKDDTATFACASGTDYSIVFC

[0337] The mature Jun a 3 protein is provided below in SEQ ID NO: 26.

TABLE-US-00020 (SEQIDNO:26) KFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCT FDASGKGSCQTGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDVSLVDGFN IPLAINPTNAQCTAPACKADINAVCPSELKVDGGCNSACNVFKTDQYCCR NAYVDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFC

[0338] The ERSP encoded in the ORF of SEQ ID NO: 25 is the Jun a 3 native signal peptide shown below as SEQ ID NO: 27.

TABLE-US-00021 (SEQIDNO:27) MARVSELAFLLAATLAISLHMQEAGVV

[0339] The IGER linker, encoded by the sequence between the omega-ACTX-Hv1a domain and Jun a 3 domains that are encoded in the ORF, is described in detail in Example 1. Taken together, this omega-ACTX-Hv1a expression ORF is referred to as S-Juna3-IGER-Omega, or SJIO. Likewise, the FECT vector into which the SJIO expression ORF was inserted was named pFECT-SJIO.

[0340] The two omega-ACTX-Hv1a FECT expression vectors, pFECT-BO and pFECT-SJIO, were used to transiently express omega-ACTX-Hv1a protein in tobacco plants. The two FECT expression vectors were transformed into Agrobacterium strain GV3101, and the resulting GV3101 transformant was injected into tobacco leaves for transient expression of omega-ACTX-Hv1a in tobacco leaves using the techniques described in detail in Example 1.

[0341] At day 6 post-tobacco transformation, transformed tobacco leaves were collected and total soluble leaf proteins were extracted from the leaves (refer to Example 1 for detailed methods). Pierce Coomassie Plus protein assay was then performed to determine the concentrations of the total soluble leaf protein, yielding values of 3.0470.176 g/L (N=2) and 2.4730.209 g/L (N=2) for the leaves transformed with constructs encoding pFECT-SJIO and pFECT-BO respectively.

[0342] The indirect ELISA protocol was then performed using the TSP extracts above as described in Example 1 to quantitatively evaluate the expression level of the omega-ACTX-Hv1a protein as percentage of the total soluble protein (% TSP), yielding values of 0.1330.014% (N=2) and 0.00040.0003% (N=2) for the leaves transformed with the pFECT-SJIO and pFECT-BO vectors respectively. These data indicated that omega-ACTX-Hv1a expressed as a translational fusion to Jun a 3 accumulated to a more than 300-fold higher steady state level than that of omega-ACTX-Hv1a expressed without translational fusion to the Jun a 3 protein.

[0343] The example 4 above, the function of the STA could also have been performed with snowdrop lectin (GNA) having the following sequence:

TABLE-US-00022 (SEQIDNO:28) DNILYSGETLSTGEFLNYGSFVFIMQEDCNLVLYDVDKPIWATNTGGLSR SCFLSMQTDGNLVVYNPSNKPIWASNTGGQNGNYVCILQKDRNVVIYGTD RWATG

Example 5

[0344] A cleavable linker between the stabilizing protein domain and the ICK motif protein domains in an ICK motif fusion protein expression ORF enhances the insecticidal activity of the resulting ICK motif protein expressed in a transgenic plant.

[0345] Because most chewing insects secrete trypsin into their guts to digest food, we designed a fusion protein expression ORF that encoded a trypsin cleavable linker between the stabilizing protein domain and the ICK motif protein domain of the fusion, in order to facilitate release of the ICK motif domain from the intact fusion protein in the insect gut.

[0346] The ICK motif protein for plant expression here was omega-ACTX-Hv1a, whose amino acid sequence is as follows (one letter code):

TABLE-US-00023 (SEQIDNO:24) SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

[0347] The omega-ACTX-Hv1a expression ORF that was used encodes a fusion protein comprising the following domains (N to C): Jun a 3 signal peptide::Jun a 3::IGER linker::omega-ACTX-Hv1a, as in the structural formula ERSP-Sta-L-ICK described above. The origin and sequence of Jun a 3 is as described above in Example 4.

[0348] The ERSP used here was the Jun a 3 native signal peptide, as described above in Example 4.

[0349] The IGER linker, encoded by the sequence between the omega-ACTX-Hv1a domain and Jun a 3 domains that are encoded in the ORF, is described in detail in Example 1. Taken together, this omega-ACTX-Hv1a expression ORF is referred to as S-Juna3-IGER-Omega, or SJIO. Likewise, the FECT vector into which the SJIO expression ORF was inserted was named pFECT-SJIO.

[0350] The vector, pFECT-SJIO, was then used to transiently express omega-ACTX-Hv1a protein in tobacco plants. The vector was transformed into Agrobacterium, GV3101, and then the transformed GV3101 was injected into tobacco leaves for transient expression of omega-ACTX-Hv1a in the leaves using the techniques described in detail in Example 1.

[0351] On day 6 post tobacco leaf transformation, 3.3 g of transformed tobacco leaf was collected and ground in liquid nitrogen. 50 mL of TSP-Sel buffer was used to extract the total soluble proteins (TSP) from the ground leaves by following the procedure described in Example 1. A total of 26 mL extract was recovered from the TSP extraction procedure, which was then evenly split into two samples, A and B, with 13 mL extract for each group. Sample A was treated with trypsin to release omega-ACTX-Hv1a from the fused Jun a 3 protein by adding 1.3 mL of 1 mg/mL trypsin in 1 mM HCl at 37 C. for 1 hour. Sample B was not treated by trypsin cleavage. To get omega-ACTX-Hv1a in the concentration range of bioactivity, both groups were concentrated in the same way as following. First, the extractions were loaded into a concentrator with 10 kD cutoff filter membrane and spun at 3200 g for 2 hours. Then 1.4 mL retentate from Sample A and 1.1 mL retentate from Sample B were saved for later tests. The 12.5 mL filtrate from Sample A and 12.5 mL filtrate from Sample B were further concentrated by being spun in concentrators with 1 kD cutoff filter membranes at 3200 g for 16 hours. 1.3 mL retentate was recovered from Sample A and 1.1 mL retentate was recovered from Sample B. Both 1 kD cutoff filtration retentates were saved for later tests. This sample concentration procedure was summarized in FIG. 10. The total TSP extraction from pFECT-SJIO transformed tobacco leaves was split evenly to two samples. One sample (A) was treated by trypsin cleavage and the other (B) was not. Both groups were concentrated by being spun in the concentrators with 10 kD and then 1 kD cutoff filter membranes, and the retentates from the 10 kD and 1 kD cutoff filtration were saved for further tests.

[0352] The SJIO expression ORF expressed a fusion protein as following, Jun a 3::IGER::Omega-ACTX-Hv1a, which comprises a total of 266 amino acid residues and has a predicted molecular weight of 28,204.28 Da. The trypsin cleavage of this fusion protein should release an omega-ACTX-Hv1a with molecular weight of 4049.2 Da and Jun a 3::IGER fusion protein with molecular weight of 24,155.1 Da. Therefore, if the trypsin cleavage reaction is complete in the treatment, then the anticipated major components of the filtration samples are as follows:

[0353] Sample A 10 kD filtration retentate: Jun a 3::IGER fusion.

[0354] Sample A 1 kD filtration retentate: Omega-ACTX-Hv1a.

[0355] Sample B 10 kD filtration retentate: Jun a 3::IGER::Omega-ACTX-Hv1a fusion.

[0356] Sample B 1 kD filtration retentate: no SJIO expressed protein.

[0357] To quantify the omega-ACTX-Hv1a peptide in the retentate samples, iELISA was performed as described in Example 1. The detected omega-ACTX-Hv1a concentrations in the samples were as follows:

[0358] Sample A 10 kD filtration retentate: 1.328 ng/L of omega-ACTX-Hv1a, total 1.86 g.

[0359] Sample A 1 kD filtration retentate: 2.768 ng/L of omega-ACTX-Hv1a, total 3.60 g.

[0360] Sample B 10 kD filtration retentate: 12.656 ng/L of omega-ACTX-Hv1a, total 13.92 g.

[0361] Sample B 1 kD filtration retentate: 0.752 ng/L of omega-ACTX-Hv1a, total 0.83 g.

[0362] As indicated, Omega-ACTX-Hv1a was detected in all filtration samples that were analyzed. The detected omega-ACTX-Hv1a in the Group A 10 kD filtration retentate is presumably due in large part to physical retention of the uncleaved fusion protein. Likewise the omega-ACTX-Hv1a detected in the Group B 1 kD filtration retentate sample could be due to a low rate of spurious filtration of the uncleaved fusion protein through the 10 kD cutoff filter membrane.

[0363] To confirm the trypsin-cleavage reaction was successful, reverse phase High Performance Liquid Chromatography (rpHPLC) was performed to analyze the components in the reserved filtration samples. HPLC was performed using a Varian E218 HPLC system with an Onyx 100 monolithic C.sub.18 column (4.6100 mm), using water with 0.1% trifluoroacetic acid (solvent A) and acetonitrile with 0.1% trifluoroacetic acid (solvent B) as mobile phase components. The omega-ACTX-Hv1a peptide was eluted from the column at a flow rate of 2 mL per minute using a linear gradient of 10-20% solvent B over 10 minutes. Samples of 99% pure synthetic omega-ACTX-Hv1a were used in rpHPLC to produce a standard curve (relating peak area to mass of peptide injected). FIG. 11 shows three separate elution profiles, 11A, 11B, 11C. As shown in FIG. 11A, the omega-ACTX-Hv1a peptide eluted at 6.5 minutes post-injection. When a 500 L sample from Group B 1 kD filtration retentate was loaded into the HPLC system, there was no protein peak between 6 and 7 minutes post-injection in the corresponding HPLC chromatograph (FIG. 11B). When a 500 L sample from Group A 1 kD filtration retentate was loaded into the HPLC system, there was a peak at retention time of 6.3 minute (see dotted line in FIG. 11) in the corresponding chromatograph, representing omega-ACTX-Hv1a released from the fusion protein by trypsin cleavage (FIG. 11C). The area of this peak corresponded to a concentration of omega-ACTX-Hv1a of between 16-70 ng/L in the Sample A 1 kD filtration retentate (depending on the approach used to integrate the peak).

[0364] The reserved filtration samples were used to perform housefly injection bioassays to test the activity of the omega-ACTX-Hv1a in the fusion protein form and in the released form from the fusion protein. Housefly pupae (Musca domestica) were purchased from Benzon Research, Inc. and kept at 25 C. in a plastic box with air holes on the box lid and fly food (1:1 ratio sugar and powder milk) and cotton balls soaked in water in the box. On the day after adult housefly emergence, the flies were immobilized using a CO.sub.2 line and then kept immobile using a CO.sub.2 infusion pad. Flies weighing 12-18 mg were selected for the injection bioassay. To perform housefly injection, a microapplicator loaded with a 1 cc glass syringe with a 30 gauge needle, in which the injection solution was loaded, was used to deliver 0.5 L doses into the dorsal thorax of the flies. The injected flies were then put into labeled boxes with air holes, and mortality was scored 24 hours post-injection. The following samples were injected into houseflies (groups of 10 flies were used for each sample):

[0365] Water injection as negative control.

[0366] Group A 10 kD filtration retentate.

[0367] Group A 1 kD filtration retentate.

[0368] Group B 10 kD filtration retentate.

[0369] Group B 1 kD filtration retentate.

[0370] 0.13 mg/mL trypsin solution as negative control.

[0371] At 24 hrs. post injection, the Sample A 10 kD filtration retentate and Sample A 1 kD filtration retentate caused 100% housefly mortality, while 0% mortality was observed for the flies injected with the other samples. Pure, native sequence omega-ACTX-Hv1a showed an LD.sub.50 of 100 pmol/gram of housefly in this housefly injection bioassay; hence, to generate 100% mortality in this paradigm, the concentration of the injected omega-ACTX-Hv1a must at least 25 ng/L. This is consistent with the bioassay results, since HPLC analysis of the Sample A 1 kD filtration retentate indicated a concentration of concentration of omega-ACTX-Hv1a of 16-70 ng/L. Filtration samples that did not comprise material that was treated with trypsin cleavage did not generate mortality in the housefly injection bioassay, indicating that the Jun a 3 fused omega-ACTX-Hv1a was considerably less active than native-sequence omega-ACTX-Hv1a cleaved away from the fusion construct by trypsin. Therefore, the linker region of a plant ICK motif protein expression ORF can show enhanced insecticidal function when designed to be cleavable, such that the ICK motif domain of the ICK fusion protein can be released from the other structural domains of the protein by proteolysis.

PART II. HIGH PRODUCTION PEPTIDES

[0372] The ability to successfully produce insecticidal peptides on a commercial scale, with reproducible peptide formation and folding, and with cost controls can be challenging. The wide variety, unique properties and special nature of peptides, combined with the huge variety of possible productions techniques can present an overwhelming number of approaches to peptide production.

[0373] There are few if any descriptions, however, that describe how to change a peptide so that it will be produced in a biological system at a much higher rate of production than the peptide is typically produced before it is changed. Here we present a way to change the composition of a peptide and in so doing increase the rate and amount and simultaneously lower the cost of peptide production. We describe novel ways of changing or converting one peptide into a different, more cost effective peptide, yet one which surprisingly is just as toxic as before it was converted.

[0374] We describe examples of these novel converted peptides, and we show how these methods for altering or converting a peptide can make a significant improvement in the yield of peptides without making significant changes in its activity. The new processes, new peptides, new formulations, and new organisms for producing those peptides are described and claimed herein. A process is described which increases the insecticidal peptide production yield from yeast expression systems by adding a dipeptide at the N terminus of insecticidal peptides. The addition of a dipeptide does not adversely affect the insecticidal activities of insecticidal peptides.

[0375] We describe examples of these novel converted peptides, and we show how these methods for altering or converting a peptide can make a significant improvement in the yield of peptides without making significant changes in its activity. The new processes, new peptides, new formulations, and new organisms for producing those peptides are described and claimed herein.

[0376] Detailed Procedures for Making High Production Peptides.

[0377] We describe a process and peptide that can increase peptide production. When followed these techniques will provide a converted peptide by adding a dipeptide at the N-terminus of the native peptide that has better production rate than the native peptide in three different ways. First, the over-all average yield of the dipeptide-native peptide strains is better than that of the native strains; second, the median yield of the dipeptide-native peptide strains is better than that of the native; and third, there are more dipeptide strains at the higher yield range than there are for native peptide strains. The process described here can be used in various in vivo systems, including plants, animals and microbes. The invention requires the addition of a dipeptide to the N-terminus of the native peptide, which is the peptide that was known before the dipeptide is added. The known peptide is then converted, and it can then be made with greater yields than were previously thought possible. In one embodiment insecticidal peptides are linked to a dipeptide. These dipeptide-native peptide systems can be used in plants that can produce the peptides. Plant produced peptides have a variety of uses from production to simply making a toxic peptide available for consumption by a damaging insect, thus either protecting the plants or possibly providing other benefits.

[0378] In one embodiment we describe a process for increasing insecticidal peptide production yield in yeast expression systems by the addition of any dipeptide to the N-terminus of the insecticidal peptide. The dipeptide is composed of a non-polar amino acid and a polar amino acid. The non-polar amino acid may be selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine. Glycine is the preferred non-polar amino acid. The polar amino acid may be selected from serine, threonine, cysteine, asparagine, glutamine, histidine, tryptophan and tyrosine. Serine is the preferred polar amino acid. The process and amino acids are described where the non-polar amino acid is at the N-terminus of the dipeptide and in one embodiment the preferred N-terminus of the dipeptide is glycine. The process and amino acids are described where the polar amino acid is at the C-terminus of the dipeptide and in one embodiment the preferred C-terminus of the dipeptide is serine.

[0379] In one embodiment of the invention the dipeptide is glycine-serine, gly-ser or GS. These amino acids are typically encoded by the following codons: Gly may be encoded by codons such as GGT, GGC, GGA, GGG and Ser may be encoded by codons such as TCT, TCC, TCA, TCG, AGT, and AGC.

[0380] The transgenes of the insecticidal peptides are designed such that their transgene sequences are optimized for the specific expression that may be needed. For example, the transgenes of insecticidal peptides may be optimized for expression in yeast, plants, bacteria, and viruses. Examples of such uses of the invention would include the engineering and optimization of transgenes for crops like maize and soybean, with the purpose of protecting them from insect pests. In one example we design transgenes of insecticidal peptides such that their transgene sequences are optimized for the specific expression in yeast expression systems, using for example, Kluyveromyces lactis, Pichia pastoris, and Saccharomyces cerevisiae. Other suitable yeast expression systems are known in the art. The nucleotide codons for a dipeptide, such as glycine-serine, (gly-ser) are added to the 5 end of the transgene sequences of the mature insecticidal peptides. The transgene sequences are then ligated into appropriate expression vectors, which can provide appropriate selection markers, strong promoter-terminator sets for the specific yeast expression system, signal sequences for secretion, and cleavage sites between the respective signal sequences and mature peptide sequences. The insecticidal peptide expression vectors are then transformed into yeast cells, by means known to one skilled in the art, including either electroporation or chemical transformation methods, in order to generate stable peptide expression yeast strains. When these yeast strains grow in appropriate media, they produce insecticidal peptides modified by the addition of a dipeptide sequence, glycine-serine, to the N-terminus of the mature insecticidal peptides, which are secreted into the growth media. The addition of the dipeptide, glycine-serine, to the N-terminus of the mature insecticidal peptides, significantly improves the yield of the insecticidal peptides without adverse effects on the insecticidal activities of the peptides.

[0381] Our data shows that any Cysteine Rich Insecticidal Peptide (CRIP) can be made to grow at significantly higher yields than would otherwise be possible using the procedures we describe here. We have demonstrated the both ICK and non ICK types of CRIPs can have their yields dramatically improved using the High Production techniques we described. Here we provide evidence of dramatic and surprising increases in yields of two very diverse types of CRIPS.

[0382] The insecticidal peptides that can be converted may be selected from insecticidal venom, for example the venom of a spider. The spider may be an Australian funnel web spider. The peptides from the genus of Atrax or Hadronyche are U-ACTX-Hv1a and its analogs and are easily made special using the procedures described herein. Specific peptide examples from spiders are described in the sequence listing provided herein. These peptides and others can be converted using the procedures described herein.

[0383] The insecticidal peptides that can be converted may be selected from sea anemone toxins such as from Anemonia viridis as described in Example 3. Sea anemones are far removed in their normal habitat from the funnel web spiders of the genus of Atrax or Hadronyche and the venom from Anemonia viridis is not considered an ICK type of venom, as is venomous peptides from Atrax or Hadronyche but in spite of that the venom of the sea urchin, like the U-ACTX-Hv1a toxic peptides and other insecticidal venoms is that they are all a type of venom that we call Cysteine Rich Insecticidal Peptide or CRIP and identified here for the first time as such. The procedures described herein, in all the sections, are expected and believed to work with all of the peptide in the sequence listings and all of the peptides related to those sequences that would be understood by one skilled in the art to be a Cysteine Rich Insecticidal Peptide or CRIP. All such peptides and others can be converted using the procedures described herein.

[0384] In addition to the process, we also disclose novel High Production Peptides, herein HP peptides, comprising a dipeptide bound to one end of a peptide. In our embodiments the peptide is an insecticidal peptide. In one embodiment the dipeptide is added to the N-terminus of the peptide. We have demonstrated success in producing high yield strains with both ICK and non-ICK CRIP peptides. In a further embodiment the dipeptide is composed of a non-polar amino acid and a polar amino acid. In a further embodiment the non-polar amino acid is selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine, and the polar amino acid is selected from serine, threonine, cysteine, asparagine, glutamine histidine, tryptophan and tyrosine. In one specific embodiment an HP peptide is comprised of a peptide which is modified to have the dipeptide of glycine-serine as the first two amino acids of an otherwise unmodified, mature peptide. HP peptides may be produced by adding glycine-serine to the U peptide and its analogs to create HP peptides.

[0385] The modified peptides made by the processes described herein are new and are separately claimed. These peptides are described by all of their properties and not simply their sequence. These peptides are novel and have unique properties. Both HP peptides and the process of making them are disclosed and claimed herein.

[0386] Examples of useful peptides are well known and can be found in numerous references. One class of useful peptides is insecticidal peptides. Insecticidal peptides can be identified by their peptide nature and their activity, usually oral or injection insecticidal activity. Here we provide a few examples to better illustrate and describe the invention, but the invention is not limited to these examples. All of these examples and others not shown here are descriptive of new materials, described and claimed here for the first time.

[0387] HP (High Production) peptides are defined here as any peptides capable of being produced at greater than normal rates of production using the techniques described herein. Such peptides may have insecticidal activity. Typically, insecticidal peptides show activity when injected into insects but most do not have significant activity when applied to an insect topically. The insecticidal activity of HP peptides is measured in a variety of ways. Common methods of measurement are widely known to those skilled in the art. Such methods include, but are not limited to determination of median response doses (e.g., LD.sub.50, PD.sub.50, LC.sub.50, ED.sub.50) by fitting of dose-response plots based on scoring various parameters such as: paralysis, mortality, failure to gain weight, etc. Measurements can be made for cohorts of insects exposed to various doses of the insecticidal formulation in question. Analysis of the data can be made by creating curves defined by probit analysis and/or the Hill Equation, etc. In such cases, doses would be administered by hypodermic injection, by hyperbaric infusion, by presentation of the insecticidal formulation as part of a sample of food or bait, etc.

[0388] Specific examples of HP peptides disclosed for purposes of providing examples and not intended to be limiting in any way, are the U peptide and its homologies, which origin from the venoms of Australian Funnel-web spiders. The description of these peptides can be found in this document in earlier sections.

[0389] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.

[0390] As noted above, many peptides are suitable candidates as the subject of the process to make special. The sequences noted above, below and in the sequence listing are especially suitable peptides that can be made special, and some of these have been made special according to this invention with the results shown in the examples below:

TABLE-US-00024 (SEQIDNO:5) GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA (onelettercode)

[0391] Named U+2-ACTX-Hv1a, it has disulfide bridges at positions: 5-20, 12-25, 19-39. The molecular weight is 4564.85 Daltons.

TABLE-US-00025 (SEQIDNO:29) GSRSCCPCYWGGCPWGQNCYPEGCSGPKV (onelettercode)

[0392] Named Av3+2, It has disulfide bridges at positions: 5-19, 6-13, 8-24. The molecular weight is 3076.47 Daltons.

[0393] Preparation of the HP Peptides

[0394] The HP peptides described herein can be prepared as below. The open reading frames (ORFs) of the insecticidal peptides are designed such that their nucleotide sequences are optimized for species-specific expression. Shown below is a specific example of a process for increasing insecticidal peptide production yield from yeast expression systems by addition of a dipeptide to the N-terminus of the insecticidal peptide. The dipeptide is composed of a non-polar amino acid and a polar amino acid. The non-polar amino acid may be selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine and glycine is the preferred non-polar amino acid. The polar amino acid may be selected from serine, threonine, cysteine, histidine, tryptophan, tyrosine, asparagine and glutamine and serine is the preferred polar amino acid. In the example below, the non-polar amino acid is at the N-terminus of the dipeptide and it is glycine. In the example below, the polar amino acid is at the C-terminus of the dipeptide and it is serine.

[0395] The insecticidal peptide ORF is designed for secretion from host yeast cells as follows: the ORF starts with a signal peptide sequence, followed by DNA sequence encoding a Kex 2 cleavage site (Lysine-Arginine), followed by the insecticidal peptide transgene with addition of glycine-serine codons at the 5 terminus, and finally ends with a stop codon at the 3 terminus. All these elements will be expressed to a fusion peptide in yeast cells as a single open reading frame. An -mating factor signal sequence is most frequently used to facilitate metabolic processing of the recombinant insecticidal peptides through the endogenous secretion pathway of the recombinant yeast, i.e. the expressed fusion peptide will typically enter the Endoplasmic Reticulum, wherein the -mating factor signal sequence is removed by signal peptidase activity, and then the resulting pro-insecticidal peptide will be trafficked to the Golgi Apparatus, in which the Lysine-Arginine dipeptide mentioned above is completely removed by Kex 2 endoprotease, after which the mature, HP insecticidal peptide, comprising the additional non-native glycine-serine dipeptide at its N-terminus, is secreted out of the cells.

[0396] To enhance insecticidal peptide expression level in the recombinant yeast cells, the codons of the insecticidal peptide ORF are usually optimized for expression in the specific host yeast species. Naturally occurring frequencies of codons observed in endogenous open reading frames of a given host organism are not necessarily optimized for high efficiency expression. Furthermore, different yeast species (for example, Kluyveromyces lactis, Pichia pastoris, Saccharomyces cerevisiae, etc.) have different optimal codons for high efficiency expression. Hence, codon optimization should be considered for the peptide ORF, including the sequence elements encoding the signal sequence, the Kex2 cleavage site and the insecticidal peptides, since they are initially translated as one fusion peptide in the recombinant yeast cells.

[0397] The codon-optimized peptide expression DNAs are then ligated into appropriate expression vectors for yeast expression. There are many expression vectors available for yeast expression, including episomal vectors and integrative vectors, and they are usually designed for specific yeast strains. One should carefully choose the appropriate expression vector in view of the specific yeast expression system which will be used for the peptide production. Here we used integrative vectors, which will integrate into chromosomes of the transformed yeast cells and be stable through cycles of cell division and proliferation.

[0398] The expression vectors usually contain some E. coli elements for DNA preparation in E. coli, for example, E. coli replication origin, antibiotic selection marker, etc. The vectors also contain an array of the sequence elements needed for expression of the transgene of interest, for example, transcriptional promoters, terminators, yeast selection markers, integrative DNA sequences homologous to host yeast DNA, etc. There are many suitable yeast promoters available, including natural and engineered promoters. In our efforts, yeast promoters such as pLAC4, pAOX1, pUPP, pADH1, pTEF, pGal1, etc. have been used. We also used the following commonly used yeast selection markers: acetamide prototrophy selection, zeocin-resistance selection, geneti cin-resi stance selection, nourseothricin-resi stance selection, uracil deficiency selection. Other markers known to one skilled in the art could also be used. The integrative DNA sequences are homologous to targeted genomic DNA loci in the transformed yeast species, and such integrative sequences include pLAC4, 25S rDNA, pAOX1, and TRP2, etc. The locations of insecticidal peptide transgenes can be adjacent to the integrative DNA sequence (Insertion vectors) or within the integrative DNA sequence (replacement vectors).

[0399] To get more copies of insecticidal peptide ORF integrated into the host yeast chromosomes, the expression vectors can be designed and generated to contain two or three copies of insecticidal peptide expression cassette. Each copy of the insecticidal peptide expression cassette in the expression vector should contain independent and complete expression structures including promoter, signal sequence, Kex2 cleavage sequence and, the insecticidal peptide transgene, stop codon transcription terminator.

[0400] The peptide expression vectors are then transformed into yeast cells. First, the expression vectors are usually linearized by specific restriction enzyme cleavage to facilitate chromosomal integration via homologous recombination. The linear expression vector is then transformed into yeast cells by a chemical or electroporation method of transformation and integrated into the targeted locus of the yeast genome by homologous recombination. The integration can happen at the same chromosomal locus multiple times; therefore the genome of a transformed yeast cell can contain multiple copies of insecticidal peptide transgenes. The successful transformants can be identified using growth conditions that favor a selective marker engineered into the expression vector and co-integrated into yeast chromosomes with the insecticidal peptide transgenes; examples of such markers include, but aren't limited to, acetamide prototrophy, zeocin resistance, geneticin resistance, nourseothricin resistance, and uracil prototrophy.

[0401] Due to the influence of unpredictable and variable factors-such as epigenetic modification of genes and networks of genes, and variation in the number of integration events that occur in individual cells in a population undergoing a transformation procedure-individual yeast transformants of a given transformation process will differ in their capacities to produce a transgenic insecticidal peptide. Therefore, yeast transformants carrying the insecticidal peptide transgenes should be screened for high yield strains. Two effective methods for such screening, each dependent on growth of small-scale cultures of the transformants to provide conditioned media samples for subsequent analysis, use reverse-phase HPLC or housefly injection procedures to analyze conditioned media samples from the transformants.

[0402] The transformant cultures are usually performed in 14 mL round bottom polypropylene culture tubes with 5-10 mL defined medium added to each tube, or in 48-well deep well culture plates with 1-2 mL defined medium added to each well. The Defined medium, not containing crude proteinaceous extracts or by-products such as yeast extract or peptone, is used for the cultures to reduce the protein background in the conditioned media harvested for the later screening steps. The cultures are performed at the optimal temperature, for example, 23.5 C. for K. lactis, for 5-6 days, until the maximum cell density is reached. The insecticidal peptides are now produced from the transformants and secreted out of cells to the growth medium. To prepare samples for the screening, cells are removed from the cultures by centrifugation and the supernatants are collected as the conditioned media, which are then cleaned by filtration through 0.22 m filter membrane and then made ready for insecticidal peptide production strain screening, a couple of examples of such screening methods are described below.

[0403] One of the screening methods is reverse-phase HPLC (rpHPLC) screening of transformants. In this screening method, an HPLC analytic column with bonded phase of C18 is used. Acetonitrile and water are used as mobile phase solvents, and a UV absorbance detector set at 220 nm is used for the peptide detection. Appropriate amounts of the conditioned medium samples are loaded into the rpHPLC system and eluted with a linear gradient of mobile phase solvents. The corresponding peak area of the insecticidal peptide in the HPLC chromatograph is used to quantify the insecticidal peptide concentrations in the conditioned media. Known amounts of pure insecticidal peptide are run through the same rpHPLC column with the same HPLC protocol to confirm the retention time of the peptide and to produce a standard peptide HPLC curve for the quantification.

[0404] A second screening method is the housefly injection assay. Insecticidal peptide can kill houseflies when injected in measured doses through the body wall of the dorsal thorax. The efficacy of the insecticidal peptide can be defined by the median lethal dose of the peptide (LD50), which causes 50% mortality of the injected houseflies. The pure insecticidal peptide is normally used in the housefly injection assay to generate a standard dose-response curve, from which an LD50 value can be determined. Using an LD50 value from the analysis of a standard dose-response curve of the pure insecticidal peptide in question, quantification of the insecticidal peptide produced by a yeast transformant can be achieved using a housefly injection assay performed with serial dilutions of the corresponding conditioned media.

[0405] The insecticidal peptide production strain screen can identify the high yield yeast strains from hundreds of transformants. These strains can be fermented in bioreactor to achieve up to 6 g/L yield of the insecticidal peptides when using optimized fermentation media and fermentation conditions. The higher rates of production can be anywhere from 20 to 400, 20 to 100, 20 to 200, 20 to 300, 40 to 100, 40 to 200, 40 to 300, 40 to 400, 60 to 100, 60 to 200, 60 to 300, 60 to 400, 80 to 100, 80 to 200, 80 to 300, 80 to 400, 100 to 150, 100 to 200, 150 to 200, 200 to 250, 250 to 300, 250 to 350, 250 to 400, 300 to 350, 300 to 400% and 350 to 400 or any range of any value provided or even greater yields than can be achieved with a peptide before conversion, using the same or similar production methods that were used to produce the peptide before conversion.

[0406] Any of the sequences from the sequence listing, and as far as we know any CRIP could all be used to make high production peptides similar to either the ACTX motifs from the Australian Blue Mountain Funnel-web Spider we call the U+2 peptide described below, or the Av3+2 peptide of the toxic sea anemone, Anemonia viridis, that we teach and describe in the examples below by using procedures taught here and the knowledge of one ordinarily skilled in the art. In addition, any other suitable CRIP peptide could be used in a like manner to produce a high production or plus 2, i.e. +2 peptide.

PART II. EXAMPLES OF HIGH PRODUCTION PEPTIDES

[0407] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.

Example 1

[0408] Expression of Native U and U+2-ACTX-Hv1a in Kluyveromyces lactis (K. lactis).

[0409] Insecticidal peptides to express:

[0410] U+2-ACTX-Hv1a:

TABLE-US-00026 (SEQIDNO:5) GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0411] and

[0412] Native U-ACTX-Hv1a:

TABLE-US-00027 (SEQIDNO:6) QYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0413] To express the two insecticidal peptides above in K. lactis, the expression vector, pKLAC1, and the K. lactis strain, YCT306, were used, which are available from New England Biolabs, Ipswich, Mass., USA. pKLAC1 vector is an integrative expression vector. Once the U+2 and native U-ACTX-Hv1a transgenes were cloned into pKLAC1 and transformed into YCT306, their expression was controlled by the LAC4 promoter. The resulting transformants produced pre-propeptides comprising an -mating factor signal peptide, a Kex2 cleavage site and mature insecticidal peptides. The -Mating factor signal peptide guides the pre-propeptides to go through the endogenous secretion pathway and finally the mature insecticidal peptides are released into the growth media.

[0414] Codon optimization for U+2-ACTX-Hv1a expression was performed in two rounds. In the first round, based on some common features of high expression DNA sequences, 33 variants of the peptide ORF, expressing an -Mating factor signal peptide, a Kex2 cleavage site and the U+2-ACTX-Hv1a peptide, were designed and their expression levels were evaluated in the YCT306 strain of K. lactis, resulting in an initial K. lactis expression algorithm. In the 2.sup.nd round of optimization, five more variant U+2-ACTX-Hv1a peptide ORFs were designed based on the initial K. lactis expression algorithm to further fine-tune the K. lactis expression algorithm, and identified the best ORF for the U+2-ACTX-Hv1a peptide expression in K. lactis. This DNA sequence has an open reading frame encoding an -mating factor signal peptide, a Kex2 cleavage site and a U+2-ACTX-Hv1a peptide. The optimized DNA sequence was cloned into the pKLAC1 vector using Hind III and Not I restriction sites, resulting in the U+2-ACTX-Hv1a expression vector, pLB10V5.

[0415] To enable integration of more copies of the optimized U+2-ACTX-Hv1a transgene into the K. lactis genome during transformation, generation of a U+2-ACTX-Hv1a expression vector containing two copies of U+2-ACTX-Hv1a expression cassette was processed as follows: A 3,306 bp intact U+2-ACTX-Hv1a expression cassette DNA sequence was synthesized, which comprised an intact LAC4 promoter element, a codon-optimized U+2-ACTX-Hv1a peptide ORF element and a pLAC4 terminator element. This intact expression cassette was then ligated into the pLB10V5 vector between Sal I and Kpn I restriction sites, downstream of the pLAC4 terminator of pLB10V5, resulting in the double transgene U+2-ACTX-Hv1a expression vector, pLB10V5D.

[0416] To generate a native U-ACTX-Hv1a expression vector, the pLB10V5 vector was mutagenized by deleting the glycine-serine codons at the 5-terminus of the U+2-ACTX-Hv1a transgene region, using a Stratagene site-direct mutagenesis kit. This mutagenesis resulted in a new vector, pLB12, containing a single copy of the codon-optimized native U-ACTX-Hv1a expression cassette. To generate a double transgene native U-ACTX-Hv1a expression vector, a Stratagene site-direct mutagenesis kit was used again to remove the glycine-serine codons at the 5-terminus of the U+2-ACTX-Hv1a transgene region in the 3,306 bp U+2-ACTX-Hv1a expression cassette transgene synthesized previously, followed by ligation to insert the mutagenized cassette into the pLB12 vector between Sal I and Kpn I restriction sites, resulting in the plasmid, pLB12D, an expression vector comprising two intact copies of the codon-optimized native U-ACTX-Hv1a expression cassette.

[0417] The double transgene vectors, pLB10V5D and pLB12D, were then linearized using Sac II restriction endonuclease and chemically transformed into YCT306 strain of K. lactis, according to instructions provided with a K. lactis Protein Expression Kit. The resulting transformants grew on YCB agar plate supplemented with 5 mM acetamide, which only the acetamidase-expressing transformants could use efficiently as a metabolic source of nitrogen.

[0418] For insecticidal peptide yield evaluations, 316 colonies were picked from the pLB10V5D transformants plates, and 40 colonies were picked from the pLB12D transformants plates. Inocula from the colonies were each cultured in 6 mL of the defined K. lactis media with 2% pure glycerol added as a carbon source. Cultures were incubated at 23.5 C., with shaking at 280 rpm, for six days, at which point cell densities in the cultures had reached their maximum levels as indicated by light absorbance at 600 nm (OD600). Cells were then removed from the cultures by centrifugation at 4,000 rpm for 10 minutes. The resulting supernatants (conditioned media) were filtered through 0.2 m membranes for HPLC yield analysis.

[0419] For the peptide yield evaluation, the filtered conditioned media samples were analyzed on an Agilent 1100 HPLC system equipped with an Onyx monolithic 4.5100 mm, C18 reverse-phase analytical HPLC column and an auto-injector. HPLC grade water and acetonitrile, both containing 0.1% trifluoroacetic acid, constituted the two mobile phase solvents used for the HPLC analyses. The peak areas of both the native U and U+2-ACTX-Hv1 were measured using HPLC chromatographs and then used to calculate the peptide concentration in the conditioned media, which were then further normalized to the corresponding final cell densities (as determined by OD600 measurements) as normalized peptide yield.

[0420] Housefly injection bioassay was used to evaluate the insecticidal activity of the peptides. The conditioned media were serially diluted to generate full dose-response curves from the housefly injection bioassay. Before injection, adult houseflies (Musca domestica) were immobilized with CO.sub.2, and 12-18 mg houseflies were selected for injection. A microapplicator, loaded with a 1 cc syringe and 30-gauge needle, was used to inject 0.5 L per fly doses of serially diluted conditioned media samples into houseflies through the body wall of the dorsal thorax. The injected houseflies were placed into closed containers with moist filter paper and breathing holes on the lids, and they were examined by mortality scoring at 24 hours post-injection.

[0421] Normalized yields were calculated. Peptide yield means the peptide concentration in the conditioned media in units of mg/L. But peptide yields are not always sufficient to accurately compare the strain production rate. Individual strains may have different growth rates, hence when a culture is harvested, different cultures may vary in cell density. A culture with a high cell density may produce a higher concentration of the peptide in the media, even though the peptide production rate of the strain is lower than another strain which has a higher production rate. So the term normalized yield is created by dividing the peptide yield with the cell density in the corresponding culture and this allows a better comparison of the peptide production rate between strains. The cell density is represented by the light absorbance at 600 nm with a unit of A (Absorbance unit).

[0422] Table 1, FIG. 12 and FIG. 13 summarize the U+2- and native U-ACTX-Hv1a normalized peptide yield distributions from the K. lactis strains. The overall averaged U+2-ACTX-Hv1a normalized peptide yield from the K. lactis strains was 4.063.05 mg/L.Math.A, which was statistically significantly higher than the averaged native U-ACTX-Hv1a normalized peptide yield, 2.731.25 mg/L.Math.A, by Student's t-test at 99% confidence level. The median normalized peptide yield of the U+2-ACTX-Hv1a K. lactis strains was 9.36 mg/L.Math.A, which was almost three times higher than the median yield of native U-ACTX-Hv1a strains (3.35 mg/L.Math.A). The U+2-ACTX-Hv1a peptide expression strains had much higher ratios of the strain counts at high yield level than the native U-ACTX-Hv1a strains. All of these results indicated that the addition of the glycine-serine dipeptide to the N-terminus of the U-ACTX-Hv1a peptide contributes to significant improvement of the predicted yield for yeast transformants expressing this peptide.

[0423] Table 1 shows a comparison of peptide yields from K. lactis strains.

TABLE-US-00028 TABLE 1 U + 2 and native U-ACTX-Hv1a Peptide Yield Comparison U + 2 Yield (total 316 strains) Native U Yield (total 40 strains) Normalized Strain Ratio to Overall Median Strain Ratio to Overall Median Yield Level count total average Yield count total average Yield >2 mg/L .Math. A 242 0.765823 4.06 3.05 9.36 26 0.65 2.73 1.25 3.35 >3 mg/L .Math. A 161 0.509494 (mg/L .Math. A) (mg/L .Math. A) 18 0.45 (mg/L .Math. A) (mg/L .Math. A) >4 mg/L .Math. A 124 0.392405 6 0.15 >6 mg/L .Math. A 62 0.196203 0 0 >8 mg/L .Math. A 29 0.0917722 0 0 >10 mg/L .Math. A 16 0.0506329 0 0 >12 mg/L .Math. A 9 0.028481 0 0 >14 mg/L .Math. A 6 0.0189873 0 0

[0424] FIG. 12 shows the histograms of the normalized peptide yield distributions for the U+2 and native U strains. The X scale shows the range of the normalized peptide yield. The Y scale on the left shows the frequency of the U+2 producing strains in the specific range of the normalized yield, and the Y scale on the right shows the frequency of the native U producing strains in the specific range of the normalized yield. The black bars represent the U+2 yield distribution and the grey bars represent the native U yield distribution. For example, the first black bar tells that about 0.03 (3%) of the total U+2 producing strains have normalized yields between 0 and 0.5 mg/L.Math.A. The strain counts are different between native and +2 strains because 316 strains for U+2 were screened and 40 strains for the native peptide were screened.

[0425] FIG. 13 shows the distribution of the peptide yields from U+2 and native U-ACTX-Hv1a produced from the K. lactis strains. The U+2 data is shown in black and the native U data is in gray. The x-axis shows the yield in milligrams per liter and the y-scale shows the fraction of total U+2 or native U production from K. lactis strains. The yield from the U+2 strains, and the number of U+2 strains available that can produce high yields is far higher for the U+2 strains as compared to the native U strains.

[0426] Ordinarily one might expect making changes to a peptide sequence that dramatically improves its yield could affect its toxicity. Surprisingly that is not what happens with the dipeptides of this disclosure. Our data indicates the addition of the dipeptide, and especially the glycine-serine dipeptide, to the N-terminus of the U-ACTX-Hv1a peptide, does not lower the effectiveness of the insecticidal activities of the peptide. FIG. 14 shows two dose-response curves for housefly injection bioassays performed with the native and U+2-ACTX-Hv1a conditioned medium samples. The U+2-ACTX-Hv1a has a median lethal dose (LD50) of 76.8 pmol/g, which is consistent with the LD50 of native U-ACTX-Hv1a, 77.6 pmol/g.

Example 2

[0427] Peptide Yields of Transformants of the Yeast, Pichia pastoris (P. pastoris), Expressing Either U+2-ACTX-Hv1a or U-ACTX-Hv1a were Studied.

[0428] Two P. pastoris vectors, pJUGKR and pJUZKR, were used for the U+2-ACTX-Hv1a or native U-ACTX-Hv1a peptide expression in P. pastoris. pJUGKR and pJUZKR are available from Biogrammatics, Carlsbad, Calif., USA. Both vectors are integrative vectors and use the uracil phosphoribosyltransferase promoter (pUPP) to enhance the heterologous transgene expression. The only difference between the vectors is that pJUGKR provides G418 resistance to the host yeast, while pJUZKR provides Zeocin resistance.

[0429] Pairs of complementary oligonucleotides, encoding the native U-ACTX-Hv1a and U+2-ACTX-Hv1a respectively, were designed and synthesized for sub cloning into the two yeast expression vectors. Hybridization reactions were performed by mixing the corresponding complementary oligonucleotides to a final concentration of 20 M in 30 mM NaCl, 10 mM Tris-Cl (all final concentrations), pH 8, and then incubating at 95 C. for 20 min, followed by a 9 hour incubation starting at 92 C. and ending at 17 C., with 3 C. drops in temperature every 20 min. The hybridization reactions resulted in two DNA fragments encoding U+2-ACTX-Hv1a and native U-ACTX-Hv1a peptides respectively. The two P. pastoris vectors were digested with BsaI-HF restriction enzymes, and the double stranded products of the optimization reactions were then sub cloned into the linearized P. pastoris vectors using standard procedures. Following verification of the sequences of the four sub clones, plasmid aliquots were transformed by electroporation into the P. pastoris strain, Bg08. The resulting transformed yeast, selected based on resistance to Zeocin or G418 conferred by elements engineered into vectors pJUZKR and pJUGKR, respectively, were cultured and screened as described below. Since no transformant strains had more than one antibiotic resistance marker, and since transformation procedures were performed the same for yeast cells transformed with the U+2-ACTX-Hv1a transgene as for those transformed with the native U-ACTX-Hv1a transgene, it is reasonable to presume that the distributions of transgene copy number were comparable for the two populations of transformants being compared below.

[0430] Recipes for media and stocks used for the P. pastoris cultures are described as follows:

[0431] MSM media recipe

[0432] 2 g/L sodium citrate dihydrate

[0433] 1 g/L calcium sulfate dihydrate (0.79 g/L anhydrous calcium sulfate)

[0434] 42.9 g/L potassium phosphate monobasic

[0435] 5.17 g/L ammonium sulfate

[0436] 14.33 g/L potassium sulfate

[0437] 11.7 g/L magnesium sulfate heptahydrate

[0438] 2 mL/L PTM1 trace salt solution

[0439] 0.4 ppm biotin (from 500, 200 ppm stock)

[0440] 1-2% pure glycerol or other carbon source

[0441] PTM1 trace salts solution:

[0442] Cupric sulfate-5H.sub.2O 6.0 g

[0443] Sodium iodide 0.08 g

[0444] Manganese sulfate-H.sub.2O 3.0 g

[0445] Sodium molybdate-2H.sub.2O 0.2 g

[0446] Boric Acid 0.02 g

[0447] Cobalt chloride 0.5 g

[0448] Zinc chloride 20.0 g

[0449] Ferrous sulfate-7H.sub.2O 65.0 g

[0450] Biotin 0.2 g

[0451] Sulfuric Acid 5.0 ml

[0452] Add Water to a final volume of 1 liter

[0453] 48-well Deep-well plates, sealed after inoculation with sterile, air-permeable tape, were used to culture the insecticidal peptide P. pastoris transformants. Colonies on the P. pastoris transformant plates were picked and inoculated the deep-well plates with 1 mL media per well, which was composed of MSM+0.2% PTM1+biotin (500 diluted from 200 ppm stock)+1% glycerol (pure). Inoculated plates were grown 5 days at 23.5 C. with 220 rpm shaking in a refrigerated incubator-shaker. 100 L 5% glycerol were added to each well of the plates at 2, 3, and 4 days post inoculation. On day 5 post-inoculation, conditioned media was harvested by centrifugation at 3700 rpm for 15 minutes, followed by filtration using filter plate with 0.22 M membrane. Filtered media stored at 20 C. for further analyses.

[0454] 0.3 mL aliquots of conditioned P. pastoris media prepared as described above were analyzed using rpHPLC described in EXAMPLE 1 to determine the concentrations of the native U-ACTX-Hv1a or U+2-ACTX-Hv1a peptide present in the media. Results of this analysis are summarized in Table 2, FIG. 15 and FIG. 16. The average peptide yields with a common mean and standard deviation are 67.027.9 mg/L for the U+2-ACTX-Hv1a P. pastoris strains and 42.918.3 mg/L for the native U-ACTX-Hv1a strains. A student's t-test indicated that the probability of such differing distributions of yields is far below 1%. The median yield from the U+2-ACTX-Hv1a strains was 79.0 mg/L, far higher than that from the native U-ACTX-Hv1a strains (44.7 mg/L). It is observed that the U+2-ACTX-Hv1a strains had much higher ratios of the strain counts at high peptide yield level than the native U-ACTX-Hv1a strains. All these results support the conclusion that the extra glycine-serine dipeptide at the N-terminus of the U+2-ACTX-Hv1a significantly improved the capacity of yeast transformants to produce this peptide and secrete it into conditioned media.

[0455] Table 2 shows a comparison of peptide yields from P. pastoris strains.

TABLE-US-00029 TABLE 2 U + 2 and native U-ACTX-Hv1a Peptide Yield Comparison U + 2 Yield (total 45 strains) Native U Yield (total 48 strains) Normalized Strain Ratio Overall Median Strain Ratio to Overall Median Yield Level count to total average Yield count total average Yield >30 mg/L 42 93.3% 67.0 27.9 79.0 38 79.2% 42.9 18.3 44.7 >40 mg/L 39 86.7% (mg/L) (mg/L) 34 70.8% (mg/L) (mg/L) >50 mg/L 37 82.2% 19 39.6% >60 mg/L 34 75.6% 3 6.3% >70 mg/L 11 24.4% 2 4.2% >80 mg/L 7 15.6% 2 4.2% >90 mg/L 6 13.3% 0 0 >100 mg/L 6 13.3% 0 0

Example 3

[0456] Expression of One of the Type 3 Sea Anemone Toxins Discovered from Anemonia viridis, Native Av3 and Av3+2 in the Yeast Strain Kluyveromyces lactis.

[0457] Insecticidal peptides to express:

[0458] Av3+2:

TABLE-US-00030 (SEQIDNO:29) GSRSCCPCYWGGCPWGQNCYPEGCSGPKV

[0459] Native Av3:

TABLE-US-00031 (SEQIDNO:30) RSCCPCYWGGCPWGQNCYPEGCSGPKV

[0460] To express the two non-ICK CRIP peptides above in Kluyveromyces lactis, the pKLAC1 vector and the Kluyveromyces lactis strain, YCT306, were used as in example 1.

[0461] The Av3 and Av3+2 peptide ORF, which encode -MF::Kex2 cleavage site::Av3 (or Av3+2), were codon-optimized using previously determined K. lactis expression algorithm.

[0462] The optimized Av3+2 expression ORF sequence is follows:

TABLE-US-00032 (SEQIDNO:31) aagcttgaaaaaaatgaaattttccactattttagcagcatctacagctt taatcagtgttgtcatggctgcacctgtgagtaccgaaacagatatagac gaccttccaatctctgttccagaagaggctttgataggattcatcgattt gactggtgatgaagtttcattgttaccagtgaataatggtacccatactg gtattttgttcctaaacaccacaattgctgaagctgcttttgcagataag gatgatttggagaaaagaggttctagatcatgctgcccttgttactgggg tggttgtccatggggacaaaactgttatcctgaaggatgttctggtccaa aggtatgagcggccgc

[0463] This optimized DNA sequence was cloned into pKLAC1 vector using Hind III and Not I restriction sites, resulting in the Av3+2 expression vector, pLB102.

[0464] The optimized native Av3 expression ORF sequence is follows:

TABLE-US-00033 (SEQIDNO:32) AAGCTTGAAAAAAATGAAATTTTCCACAATCTTAGCTGCAAGTACTGCTC TTATTTCTGTTGTGATGGCTGCTCCAGTATCTACCGAAACAGATATCGAT GATTTGCCAATTTCAGTCCCTGAAGAGGCACTAATCGGATTCATTGACTT AACCGGTGATGAAGTGAGTTTGTTGCCAGTTAACAACGGTACTCATACAG GTATATTGTTTTTGAATACCACTATAGCTGAAGCAGCATTCGCTGATAAA GATGACTTAGAAAAGAGAAGATCATGCTGCCCTTGTTACTGGGGTGGTTG TCCATGGGGTCAAAATTGTTATCCAGAGGGTTGTTCTGGACCTAAGGTTT GAGCGGCCGC

[0465] This optimized DNA sequence was cloned into pKLAC1 vector using Hind III and Not I restriction sites, resulting in the native Av3 expression vector, pLB103.

[0466] The expression vectors, pLB102 and pLB103, were then linearized using Sac II restriction endonuclease and transformed into YCT306 strain of K. lactis, using the electroporation transformation method. The resulting transformants grew on YCB agar plate supplemented with 5 mM acetamide, which only the acetamidase-expressing transformants could use efficiently as a metabolic source of nitrogen.

[0467] For insecticidal peptide yield evaluations, 48 colonies of pLB102 transformants and 48 colonies of pLB103 transformants were picked up and inoculated 2.2 mL of the defined K. lactis media with 2% sorbitol added as a carbon source in 48-well deep-well plates with 5 mL volume capacity each well. Cultures were processed at 23.5 C., with shaking at 280 rpm, for six days, when cell densities in the cultures were determined by light absorbance at 600 nm (OD600). Cells were then removed from the cultures by centrifugation at 4000 rpm for 10 minutes. The resulting supernatants (conditioned media) were filtered through 0.2 m membranes for HPLC yield analysis.

[0468] For the peptide yield evaluation, the filtered conditioned media samples were analyzed on an Agilent 1100 HPLC system equipped with an Onyx monolithic 4.5100 mm, C18 reverse-phase analytical HPLC column and an auto-injector. HPLC grade water and acetonitrile, both containing 0.1% trifluoroacetic acid, constituted the two mobile phase solvents used for the HPLC analyses. The native Av3 or Av3+2 peak areas in the resulting HPLC chromatographs were used as indication of the peptide concentration in the conditioned media, which were then further normalized to the corresponding final cell densities (as determined by OD600 measurements) as normalized peptide yield.

[0469] Table 3, FIG. 17 and FIG. 18 summarize the Av3+2 and native Av3 normalized peptide yield distributions from the K. lactis strains. The normalized peptide yield is represented by the peptide UV peak area in the HPLC chromatograph divided by the corresponding cell density (represented by the OD600) at the end of the cell culture. The overall averaged normalized peptide yield from the Av3+2 strains was 117.550.1 mAu.Math.sec/A, which was statistically significantly higher than that of native Av3 which was 29.816.1 mAu.Math.sec/A, by Student's t-test at 99% confidence level. The median normalized peptide yield of the Av3+2 K. lactis strains was 106.7 mAu.Math.sec/A, which was more than three times higher than that of native Av3 strains (31.7 mAu.Math.sec/A). The Av3+2 expression strains had much higher ratios of the strain counts at high yield level than the native Av3 strains (table 3). And as shown in FIG. 18, overall at the any percentile of peptide yield, Av3+2 strains had higher yield than native Av3 strains. All of these results indicated that the addition of the glycine-serine dipeptide to the N-terminus of the Av3 peptide contributes to significant improvement of the peptide yield from yeast transformants expressing this peptide.

TABLE-US-00034 TABLE 3 Av3 + 2 and native Av3 Peptide Yield Comparison Av3 + 2 Yield (pLB102-YCT, total 48 strains) Av3 (pLB103-YCT, total 48 strains) Normalized Strain Ratio to Overall Median Strain Ratio to Overall Median Yield Level count total average Yield count total average Yield >30 mAu .Math. sec/A 46 0.958 117.5 50.1 106.7 21 0.438 29.8 16.1 31.7 >60 mAu .Math. sec/A 38 0.792 (mAu .Math. sec/A) (mAu .Math. sec/A) 0 0 (mAu .Math. sec/A) (mAu .Math. sec/A) >90 mAu .Math. sec/A 36 0.75 0 0 >120 mAu .Math. sec/A 25 0.521 0 0 >150 mAu .Math. sec/A 16 0.333 0 0 >180 mAu .Math. sec/A 2 0.042 0 0 >2000 mAu .Math. sec/A 1 0.021 0 0

[0470] Crops and Insects

[0471] Specific crops and insects that may be controlled by these methods include the following:

[0472] The present invention may be used for transformation of any plant species, including, but not limited to, monocots and dicots. Crops for which a transgenic approach or PEP would be an especially useful approach include, but are not limited to: alfalfa, cotton, tomato, maize, wheat, corn, sweet corn, lucerne, soybean, sorghum, field pea, linseed, safflower, rapeseed, oil seed rape, rice, soybean, barley, sunflower, trees (including coniferous and deciduous), flowers (including those grown commercially and in greenhouses), field lupins, switchgrass, sugarcane, potatoes, tomatoes, tobacco, crucifers, peppers, sugarbeet, barley, and oilseed rape, Brassica sp., rye, millet, peanuts, sweet potato, cassaya, coffee, coconut, pineapple, citrus trees, cocoa, tea, banana, avocado, fig, guava, mango, olive, papaya, cashew, macadamia, almond, oats, vegetables, ornamentals, and conifers.

[0473] Pest includes, but is not limited to: insects, fungi, bacteria, nematodes, mites, ticks, and the like.

[0474] Insect pests include, but are not limited to, insects selected from the orders Coleoptera, Diptera, Hymenoptera, Lepidoptera, Mallophaga, Homoptera, Hemiptera, Orthroptera, Thysanoptera, Dermaptera, Isoptera, Anoplura, Siphonaptera, Trichoptera, and the like. More particularly, insect pests include Coleoptera, Lepidoptera, and Diptera.

[0475] Insects of suitable agricultural, household and/or medical/veterinary importance for treatment with the insecticidal polypeptides include, but are not limited to, members of the following classes and orders:

[0476] The order Coleoptera includes the suborders Adephaga and Polyphaga. Suborder Adephaga includes the superfamilies Caraboidea and Gyrinoidea. Suborder Polyphaga includes the superfamilies Hydrophiloidea, Staphylinoidea, Cantharoidea, Cleroidea, Elateroidea, Dascilloidea, Dryopoidea, Byrrhoidea, Cucujoidea, Meloidea, Mordelloidea, Tenebrionoidea, Bostrichoidea, Scarabaeoidea, Cerambycoidea, Chrysomeloidea, and Curculionoidea. Superfamily Caraboidea includes the families Cicindelidae, Carabidae, and Dytiscidae. Superfamily Gyrinoidea includes the family Gyrinidae. Superfamily Hydrophiloidea includes the family Hydrophilidae. Superfamily Staphylinoidea includes the families Silphidae and Staphylinidae. Superfamily Cantharoidea includes the families Cantharidae and Lampyridae. Superfamily Cleroidea includes the families Cleridae and Dermestidae. Superfamily Elateroidea includes the families Elateridae and Buprestidae. Superfamily Cucujoidea includes the family Coccinellidae. Superfamily Meloidea includes the family Meloidae. Superfamily Tenebrionoidea includes the family Tenebrionidae. Superfamily Scarabaeoidea includes the families Passalidae and Scarabaeidae. Superfamily Cerambycoidea includes the family Cerambycidae. Superfamily Chrysomeloidea includes the family Chrysomelidae. Superfamily Curculionoidea includes the families Curculionidae and Scolytidae.

[0477] Examples of Coleoptera include, but are not limited to: the American bean weevil Acanthoscelides obtectus, the leaf beetle Agelastica alni, click beetles (Agriotes lineatus, Agriotes obscurus, Agriotes bicolor), the grain beetle Ahasverus advena, the summer schafer Amphimallon solstitialis, the furniture beetle Anobium punctatum, Anthonomus spp. (weevils), the Pygmy mangold beetle Atomaria linearis, carpet beetles (Anthrenus spp., Attagenus spp.), the cowpea weevil Callosobruchus maculates, the fried fruit beetle Carpophilus hemipterus, the cabbage seedpod weevil Ceutorhynchus assimilis, the rape winter stem weevil Ceutorhynchus picitarsis, the wireworms Conoderus vespertinus and Conoderus falli, the banana weevil Cosmopolites sordidus, the New Zealand grass grub Costelytra zealandica, the June beetle Cotinis nitida, the sunflower stem weevil Cylindrocopturus adspersus, the larder beetle Dermestes lardarius, the corn rootworms Diabrotica virgifera, Diabrotica virgifera virgifera, and Diabrotica barberi, the Mexican bean beetle Epilachna varivestis, the old house borer Hylotropes bajulus, the lucerne weevil Hypera postica, the shiny spider beetle Gibbium psylloides, the cigarette beetle Lasioderma serricorne, the Colorado potato beetle Leptinotarsa decemlineata, Lyctus beetles' (Lyctus spp.), the pollen beetle Meligethes aeneus, the common cockshafer Melolontha melolontha, the American spider beetle Mezium americanum, the golden spider beetle Niptus hololeucus, the grain beetles Oryzaephilus surinamensis and Oryzaephilus mercator, the black vine weevil Otiorhynchus sulcatus, the mustard beetle Phaedon cochleariae, the crucifer flea beetle Phyllotreta cruciferae, the striped flea beetle Phyllotreta striolata, the cabbage steam flea beetle Psylliodes chrysocephala, Ptinus spp. (spider beetles), the lesser grain borer Rhizopertha dominica, the pea and been weevil Sitona lineatus, the rice and granary beetles Sitophilus oryzae and Sitophilus granaries, the red sunflower seed weevil Smicronyx fulvus, the drugstore beetle Stegobium paniceum, the yellow mealworm beetle Tenebrio molitor, the flour beetles Tribolium castaneum and Tribolium confusum, warehouse and cabinet beetles (Trogoderma spp.), and the sunflower beetle Zygogramma exclamationis.

[0478] Examples of Dermaptera (earwigs) include, but are not limited to: the European earwig Forficula auricularia, and the striped earwig Labidura riparia.

[0479] Examples of Dictvontera include, but are not limited to: the oriental cockroach Blatta orientalis, the German cockroach Blatella germanica, the Madeira cockroach Leucophaea maderae, the American cockroach Periplaneta americana, and the smokybrown cockroach Periplaneta fuliginosa.

[0480] Examples of Diplonoda include, but are not limited to: the spotted snake millipede Blaniulus guttulatus, the flat-back millipede Brachydesmus superus, and the greenhouse millipede Oxidus gracilis.

[0481] The order Diptera includes the Suborders Nematocera, Brachycera, and Cyclorrhapha. Suborder Nematocera includes the families Tipulidae, Psychodidae, Culicidae, Ceratopogonidae, Chironomidae, Simuliidae, Bibionidae, and Cecidomyiidae. Suborder Brachycera includes the families Stratiomyidae, Tabanidae, Therevidae, Asilidae, Mydidae, Bombyliidae, and Dolichopodidae. Suborder Cyclorrhapha includes the Divisions Aschiza and Aschiza. Division Aschiza includes the families Phoridae, Syrphidae, and Conopidae. Division Aschiza includes the Sections Acalyptratae and Calyptratae. Section Acalyptratae includes the families Otitidae, Tephritidae, Agromyzidae, and Drosophilidae. Section Calyptratae includes the families Hippoboscidae, Oestridae, Tachinidae, Anthomyiidae, Muscidae, Calliphoridae, and Sarcophagidae.

[0482] Examples of Diptera include, but are not limited to: the house fly (Musca domestica), the African tumbu fly (Cordylobia anthropophaga), biting midges (Culicoides spp.), bee louse (Braula spp.), the beet fly Pegomyia betae, blackflies (Cnephia spp., Eusimulium spp., Simulium spp.), bot flies (Cuterebra spp., Gastrophilus spp., Oestrus spp.), craneflies (Tipula spp.), eye gnats (Hippelates spp.), filth-breeding flies (Calliphora spp., Fannia spp., Hermetia spp., Lucilia spp., Musca spp., Muscina spp., Phaenicia spp., Phormia spp.), flesh flies (Sarcophaga spp., Wohlfahrtia spp.); the flit fly Oscinella frit, fruitflies (Dacus spp., Drosophila spp.), head and canon flies (Hydrotea spp.), the hessian fly Mayetiola destructor, horn and buffalo flies (Haematobia spp.), horse and deer flies (Chrysops spp., Haematopota spp., Tabanus spp.), louse flies (Lipoptena spp., Lynchia spp., and Pseudolynchia spp.), medflies (Ceratitus spp.), mosquitoes (Aedes spp., Anopheles spp., Culex spp., Psorophora spp.), sandflies (Phlebotomus spp., Lutzomyia spp.), screw-worm flies (Chtysomya bezziana and Cochliomyia hominivorax), sheep keds (Melophagus spp.); stable flies (Stomoxys spp.), tsetse flies (Glossina spp.), and warble flies (Hypoderma spp.).

[0483] Examples of Isontera (termites) include, but are not limited to: species from the families Hodotennitidae, Kalotermitidae, Mastotermitidae, Rhinotennitidae, Serritermitidae, Termitidae, and Termopsidae.

[0484] Examples of Heteroptera include, but are not limited to: the bed bug Cimex lectularius, the cotton stainer Dysdercus intermedius, the Sunn pest Eurygaster integriceps, the tarnished plant bug Lygus lineolaris, the green stink bug Nezara antennata, the southern green stink bug Nezara viridula, and the triatomid bugs Panstrogylus megistus, Rhodnius ecuadoriensis, Rhodnius pallescans, Rhodnius prolixus, Rhodnius robustus, Triatoma dimidiata, Triatoma infestans, and Triatoma sordida.

[0485] Examples of Homoptera include, but are not limited to: the California red scale Aonidiella aurantii, the black bean aphid Aphis fabae, the cotton or melon aphid Aphis gossypii, the green apple aphid Aphis pomi, the citrus spiny whitefly Aleurocanthus spiniferus, the oleander scale Aspidiotus hederae, the sweet potato whitefly Bemesia tabaci, the cabbage aphid Brevicoryne brassicae, the pear psylla Cacopsylla pyricola, the currant aphid Cryptomyzus ribis, the grape phylloxera Daktulosphaira vitifoliae, the citrus psylla Diaphorina citri, the potato leafhopper Empoasca fabae, the bean leafhopper Empoasca solana, the vine leafhopper Empoasca vitis, the woolly aphid Eriosoma lanigerum, the European fruit scale Eulecanium corni, the mealy plum aphid Hyalopterus arundinis, the small brown planthopper Laodelphax striatellus, the potato aphid Macrosiphum euphorbiae, the green peach aphid Myzus persicae, the green rice leafhopper Nephotettix cinticeps, the brown planthopper Nilaparvata lugens, gall-forming aphids (Pemphigus spp.), the hop aphid Phorodon humuli, the bird-cherry aphid Rhopalosiphum padi, the black scale Saissetia oleae, the greenbug Schizaphis graminum, the grain aphid Sitobion avenae, and the greenhouse whitefly Trialeurodes vaporariorum.

[0486] Examples of Isopoda include, but are not limited to: the common pillbug Armadillidium vulgare and the common woodlouse Oniscus asellus.

[0487] The order Lepidoptera includes the families Papilionidae, Pieridae, Lycaenidae, Nymphalidae, Danaidae, Satyridae, Hesperiidae, Sphingidae, Saturniidae, Geometridae, Arctiidae, Noctuidae, Lymantriidae, Sesiidae, and Tineidae.

[0488] Examples of Lepidoptera include, but are not limited to: Adoxophyes orana (summer fruit Tortrix moth), Agrotis ipsolon (black cutworm), Archips podana (fruit tree Tortrix moth), Bucculatrix pyrivorella (pear leafminer), Bucculatrix thurberiella (cotton leaf perforator), Bupalus piniarius (pine looper), Carpocapsa pomonella (codling moth), Chilo suppressalis (striped rice borer), Choristoneura fumiferana (eastern spruce budworm), Cochylis hospes (banded sunflower moth), Diatraea grandiosella (southwestern corn borer), Earls insulana (Egyptian bollworm), Euphestia kuehniella (Mediterranean flour moth), Eupoecilia ambiguella (European grape berry moth), Euproctis chrysorrhoea (brown-tail moth), Euproctis subflava (oriental tussock moth), Galleria mellonella (greater wax moth), Helicoverpa armigera (cotton bollworm), Helicoverpa zea (cotton bollworm), Heliothis virescens (tobacco budworm), Hofmannophila pseudopretella (brown house moth), Homeosoma electellum (sunflower moth), Homona magnanima (oriental tea tree Tortrix moth), Lithocolletis blancardella (spotted tentiform leafminer), Lymantria dispar (gypsy moth), Malacosoma neustria (tent caterpillar), Mamestra brassicae (cabbage armyworm), Mamestra configurata (Bertha armyworm), the hornworms Manduca sexta and Manuduca quinquemaculata, Operophtera brumata (winter moth), Ostrinia nubilalis (European corn borer), Panolis flammea (pine beauty moth), Pectinophora gossypiella (pink bollworm), Phyllocnistis citrella (citrus leafminer), Pieris brassicae (cabbage white butterfly), Plutella xylostella (diamondback moth), Rachiplusia ni (soybean looper), Spilosoma virginica (yellow bear moth), Spodoptera exigua (beet armyworm), Spodoptera frugiperda (fall armyworm), Spodoptera littoralis (cotton leafworm), Spodoptera litura (common cutworm), Spodoptera praefica (yellowstriped armyworm), Sylepta derogata (cotton leaf roller), Tineola bisselliella (webbing clothes moth), Tineola pellionella (case-making clothes moth), Tortrix viridana (European oak leafroller), Trichoplusia ni (cabbage looper), and Yponomeuta padella (small ermine moth).

[0489] Examples of Orthoptera include, but are not limited to: the common cricket Acheta domesticus, tree locusts (Anacridium spp.), the migratory locust Locusta migratoria, the twostriped grasshopper Melanoplus bivittatus, the differential grasshopper Melanoplus dfferentialis, the redlegged grasshopper Melanoplus femurrubrum, the migratory grasshopper Melanoplus sanguinipes, the northern mole cricket Neocurtilla hexadectyla, the red locust Nomadacris septemfasciata, the shortwinged mole cricket Scapteriscus abbreviatus, the southern mole cricket Scapteriscus borellii, the tawny mole cricket Scapteriscus vicinus, and the desert locust Schistocerca gregaria.

[0490] Examples of Phthiraptera include, but are not limited to: the cattle biting louse Bovicola bovis, biting lice (Damalinia spp.), the cat louse Felicola subrostrata, the shortnosed cattle louse Haematopinus eloysternus, the tail-switch louse Haematopinus quadriperiussus, the hog louse Haematopinus suis, the face louse Linognathus ovillus, the foot louse Linognathus pedalis, the dog sucking louse Linognathus setosus, the long-nosed cattle louse Linognathus vituli, the chicken body louse Menacanthus stramineus, the poultry shaft louse Menopon gallinae, the human body louse Pediculus humanus, the pubic louse Phthirus pubis, the little blue cattle louse Solenopotes capillatus, and the dog biting louse Trichodectes canis.

[0491] Examples of Psocoptera include, but are not limited to: the booklice Liposcelis bostrychophila, Liposcelis decolor, Liposcelis entomophila, and Trogium pulsatorium.

[0492] Examples of Siphonaptera include, but are not limited to: the bird flea Ceratophyllus gallinae, the dog flea Ctenocephalides canis, the cat flea Ctenocephalides fells, the human flea Pulex irritans, and the oriental rat flea Xenopsylla cheopis.

[0493] Examples of Symphyla include, but are not limited to: the garden symphylan Scutigerella immaculate.

[0494] Examples of Thysanura include, but are not limited to: the gray silverfish Ctenolepisma longicaudata, the four-lined silverfish Ctenolepisma quadriseriata, the common silverfish Lepisma saccharina, and the firebrat Thennobia domestica;

[0495] Examples of Thysanoptera include, but are not limited to: the tobacco Thrips Frankliniella fusca, the flower Thrips Frankliniella intonsa, the western flower Thrips Frankliniella occidentalis, the cotton bud Thrips Frankliniella schultzei, the banded greenhouse Thrips Hercinothrips femoralis, the soybean Thrips Neohydatothrips variabilis, Kelly's citrus Thrips Pezothrips kellyanus, the avocado Thrips Scirtothrips perseae, the melon Thrips Thrips palmi, and the onion Thrips Thrips tabaci.

[0496] Examples of Nematodes include, but are not limited to: parasitic nematodes such as root-knot, cyst, and lesion nematodes, including Heterodera spp., Meloidogyne spp., and Globodera spp.; particularly members of the cyst nematodes, including, but not limited to: Heterodera glycines (soybean cyst nematode); Heterodera schachtii (beet cyst nematode); Heterodera avenae (cereal cyst nematode); and Globodera rostochiensis and Globodera pailida (potato cyst nematodes). Lesion nematodes include, but are not limited to: Pratylenchus spp.

[0497] In one embodiment, the insecticidal compositions comprising the polypeptides, polynucleotides, cells, vectors, etc., can be employed to treat ectoparasites. Ectoparasites include, but are not limited to: fleas, ticks, mange, mites, mosquitoes, nuisance and biting flies, lice, and combinations comprising one or more of the foregoing ectoparasites. The term fleas includes the usual or accidental species of parasitic flea of the order Siphonaptera, and in particular the species Ctenocephalides, in particular C fells and C. cams, rat fleas (Xenopsylla cheopis) and human fleas (Pulex irritans).

[0498] Insect pests of the invention for the major crops include, but are not limited to: Maize: Ostrinia nubilalis, European corn borer; Agrotis ipsilon, black cutworm; Helicoverpa zea, corn earworm; Spodoptera frugiperda, fall armyworm; Diatraea grandiosella, southwestern corn borer; Elasmopalpus lignosellus, lesser cornstalk borer; Diatraea saccharalis, surgarcane borer; Diabrotica virgifera, western corn rootworm; Diabrotica longicornis barberi, northern corn rootworm; Diabrotica undecimpunctata howardi, southern corn rootworm; Melanotus spp., wireworms; Cyclocephala borealis, northern masked chafer (white grub); Cyclocephala immaculata, southern masked chafer (white grub); Popillia japonica, Japanese beetle; Chaetocnema pulicaria, corn flea beetle; Sphenophorus maidis, maize billbug; Rhopalosiphum maidis, corn leaf aphid; Anuraphis maidiradicis, corn root aphid; Blissus leucopterus leucopterus, chinch bug; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus sanguinipes, migratory grasshopper; Hylemya platura, seedcorn maggot; Agromyza parvicornis, corn blot leafminer; Anaphothrips obscrurus, grass Thrips; Solenopsis milesta, thief ant; Tetranychus urticae, twospotted spider mite; Sorghum: Chilo partellus, sorghum borer; Spodoptera frugiperda, fall armyworm; Helicoverpa zea, corn earworm; Elasmopalpus lignosellus, lesser cornstalk borer; Feltia subterranea, granulate cutworm; Phyllophaga crinita, white grub; Eleodes, Conoderus, and Aeolus spp., wireworms; Oulema melanopus, cereal leaf beetle; Chaetocnema pulicaria, corn flea beetle; Sphenophorus maidis, maize billbug; Rhopalosiphum maidis, corn leaf aphid; Sipha flava, yellow sugarcane aphid; Blissus leucopterus leucopterus, chinch bug; Contarinia sorghicola, sorghum midge; Tetranychus cinnabarinus, carmine spider mite; Tetranychus urticae, twospotted spider mite; Wheat: Pseudaletia unipunctata, army worm; Spodoptera frugiperda, fall armyworm; Elasmopalpus lignosellus, lesser cornstalk borer; Agrotis orthogonia, western cutworm; Elasmopalpus lignosellus, lesser cornstalk borer; Oulema melanopus, cereal leaf beetle; Hypera punctata, clover leaf weevil; Diabrotica undecimpunctata howardi, southern corn rootworm; Russian wheat aphid; Schizaphis graminum, greenbug; Macrosiphum avenae, English grain aphid; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus differentialis, differential grasshopper; Melanoplus sanguinipes, migratory grasshopper; Mayetiola destructor, Hessian fly; Sitodiplosis mosellana, wheat midge; Meromyza americana, wheat stem maggot; Hylemya coarctata, wheat bulb fly; Frankliniella fusca, tobacco Thrips; Cephus cinctus, wheat stem sawfly; Aceria tulipae, wheat curl mite; Sunflower: Suleima helianthana, sunflower bud moth; Homoeosoma electellum, sunflower moth; Zygogramma exclamationis, sunflower beetle; Bothyrus gibbosus, carrot beetle; Neolasioptera murtfeldtiana, sunflower seed midge; Cotton: Heliothis virescens, cotton budworm; Helicoverpa zea, cotton bollworm; Spodoptera exigua, beet armyworm; Pectinophora gossypiella, pink bollworm; Anthonomus grandis, boll weevil; Aphis gossypii, cotton aphid; Pseudatomoscelis seriatus, cotton fleahopper; Trialeurodes abutilonea, bandedwinged whitefly; Lygus lineolaris, tarnished plant bug; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus differentialis, differential grasshopper; Thrips tabaci, onion Thrips; Franklinkiella fusca, tobacco Thrips; Tetranychus cinnabarinus, carmine spider mite; Tetranychus urticae, twospotted spider mite; Rice: Diatraea saccharalis, sugarcane borer; Spodoptera frugiperda, fall armyworm; Helicoverpa zea, corn earworm; Colaspis brunnea, grape Colaspis; Lissorhoptrus oryzophilus, rice water weevil; Sitophilus oryzae, rice weevil; Nephotettix nigropictus, rice leafhopper; Blissus leucopterus leucopterus, chinch bug; Acrosternum hilare, green stink bug; Soybean: Pseudoplusia includens, soybean looper; Anticarsia gemmatalis, velvetbean caterpillar; Plathypena scabra, green cloverworm; Ostrinia nubilalis, European corn borer; Agrotis ipsilon, black cutworm; Spodoptera exigua, beet armyworm; Heliothis virescens, cotton budworm; Helicoverpa zea, cotton bollworm; Epilachna varivestis, Mexican bean beetle; Myzus persicae, green peach aphid; Empoasca fabae, potato leafhopper; Acrosternum hilare, green stink bug; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus differentialis, differential grasshopper; Hylemya platura, seedcorn maggot; Sericothrips variabilis, soybean Thrips; Thrips tabaci, onion Thrips; Tetranychus turkestani, strawberry spider mite; Tetranychus urticae, twospotted spider mite; Barley: Ostrinia nubilalis, European corn borer; Agrotis ipsilon, black cutworm; Schizaphis graminum, greenbug; Blissus leucopterus leucopterus, chinch bug; Acrosternum hilare, green stink bug; Euschistus servus, brown stink bug; Delia platura, seedcorn maggot; Mayetiola destructor, Hessian fly; Petrobia latens, brown wheat mite; Oil Seed Rape: Brevicoryne brassicae, cabbage aphid; Phyllotreta cruciferae, Flea beetle; Mamestra configurata, Bertha armyworm; Plutella xylostella, Diamond-back moth; Delia ssp., Root maggots.

[0499] In some embodiments, the insecticidal compositions can be employed to treat combinations comprising one or more of the foregoing insects.

[0500] The insects that are susceptible to the peptides of this invention include but are not limited to the following: Cyt toxins affect families such as: Blattaria, Coleoptera, Collembola, Diptera, Echinostomida, Hemiptera, Hymenoptera, Isoptera, Lepidoptera, Neuroptera, Orthoptera, Rhabditida, Siphonoptera, and Thysanoptera. Genus-Species are indicated as follows: Actebia-fennica, Agrotis-ipsilon, A.-segetum, Anticarsia-gemmatalis, Argyrotaenia-citrana, Artogeia-rapae, Bombyx mori, Busseola-fusca, Cacyreus-marshall, Chilo-suppressalis, Christoneura-fumiferana, C.-occidentalis, C.-pinus pinus, C.-rosacena, Cnaphalocrocis-medinalis, Conopomorpha-cramerella, Ctenopsuestis-obliquana, Cydia-pomonella, Danaus-plexippus, Diatraea-saccharallis, D.-grandiosella, Earias-vittella, Elasmolpalpus-lignoselius, Eldana-saccharina, Ephestia-kuehniella, Epinotia-aporema, Epiphyas-postvittana, Galleria-mellonella, Genus-Species, Helicoverpa-zea, H.-punctigera, H.-armigera, Heliothis-virescens, Hyphantria-cunea, Lambdina-fiscellaria, Leguminivora-glycinivorella, Lobesia-botrana, Lymantria-dispar, Malacosoma-disstria, Mamestra-brassicae, M. configurata, Manduca-sexta, Marasmia-patnalis, Maruca-vitrata, Orgyia-leucostigma, Ostrinia-nubilalis, O.-furnacalis, Pandemis-pyrusana, Pectinophora-gossypiella, Perileucoptera-coffeella, Phthorimaea-opercullela, Pianotortrix-octo, Piatynota-stultana, Pieris-brassicae, Plodia-interpunctala, Plutella-xylostella, Pseudoplusia-includens, Rachiplusia-nu, Sciropophaga-incertulas, Sesamia-calamistis, Spilosoma-virginica, Spodoptera-exigua, S.-frugiperda, S.-littoralis, S.-exempta, S.-litura, Tecia-solanivora, Thaumetopoea-pityocampa, Trichoplusia-ni, Wiseana-cervinata, Wiseana-copularis, Wiseana-jocosa, Blattaria-Blattella, Collembola-Xenylla, C.-Folsomia, Echinostomida-Fasciola, Hemiptera-Oncopeltrus, He.-Bemisia, He.-Macrosiphum, He.-Rhopalosiphum, He.-Myzus, Hymenoptera-Diprion, Hy.-Apis, Hy.-Macrocentrus, Hy.-Meteorus, Hy.-Nasonia, Hy.-Solenopsis, Isopoda-Porcellio, Isoptera-Reticulitermes, Orthoptera-Achta, Prostigmata-Tetranychus, Rhabitida-Acrobeloides, R.-Caenorhabditis, R.-Distolabrellus, R.-Panagrellus, R.-Pristionchus, R.-Pratylenchus, R.-Ancylostoma, R.-Nippostrongylus, R.-Panagrellus, R.-Haemonchus, R.-Meloidogyne, and Siphonaptera-Ctenocephalides.

[0501] We describe Part II with the following description and summary:

[0502] We describe a peptide with an N-terminal dipeptide which is added to and operably linked to a known peptide, wherein said N-terminal dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide, wherein said peptide is selected from a CRIP (Cysteine Rich Insecticidal Peptide), such as from an ICK peptide, or a Non-ICK peptide. The N-terminal dipeptide which is added to and operably linked to a known peptide, wherein said N-terminal dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide. The N-terminal dipeptide has a non-polar amino acid as the N-terminal amino acid of the N-terminal dipeptide that can be selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine and a polar amino acid of the C-terminal amino acid of the N-terminal peptide can be selected from serine, threonine, cysteine, asparagine, glutamine, histidine, tryptophan, and tyrosine.

[0503] The N-terminal dipeptide can have a non-polar amino acid as the N-terminal amino acid of the N-terminal dipeptide selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine and said polar amino acid of the C-terminal amino acid of the N-terminal peptide is selected from serine, threonine, cysteine, asparagine, glutamine, histidine, tryptophan, and tyrosine. The N-terminal dipeptide can and preferably is comprised of glycine-serine.

[0504] We describe a peptide with a N-terminal dipeptide which is added to and operably linked to a known peptide, wherein said N-terminal dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide, wherein said peptide is selected from a PFIP (Pore Forming Insecticidal Protein), or it could be selected from a CRIP (Cysteine Rich Insecticidal Peptide), such as from an ICK peptide, or a Non-ICK peptide. The Non-ICK peptide could be a sea anemone, origin peptide like Av2 or Av3 and the preferred dipeptide is comprised of glycine-serine. The ICK peptide could be from a spider like the ACTX peptides and the preferred dipeptide is comprised of glycine-serine. The PFIP could be a Bt protein, like any of those disclosed herein, in the sequence listing and know to one skilled in the art who reads these description and the preferred dipeptide is comprised of glycine-serine.

[0505] As noted above we explain that the N-terminal dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide and the non-polar amino acid from the N-terminal amino acid of the N-terminal dipeptide can be selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine and preferably the non-polar amino acid is glycine. And we explain and claim that any of the peptides in the paragraph below and any of the peptides in this paragraph can act independently and should be treated independently and all of the possible combinations are claimed independently.

[0506] As noted above we explain that the N-terminal dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide and the polar amino acid of the C-terminal amino acid of the N-terminal peptide is selected from serine, threonine, cysteine, asparagine, glutamine, histidine, tryptophan, tyrosine and preferably the polar amino acid is serine. And we explain and claim that any of the peptides in the paragraph above and any of the peptides in this paragraph can act independently and should be treated independently and all of the possible combinations are claimed independently.

[0507] The peptide to which the N-terminal dipeptide is attached can be any peptide, any toxic peptide, any insecticidal peptide, any PFIP, any CRIP, a CRIP that is a ACTX peptide (which is an example of an ICK peptide), CRIP is a sea anemone peptide (which is an example of a Non-ICK peptide), it can be a PFIP, the PFIP can be a Bt protein, the Bt protein can be cry, cyt, VIP and it can be like any of these peptides as disclosed herein, or in the sequence listing, or known by one skilled in the art who reads these descriptions and understands the document.

[0508] We specifically note that these procedures are useful and we claim the procedures themselves and the products of the procedures both as independent claims and as process by product claims for making any insecticidal peptide and in particular any peptide selected from any of the peptides or sources of peptides including Atrax or Hadronyche, as disclosed herein or elsewhere, as well as any insecticidal peptide with fragments thereof including mature, pre, and pro peptide versions of said peptides and sequence numbers and the peptide in SEQ. ID. NO. 5.

[0509] These peptides are useful and the procedures can all be made and used where there is one nonpolar amino acid at the N-terminal end and one polar amino acid at the C-terminal end, and the dipeptide of said non-polar amino acid is selected from glycine, alanine, proline, valine, leucine, isoleucine, phenylalanine and methionine, and it is preferably glycine or gly, and the polar amino acid is selected from serine, threonine, cysteine, asparagine, glutamine, histidine, tryptophan and tyrosine and it is preferably serine or ser. The dipeptide gly-ser is most preferred. The dipeptide can be operably linked to any known peptide, any toxic peptide, any insecticidal peptide, any of the peptides including Atrax or Hadronyche, disclosed herein any insecticidal peptide with fragments thereof including mature, pre, and pro peptide versions of said peptides and sequence numbers, any mature insecticidal peptide, the toxic peptide comprises SEQ. ID. NO; 6, or the toxic peptide comprises GSQYC VPVDQ PCSLN TQPCC DDATC TQERN ENGHT VYYCR A (SEQ ID NO: 5).

[0510] We also describe and claim the dipeptide Gly-Ser, nucleotides encoding the dipeptide Gly-Ser selected from GGT, GGC, GGA, or GGG, any of which encodes Gly, and TCT, TCC, TCA, TCG, AGT, and AGC, any of which encodes Ser, and those nucleotides linked to any of the proteins and the process and the products of the process. We describe and claim these nucleotides which code for these peptides operably linked to the 5 terminus of the DNA sequence encoding any peptide disclosed herein.

[0511] We explain and disclose a process for increasing the yield of insecticidal peptides which are produced from yeast expression systems comprising the addition of any dipeptide to the N-terminus of any insecticidal peptide. The process and product by process for increasing the yield used the dipeptide as discussed in the paragraphs above.

[0512] We specifically discuss the procedures, products, process and products by process with any insecticidal peptide that inhibits both voltage-gated Calcium channels and Calcium-activated potassium channels in insects, with peptide origins from any species of Australian Funnel-web spider, a spider is selected from the Australian Funnel-web spiders of genus Atrax or Hadronyche, including Hadronyche versuta. We also specifically describe and claim insecticidal peptides that are not ICK motif peptide such as peptides with origins from any species of venomous sea anemone, we refer to the proteins as examples of CRIP motif peptide that are Non-ICK. We disclose and have tested and show that the procedures work with proteins from the sea anemone genus Anemonia, and specifically from selected species, Anemonia viridis. We believe to a scientific certainty that the methods will work with insecticidal peptides that contain contains 20-100 amino acids and 2-6 disulfide bonds, and with insecticidal peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to SEQ ID NO: 5, SEQ ID NO: 6, Av2 and Av3.

[0513] We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of the genuses Saccharomyces, Pichia, Kluyveromyces, Hansenula, Yarrowia or Schizosaccharomyces and the species Saccharomyces includes any species of Saccharomyces, and preferably we disclose the Saccharomyces species Saccharomyces cerevisiae. We specifically disclose Saccharomyces cerevisiae species is selected from following strains: INVSc1, YNN27, S150-2B, W303-1B, CG25, W3124, JRY188, BJ5464, AH22, GRF18, W303-1A and BJ3505. We specifically disclose Pichia species including any species of Pichia and preferably the Pichia species, Pichia pastoris, and preferably the Pichia pastoris is selected from following strains: Bg08, Y-11430, X-33, GS115, GS190, JC220, JC254, GS200, JC227, JC300, JC301, JC302, JC303, JC304, JC305, JC306, JC307, JC308, YJN165, KM71, MC100-3, SMD1163, SMD1165, SMD1168, GS241, MS105, any pep4 knock-out strain and any prb1 knock-out strain, as well as Pichia pastoris is selected from following strains: Bg08, X-33, SMD1168 and KM71. We specifically disclose Kluyveromyces species includes any species of Kluyveromyces, and preferably Kluyveromyces lactis, and we teach that the stain of Kluyveromyces lactis can be but is not required to be selected from following strains: GG799, YCT306, YCT284, YCT389, YCT390, YCT569, YCT598, MW98-8C, MS1, CBS293.91, Y721, MD2/1, PM6-7A, WM37, K6, K7, 22AR1, 22A295-1, SD11, MG1/2, MSK110, JA6, CMK5, HP101, HP108 and PM6-3C, in addition to Kluyveromyces lactis species is selected from GG799 and YCT306.

[0514] We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of Hansenula species including any species of Hansenula and preferably Hansenula polymorpha. We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of Yarrowia species including any species of Yarrowia and preferably Yarrowia lipolytica. We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of Schizosaccharomyces species including any species of Schizosaccharomyces and preferably Schizosaccharomyces pombe.

[0515] We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of Hansenula species including any species of Hansenula and preferably Hansenula polymorpha. We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of Yarrowia species including any species of Yarrowia and preferably Yarrowia lipolytica. We specifically describe and claim the procedures when used with any species of yeast, including but not limited to any species of Schizosaccharomyces species including any species of Schizosaccharomyces and preferably Schizosaccharomyces pombe.

PART III. IN THIS PART WE DESCRIBE COMBINATIONS OF CRIPS AND PFIPS

[0516] A large number of venom peptides have been characterized as insecticidal. However, despite numerous reports, few have found any utility in the market as actual or effective insecticides. In fact, only -ACTX-Hv1a has been reported to be toxic by oral administration to the American lone star tick Amblyomma americanum. No other spider toxins have been reported to possess oral activity even in the modified gut of ticks. There has been a report that the bioavailability of these peptides may be increased by coupling them to a carrier protein such as snowdrop lectin (Galanthus nivalis agglutinin, GNA). Mukherjee, A. K.: Sollod, B. L.; Wikel, S. K.; King, G. F. Orally active acaricidal peptide toxins from spider venom. Toxicon 2006, 47, 182-187. Garlic lectins are reported to increase the absorption of toxins across the insect midgut Fitches, E, et al., Insect Sci., 2008, 15, 483-495, Fitches, E., et. al., Insect Biochem. Mol. Biol. 2008, 38, 905-915. Firches, E. et. al., J. Insect Physiol. 2004, 50, 61-71. For example, fusion of the insecticidal spider toxin U2-SGTX-Sf1a (SFI1) to GNA significantly increased its oral toxicity to the tomato moth Lacanobia oleracea Down, R. E. et. al., Pest Manag. Sci. 2006, 62, 77-85, as well as the rice brown planthopper Nilaparvata lugens and the peach-potato aphid Myzus persicae. Surprisingly, a thioredoxin--HXTX-Hv1a fusion protein was found to be insecticidal in Helicoverpa armigera and Spodoptera littoralis caterpillars by topical application. See Khan, S. A. Transgenic Res. 2006, 15, 349-357. (although the fusion protein was applied topically in a solution containing high levels of imidazole, a compound known to have contact insecticidal activity; Pence, R. J. California Agric. 1965, 13-15. These efforts and findings clearly indicate the importance of developing means to enhance the oral bioavailability of venom toxins. We think these efforts are also misdirected. In this disclosure we teach that fusion of insecticidal peptides to carrier proteins that bind to the gut of insects is unnecessary. We describe a better way to deliver the toxin in insecticidal peptides to insects. Without wishing to be bound by theory, it is our theory that PFIPS, or Pore Forming Insecticidal Proteins, act by selectively binding to receptors in the insect gut. The PFIPS then, in subsequent events, act to disrupt the membrane of the epithelial cells lining the gut. When an appropriate CRIP or TMOF is also timely introduced to the gut at the same time the PFIPS are acting on the insect gut, the result is apoptosis and death of the cells lining the gut. Thus, the gut lining is broached and simultaneously the venomous peptides, often large peptides isolated from venom, can pass through the gut and sicken or kill the target insect. Surprisingly, insects that have developed resistance to Bt proteins have no defenses and show no resistance at all to even low levels of Bt, when a PFIP like Bt is administered to an insect in combination with CRIP or TMOF, that is a toxic peptide, but one with properties that do not act like a PFIPS such as Bt. We provide data showing that certain combinations of co-administered CRIPS and PFIPS can provide more than double the killing and stopping power than would be expected from similar concentration applications of either a CRIP or PFIPS applied individually.

[0517] Examples of a PFIP include the cry and VIP proteins from Bt organisms. Bt proteins like the cry proteins disrupt the insect gut membrane allowing for adventitious infection (sepsis) of the insect by gut flora. In the absence of gut microbes, Bt is not insecticidal. Broderick, Nichole PNAS Vol. 103, No. 41 (2006). Hence one would expect that the mechanism shown to cause Bt mortality (infection) would be mitigated in those insects showing Bt resistance, and it is mitigated in those insects. Bt resistant insects show little gut disruption even when fed high levels of Bt proteins, like cry. What we have surprisingly discovered is that somehow even though these insects guts no longer display the dramatic effects of Bt on the gut, that is they are truly resistant, when they are exposed to insecticidal peptides of a certain type, like the CRIPS and TMOF which have a very different mode of action than PFIPS like Bt, then these very resistant insects have no resistance what so ever. The disappearance of resistance in a Bt resistant insect is surprising, and we show this happens, with our data, in the examples provided herein. This result was completely unexpected. Now however we understand, and we can use this knowledge to explain how sublethal amounts of a PFIP protein like Bt, can be converted into a lethal cocktail such that if two (2) or more sublethal amounts of insecticidal protein are co-administered, then the combination of proteins becomes lethal to insects which are otherwise thought to be too large, or too resistant to be susceptible to toxic peptides.

[0518] It is surprising that insect resistance to PFIPs alone does not confer resistance to the combination of PFIPS with CRIPS and or TMOF. Because of the mechanism of action of the PFIPS one would expect that the PFIP, like a Bt protein, would no longer contribute to the toxic effects of the combination of PFIPS with CRIPS and or TMOF. Instead the opposite happens and the combination has a greater than expected level of activity as shown with our data.

[0519] Insects have developed resistance to Bt. Attempts to combat this resistance have resulted in the use of many different subtypes of Bt. We teach here that insect resistance can be overcome by co-application of venom peptides. Since the most common mode of resistance (mode 1, prior ref) Pence, R. J. The antimetabolite imidazole as a pesticide. California Agric. 1965, 13-15. is down regulation of Bt receptors that line the gut, one would expect insect resistance would be maintained in Bt resistant insects because the number of receptors is insufficient to render the insect vulnerable to sepsis by gut flora. What we have discovered and believe, and our data supports our theory in dramatic fashion (see examples below), is that even with Bt resistant insects there remains sufficient membrane abnormalities that exposure to even low levels of Bt, when combined with certain small toxic insecticidal peptides, having a different type of mode of action than Bt, will surprisingly cause Bt resistant insects to stop feeding or die, We believe this is because the gut lining is still disrupted in these resistant insects, just enough to allow the passage of the much smaller venom peptides characteristic of either CRIP and TMOF types of insecticidal peptides.

[0520] In this document we do not consider TMOF peptides or Trypsin modulating oostatic factor (TMOF) peptides which have been identified as a potential larvicides, see D. Borovsky, Journal of Experimental Biology 206, 3869-3875, to be a CRIP type of insecticidal peptide. We define a CRIP peptide as one with various cysteines according to our definitions herein. TMOF peptides does not fit the motif that we have described as a CRIP peptide. Please see the definition section toward the beginning of these documents for a definition of CRIP and TMOF. We discuss combining CRIP and or TMOF type of proteins with a different type of protein we describe as PFIPS.

[0521] PFIPS are Pore Forming Insecticidal Proteins which are also defined in the definition section. One example of one type of PFIP are various proteins of the widely used group of proteins derived from Bt, such as cry, cyt and VIP. These are effective insecticides used for crop protection in the form of both plant incorporated protectants and foliar sprays. Commercial formulations of such Bt proteins are widely used to control insects at the larval stage.

[0522] In contrast to PFIPS, CRIPS such as Inhibitory cysteine knot or ICK peptides are very different group of peptides that also have insecticidal activity, but they act with a very different mode of action. In this document there is no overlap of a PFIP protein with a CRIP protein, the two groups are separate and distinct. ICK peptides and even Non-ICK peptides are both considered CRIPS in this document. CRIPS are often toxic to naturally occurring biological target species, usually insects or arachnids of some type. Often CRIP peptides can have arthropod origins such as the venoms of scorpions or spiders, this venom origin is very common with ICKs. CRIP may be delivered to their physiological site of action in various ways, for example by delivering the toxin directly to the insect's gut or internal organs by injection, by application to an insect locus and uptake from surface contact, or by inducing the insect to consume the toxin from its food. For example, in some embodiments, an insect may consume the toxin by feeding on a plant treated (e.g., sprayed, powdered, wetted, or otherwise contacted) with one or more toxins and/or compositions thereof. In yet other embodiments, an insect may consume the toxin by feeding upon a transgenic plant that has been transformed to express one or more toxins.

[0523] The peptides described herein may be formulated as either applied products or through transgenic plants face challenges. It can be difficult to successfully produce such peptides on a commercial scale, with reproducible peptide formation and folding. Cost controls can be challenging. The wide variety, unique properties and special nature of peptides, combined with the huge variety of possible production techniques present an overwhelming number of approaches to peptide production. Commercial products have their own significant challenges. Peptides are often unstable when applied in the environment of a crop. UV irradiation and other factors can cause Bt insecticides to decay rapidly in the environment, often in as little as a few hours. Further, commercial effectiveness can change. Both Bt spray on products and the transgenic Bt proteins used as plant incorporated protectant face emerging insect resistance.

[0524] A product is needed that enhances the acute activity, improves resistance performance, or extends the duration of action in order to increase insect control and crop protection.

[0525] Here we present combinations of Bt Protein and ICK and TMOF peptides in various combinations. We describe examples of these novel combinations. The new combinations, products, methods, and their formulation and uses thereof are described and claimed herein.

[0526] Cysteine Rich Insecticidal Peptides (CRIPS) in Insecticidal Combinations

[0527] Cysteine rich insecticidal peptides (CRIPS) are peptides rich in cysteine which form disulfide bonds. The cysteine-cysteine disulfide bonds play a significant role in the toxicity of these insecticidal peptides which are exemplified by both inhibitory cysteine knot or ICK peptides and by examples of toxic peptides with disulfide bonds that are not considered ICK peptides (non-ICK CRIPS) such as peptides from the sea anemone, like Av2 and Av3 peptides. These cysteine-cysteine disulfide bonds stabilized toxic peptides (CRIPS) can have remarkable stability when exposed to the environment. Many ICK peptides are isolated from venomous animals such as spiders, scorpions, and snakes and are toxic to insects. TMOF peptides are known to have larvicidal activity. Av2 and Av3 peptides are isolated from sea anemones. We also describe a different group of peptides that act on the lining of the insect gut. We call these PFIPS for Pore Forming Insecticidal Proteins. Most well-known examples of a PFIPS are the Bt proteins, well known because of their specific pesticidal activities and commercial applications. Surprisingly, we discovered that, when the combination of these peptides, PFIPS and CRIPS are combined and administered so they act together in the gut (co-administration of the combination not required only the combination of the activity in the gut is needed) they become highly effective at controlling insects. For example, one of the preferred combinations would be to combine a Bt protein with an ICK peptides, or sea anemone peptides they create a highly effective insecticide with a potency much greater than one would expect.

[0528] We describe an insecticidal combination peptide composition comprising both a PFIP (Pore Forming Insecticidal Proteins) in combination with a either a CRIP and/or a TMOF type of insecticidal protein. Note that CRIP includes such insecticidal proteins as ICK (Inhibitor Cystine Knot) peptides, and Non-ICK proteins but TMOF peptides are not considered CRIP proteins. CRIP proteins can include Non-ICK proteins like the proteins first identified in sea anemones, for example Av2 or Av3. The composition can be in the ratio of PFIP: to CRIP and or TMOF, on a dry weight basis, from about any or all of the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. We also describe a composition where the ratio of PFIP to CRIP or TMOF on a on a dry weight basis, is selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. CRIP, ICK, Non-ICK CRIP and TMOF can be either 100% of the peptide combined with Bt, or either peptide in any combination that totals 100% of both ICK+TMOF peptide can be combined with Bt.

[0529] In another embodiment the combination of mixtures of PFIP in combination with CRIP or TMOF peptides includes either or both of the PFIP and CRIP, ICK and non ICK peptides which are derived from more than 1 different types or bacterial strain origins for either one or both of PFIP, ICK and TMOF peptides. By bacterial strain origins we mean the peptides can be described as having been expressed by a bacterial strain that expresses the peptides with the understanding that many peptides are also artificial in the sense that they are no longer all developed from animal or bacterial strains.

[0530] We also disclose compositions where either or both of mixtures of PFIP in combination with CRIP or TMOF peptides and or mixtures of PFIP in combination with CRIP plus or with TMOF peptides are derived from between 2 and 5, 2-15, 2-30, 5-10, 5-15, 5-30, 5-50 and various other different types or bacterial strains origins of either one or both of the proteins. We disclose a composition where either or both of the proteins are encoded by from 2 to 15 different types or bacterial strain origins of either one or both of the PFIP in combination with CRIP or TMOF peptides. And any of these combinations of 2-5, 2-15, 2-30, 5-10, 5-15, 5-30, 5-50 and various other different types and mixtures of PFIP in combination with CRIP or TMOF peptides can contribute more than at least 1% of each strain type to the composition.

[0531] We disclose compositions of Bt and ICK, Bt and TMOF peptides or Bt and ICK+TMOF peptides of claims 1-6 where the total concentration of Bt and ICK peptide, Bt and TMOF peptides or BT and ICK+TMOF peptides in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients. We disclose compositions wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide. We disclose compositions wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, wherein the ERSP is BAAS.

[0532] We disclose compositions wherein said combination of peptides is produced using a genetic cassette that further comprises a dipeptide operably linked to the insecticidal ICK and of TMOF peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal ICK peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide, including embodiments where the dipeptide is glycine-serine, including embodiments where the insecticidal ICK peptide is any insecticidal peptide that is a positive allosteric modulators of the nicotinic acetylcholine receptor, and may also be a dual antagonist to insect voltage-gated Ca.sup.2+ channels and voltage-gated K.sup.+ channels. See Chambers et al., Insecticidal spider toxins are high affinity positive allosteric modulators of the nicotinic acetylcholine receptor. FEBS Lett. 2019 June; 593(12):1336-1350; and Windley et al., Lethal effects of an insecticidal spider venom peptide involve positive allosteric modulation of insect nicotinic acetylcholine receptors. Neuropharmacology. 2017 December; 127:224-242, the disclosures of which are incorporated herein by reference in their entireties. Also included are embodiments where the insecticidal ICK peptide origins from any species of Australian Funnel-web spider, including embodiments where the spider is selected from the Australian Funnel-web spiders of genus Atrax or Hadronyche, including embodiments where the spider is selected from the Australian Funnel-web spiders of genus Hadronyche, including embodiments where the spider is selected from the Australian Blue Mountains Funnel-web, Hadronyche versuta, including embodiments where the insecticidal ICK peptide is Hybrid-ACTX-Hv1a, including embodiments where the insecticidal ICK peptide contains 20-100 amino acids and 2-4 disulfide bonds, including embodiments where said insecticidal ICK peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the ICK sequences disclosed herein, including embodiments where the insecticidal ICK peptide is selected from publications incorporated by reference, including embodiments where the Bt protein is any insecticidal Bt protein, including embodiments where the Bt protein is a Cry or Cyt protein, including embodiments where the Bt protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1, including embodiments where the Bt protein is selected from a Cry protein, a Cry1A protein or a Cry1F protein, including embodiments where the Bt protein is a combination Cry1F-Cry1A protein, including embodiments where the Bt protein comprises an amino acid sequence at least 90% identical to SEQ ID NOs: 10, 12, 14, 26, 28, or 34 of U.S. Pat. No. 7,304,206, including embodiments where the Bt Protein is Dipel, including embodiments where the Bt protein is Thuricide.

[0533] We disclose a composition comprising the nucleotides of: Bt (Bacillus thuringiensis) protein; and an insecticidal ICK (Inhibitor Cystine Knot) peptide, Bt and TMOF peptide or BT and ICK+TMOF peptides in a transformed plant or plant genome; where the ratio of Bt to ICK, Bt and TMOF peptides or BT and ICK+TMOF peptides, on a dry weight basis, is selected from about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values.

[0534] We disclose transformed plant or plant genome wherein the ratio of Bt to ICK, Bt and TMOF peptides or BT and ICK+TMOF peptides on a dry weight basis, is selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. The transformed plant or plant genome may have either or both of the Bt and ICK peptides are derived from more than 1 different type or bacterial strain origin of Bt or ICK peptides, or either or both of the Bt and ICK peptides are derived from between 2 and 5 different type or bacterial strain origin of either Bt or ICK peptides or both Bt and ICK peptides are derived from between 2 and 5 different types or strain origins, or either or both of the Bt and ICK peptides are derived from 2 to 15 different type or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides encoded by more than one copy of the Bt or ICK genes, or either or both of the Bt and ICK peptides are derived from more than one different type or bacterial strain origin of Bt and/or ICK peptides where all the strains of Bt and/or ICK peptides contribute more than at least 1% of each strain type to said composition, or either or both of the Bt and ICK peptides are derived from 2 to 5 different type or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides encoded by more than one copy of the Bt of ICK genes, or the total concentration of Bt and ICK peptide in the composition can be selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0535] The compositions and plants described herein include an insecticidal combination peptide produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, or to a TMOF peptide wherein said ERSP is linked at the N-terminal of the insecticidal ICK or TMOF peptide. In another embodiment the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, wherein the ERSP is BAAS. In another embodiment the transgenic plant incorporating and expressing the combination peptides from the nucleotides described herein, wherein said combination peptide is produced using a genetic cassette that further comprises nucleotides expressing a dipeptide operably linked to the insecticidal ICK or TMOF peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal ICK peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide. In another embodiment the transgenic plant has a dipeptide that is a glycine-serine. In another embodiment the transgenic plant has insecticidal ICK peptides expressed that are comprised of an insecticidal peptide combination of ICK and Bt proteins. The transgenic plants can have an insecticidal ICK peptide derived from any species of Australian Funnel-web spider, or the Australian Funnel-web spiders of genus Atrax or Hadronyche, and the Australian Blue Mountains Funnel-web, Hadronyche versuta.

[0536] We describe and claim a transgenic plant wherein the insecticidal ICK peptide expressed is Hybrid-ACTX-Hv1a, and or the insecticidal ICK peptide expressed may contain 20-100 amino acids and 2-4 disulfide bonds and or the insecticidal ICK peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the ICK peptides described herein. The transgenic plants disclosed can contain any known Bt protein, including peptides where the Bt protein is a Cry or Cyt protein, and/or the Bt protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1. The Bt protein can be selected from a Cry protein, a Cry1A protein or a Cry1F protein, or a combination Cry1F-Cry1A protein, or it comprises an amino acid sequence at least 90% identical to sequences 10, 12, 14, 26, 28, or 34 of U.S. Pat. No. 7,304,206. We describe a transgenic plant wherein the Bt protein is Dipel and we describe a transgenic plant wherein the Bt protein is Thuricide.

[0537] We specifically describe and claim a transformed plant expressing the peptides described herein where the average concentration of Bt and ICK peptide, Bt and TMOF peptides or BT and ICK+TMOF peptides, in an average leaf of a transformed plant is about: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values. We specifically describe and claim a transformed plant expressing properly folded toxic peptides in the transformed plant. We specifically describe and claim a transformed plant expressing properly folded combination toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase in the plant's yield or resistance to insect damage and they control insect pests in crops and forestry. We describe plants made by any of the products and processes described herein.

[0538] We describe expression cassettes comprising any of the nucleotides which express any peptides described herein, including embodiments having a functional expression cassette incorporated into a transformed plant, comprising nucleotides that code for any of the peptides disclosed herein or that could be made by one skilled in the art given the teaching disclosed herein. We describe and claim procedures for the generation of transformed plants having or expressing any of the peptides described herein.

[0539] We describe the use of any of the peptides or nucleotides described herein, to make a plant or transform these peptides or nucleotides into a plant, and methods and techniques for generating these proteins in plants and/or expression cassettes comprising any of the peptides and methods to transform them into a plant genome and any method of using, making, transforming any of the described peptides or nucleotides into a plant and methods and techniques for generating transformed plants having or expressing any of the peptides and functional expression cassettes in plants comprising any of the disclosed peptides and their corresponding nucleotides and any plants made by the products and processes described herein.

[0540] In some embodiments we disclose a chimeric gene comprising a promoter active in plants operatively linked to the nucleic acids or expression cassettes as described herein. We disclose a method of making, producing, or using the combination of genes described herein. We disclose a recombinant vector comprising the combination of genes described herein. We disclose a method of making, producing, or using the recombinant vector. We disclose a transgenic host cell comprising the combination of genes described herein and the method of making, producing or using the transgenic host cell, which can be a transgenic plant cell and we disclose a method of making, producing or using such a transgenic plant cell as well as the transgenic plant comprising the transgenic plant cell and how to make and use the transgenic plant. We disclose transgenic plant and seed having the properties described herein that is derived from corn, soybean, cotton, rice, sorghum, switchgrass, sugarcane, alfalfa, potatoes or tomatoes. The transgenic seed may have a chimeric gene that we describe herein. We describe methods of making, producing or using the transgenic plant and or seed of this disclosure.

[0541] We also describe methods of using the invention and provide novel formulations. The invention is most useful to control insects. We describe a method of controlling an insect comprising: Applying Bt (Bacillus thuringiensis) protein to said insect; and Applying an insecticidal ICK (Inhibitor Cystine Knot) peptide to said insect. This method may be used where the Bt protein and the insecticidal ICK peptide, Bt and TMOF peptides or BT and ICK+TMOF peptides are applied together at the same time in the same compositions or separately in different compositions and at different times. The Bt protein and the insecticidal ICK peptide, and or TMOF peptide may be applied sequentially, and it may be applied to (Bt protein)-resistant insects. The ratio of Bt to ICK or TMOF, on a dry weight basis, can be selected from at least about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. The ratio of Bt to ICK, on a dry weight basis, can be selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. Either or both of the Bt and ICK peptides are derived from more than 1 different types or bacterial strain origins of Bt and ICK peptides, Bt and TMOF peptides or BT and ICK+TMOF peptides. Either or both of the Bt and ICK, Bt and TMOF peptides or BT and ICK+TMOF peptides are derived from between 2 and 5 different types or bacterial strain origins of either Bt or ICK peptides or both Bt and ICK peptides. Either or both of the Bt and ICK peptides are derived from 2 to 15 different types or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides are encoded by more than one copy of the Bt or ICK genes. Either one or both of the Bt and ICK peptides are derived from more than 1 different types or bacterial strain origins of Bt and/or ICK peptides with all the strains of Bt and/or ICK peptides contributing more than at least 1% of the peptides from each strain type in said composition. Either or both of the Bt and ICK peptides are derived from 2 to 5 different types or bacterial strain origins of either one or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides are encoded by more than one copy of the Bt or ICK genes. The total concentration of Bt and ICK, Bt and TMOF peptides or BT and ICK+TMOF peptides peptide in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0542] The methods can be used where the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, or TMOF peptide; wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide. In some embodiments the insecticidal combination peptides used are produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, wherein the ERSP is BAAS.

[0543] Any of the peptides and plants described herein can be used to control insects, their growth and damage, especially their damage to plants. The combination Bt protein and insecticidal ICK peptide can be applied by being sprayed on a plant, or the insect's locus, or the locus of a plant in need of protecting.

[0544] We also describe formulations comprising: Bt proteins; and an insecticidal ICK, and or an insecticidal TMOF peptide which can include any of the compositions described herein or capable of being made by one skilled in the art given this disclosure. Some of the described formulations include the use of a polar aprotic solvent, and or water, and or where the polar aprotic solvent is present in an amount of 1-99 wt %, the polar protic solvent is present in an amount of 1-99 wt %, and the water is present in an amount of 0-98 wt %. The formulations include formulations where the Bt protein is from the product Dipel and where the insecticidal ICK peptide is a hybrid-ACTX-Hv1a peptide. The polar aprotic solvent formulations are especially effective when they contain MSO. MSO is a methylated seed oil and surfactant blend that uses methyl esters of soya oil in amounts of between about 80 and 85 percent petroleum oil with 15 to 20 percent surfactant.

[0545] This disclosure provides numerous examples of suitable CRIP type peptides, ICK peptides, NON-ICK CRIP peptides, and TMOF peptides in addition to many type of PFIP type peptides such as Bt and VIP proteins and peptides, when combined, provide novel insecticidal products, and these may be referred to herein as combination peptides. Peptides suitable for use with this invention are described in this document, and specific examples are disclosed in the sequence listing. The peptides in the sequence listing are provided only as examples to illustrate the invention and to provide direction and meaning for one skilled in the art. It should be understood that the sequence listing does not provide a full and complete list of all CRIPS, ICKs, NON-ICK CRIPS, and TMOF not does it provide a full and complete list of all PFIPS. Insects may be treated with combination peptides applied directly, such as sprayed onto an insect or its locus, or the combination peptides can be applied indirectly, such as delivered in a transgenic plant. First we provide detailed written descriptions and examples of CRIP peptides like ICK (Section I), and these are also provided above. Then we provide detailed written descriptions and examples of TMOF peptide (Section II). Next we provide detailed written descriptions and examples of Bt proteins (Section III). It should be understood that the application provides these examples as a means to illustrate and not limit the bounds of the patent and the claimed invention. Any suitable Bt protein and ICK peptide or TMOF peptide could be combined in the manner described and result in an effective insecticide. After describing the ICK and Bt proteins, applicant describes various pesticide compositions (Section IV). Plant transformations using both ICK and Bt proteins are described (Section V). Descriptions and examples of CRIP and Bt Combinations (Section VI). TMOF and Bt proteins combinations are described (Section VII). We provide non limiting examples and descriptions of how the ICK and Bt proteins have been combined to produce a highly effective insecticide, with results and data provided herein.

[0546] Section I. The ICK Motif Peptides or ICK Peptides.

[0547] ICK motif, ICK motif protein, inhibitor cystine knot motif, Toxic insect ICK peptides or ICK peptides means a 16 to 60 amino acid peptide with at least 6 half-cystine core amino acids having three disulfide bridges, wherein the 3 disulfide bridges are covalent bonds and of the six half-cystine residues the covalent disulfide bonds are between the first and fourth, the second and fifth, and the third and sixth half-cystines, of the six core half-cystine amino acids starting from the N-terminal amino acid. The ICK motif also comprises a beta-hairpin secondary structure, normally composed of residues situated between the fourth and sixth core half-cystines of the motif, the hairpin being stabilized by the structural crosslinking provided by the motif s three disulfide bonds. Note that additional cysteine/cystine or half-cystine amino acids may be present within the inhibitor cystine knot motif.

[0548] This motif is common in peptides isolated from the venom of numerous species. Invertebrate species include spiders and scorpions, other examples are numerous, even snake venom has been known to have peptides having the ICK motif. Specific examples of insecticidal ICK peptides are the U peptides disclosed herein and in published patents and patent applications and its homologies, which have an origin from the venoms of Australian Funnel-web spiders. These proteins are also referred to as ACTX peptides from the Australian Blue Mountains Funnel-web Spider, but the procedures described herein are useful and may be applied to any protein with the ICK motif. The following documents are incorporated by reference in the United States in their entirety, are known to one skilled in the art, and have all been published.

[0549] Examples of peptide toxins with the ICK motif protein can be found in the following references. The N-type calcium channel blocker -Conotoxin was reviewed by Lew, M. J. et al. Structure-Function Relationships of -Conotoxin GVIA Journal of Biological Chemistry, Vol. 272, No. 18, Issue of May 2, pp. 12014-12023, 1997. A summary of numerous arthropod toxic ICK peptides different spider and scorpion species was reviewed in, Quintero-Hernandez, V. et al. Scorpion and Spider Venom Peptides: Gene Cloning and Peptide Expression Toxicon, 58, pp. 644-663, 2011. The three-dimensional structure of Hanatoxin1 using NMR spectroscopy was identified as an inhibitor cystine knot motif in Takahashi, H. et al. Solution structure of hanatoxin1, a gating modifier of voltage-dependent K+ channels: common surface features of gating modifier toxins Journal of Molecular Biology, Volume 297, Issue 3, 31 Mar. 2000, pp. 771-780. The isolation and identification of cDNA encoding a scorpion venom ICK toxin peptide, Opicalcine1, was published by Zhu, S. et al. Evolutionary origin of inhibitor cystine knot peptides FASEB J., 2003 Sep. 17, (12):1765-7, Epub 2003 Jul. 3. The sequence-specific assignment and the secondary structure identification of BgK, a K+ channel-blocking toxin from the sea anemone Bunodosoma granulifera, was disclosed by Dauplais, M. et al. On the convergent evolution of animal toxins Journal of Biological Chemistry. 1997 Feb. 14; 272(7): 4302-9. A review of the composition and pharmacology of spider venoms with emphasis on polypeptide toxin structure, mode of action, and molecular evolution showing cystine bridges, cystine knot formations and the knotting-type fold was published by Escoubas, P. et al. Structure and pharmacology of spider venom neurotoxins Biochimie, Vol. 82, Issues 9-10, 10 Sep. 2000, pp. 893-907. The purified peptide, iberiotoxin, an inhibitor of the Ca2+-activated K+ channel, from scorpion (Buthus tamulus) venom was disclosed in Galvez, A. et al. Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus Journal of Biological Chemistry, 1990 Jul. 5; 265(19): 11083-90. The purified peptide, charybdotoxin, an inhibitor of the Ca2+-activated K+ channel, from the venom of the scorpion Leiurus quinquestriatus was disclosed in Gimenez-Gallego, G. et al. Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium-activated potassium channels Proc Natl Acad Sci, 1988 May; 85(10): 3329-3333. From these and other publications, one skilled in the art should be able to readily identify proteins and peptides having what we describe as the ICK motif, ICK motif protein or the inhibitor cystine knot motif.

[0550] The ICK motif protein can be any protein with the ICK motif and is between 16 and 60 amino acids in length, with at least 6 cysteine residues that create covalent cross-linking disulfide bonds in the proper order. Some ICK motif peptides have between 26-60 amino acids in length. Some ICK motif proteins are between 16-48 amino acids in length. Some ICK motif proteins are between 26-48 amino acids in length. Some ICK motif proteins are between 30-44 amino acids in length. ICK motif proteins with natural insecticidal activity are preferred but ICK motif proteins with other types of activity such as salt and frost resistance are known to those skilled in the art and are claimed herein. Examples of insecticidal ICK motif proteins include the ACTX peptides and genes, and including all of the peptides and their coding genes known as Magi6.

[0551] Examples of insecticidal ICK motif proteins include the ACTX peptides and genes and include all of the peptides and their coding genes as described in the references provided above and herein. Specific examples of ICK motif proteins and peptides disclosed for purposes of providing examples and not intended to be limiting in any way, are the peptides and their homologies as described above, and in particular peptides and nucleotides which originate from the venoms of Australian Funnel-web spiders. The following documents are incorporated by reference in the United States in their entirety, are known to one skilled in the art, and have all been published. They disclose numerous ICK motif proteins which, their full peptide sequence, their full nucleotide sequence, are specifically disclosed and are incorporated by reference, and in addition the full disclosures are incorporated by reference including all of their sequence listings. Their sequence listings are known and published. See the following: U.S. Pat. No. 7,354,993 B2, issued Apr. 8, 2008, specifically the peptide and nucleotide sequences listed in the sequence listing, and numbered SEQ ID NOs: 33-71, from U.S. Pat. No. 7,354,993 B2, and those named U-ACTX polypeptides, and these and other toxins that can form 2 to 4 intra-chain disulfide bridges, and variants thereof, and the peptides appearing on columns 4 to 9 and in FIG. 2 of U.S. Pat. No. 7,354,993 B2. Other specific sequences can be found in EP patent 1 812 464 B1, published and granted Aug. 10, 2008, see Bulletin 2008/41, specifically the peptide and nucleotide sequences listed in the sequence listing, and other toxins that can form 2 to 4 intra-chain disulfide bridges, and those sequences numbered SEQ ID NOs: 33-71, and sequences named U-ACTX polypeptides, and variants thereof, and the peptides appearing in paragraphs 0023 to 0055, and appearing in EP patent 1 812 464 B1, see FIG. 1 of EP 1 812 464 B1.

[0552] Described and incorporated by reference in order to disclose the peptides identified herein are homologous variants of sequences mentioned, having homology to such sequences or referred to herein, which are also identified and claimed as suitable for making special according to the processes described herein, including all homologous sequences having at least any of the following percent identities to any of the sequences disclosed here or to any sequence incorporated by reference: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater identity or 100% identity to any and all sequences identified in the patents noted above, and to any other sequence identified herein, including each and every sequence in the sequence listing of this application. When the term homologous or homology is used herein with a number such as 50% or greater, then what is meant is percent identity or percent similarity between the two peptides. When homologous or homology is used without a numeric percent then it refers to two peptide sequences that are closely related in the evolutionary or developmental aspect in that they share common physical and functional aspects, like topical toxicity and similar size (i.e., the homolog being within 100% greater length or 50% shorter length of the peptide specifically mentioned herein or identified by reference herein as above).

[0553] Described and incorporated by reference to describe the peptides identified herein are toxic ICK peptides including the following: the U peptide and its variants; found in, isolated from, or derived from, spiders of the genus Atrax or Hadronyche, including the genus species, Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, Atrax infensus, including toxins known as U-ACTX polypeptides, U-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, or mutants or variants, especially peptides of any of these types and especially those less than about 200 amino acids but greater than about 10 amino acids, and especially peptides less than about 150 amino acids but greater than about 20 amino acids, especially peptides less than about 100 amino acids but greater than about 25 amino acids, especially peptides less than about 65 amino acids but greater than about 25 amino acids, especially peptides less than about 55 amino acids but greater than about 25 amino acids, especially peptides of about 37 or 39 or about 36 to 42 amino acids, especially peptides with less than about 55 amino acids but greater than about 25 amino acids, especially peptides with less than about 45 amino acids but greater than about 35 amino acids, especially peptides with less than about 115 amino acids but greater than about 75 amino acids, especially peptides with less than about 105 amino acids but greater than about 85 amino acids, especially peptides with less than about 100 amino acids but greater than about 90 amino acids, including peptide toxins of any of the lengths mentioned here that can form 2, 3 and or 4 or more intrachain disulfide bridges, including toxins that disrupt calcium channel currents, including toxins that disrupt potassium channel currents, especially toxins that disrupt insect calcium channels or Us thereof, especially toxins or variants thereof of any of these types, and any combination of any of the types of toxins described herein that have oral or topical insecticidal activity, can be made special by the processes described herein.

[0554] The U peptides from the Australian Funnel Web Spider, genus Atrax and Hadronyche are particularly suitable and work well when placed in combination according to the methods, procedures or processes described by this invention. Examples of such suitable peptides tested and with data are provided herein. The following species are also specifically known to carry toxic ICK peptides suitable for being made special by the process of this invention. The following species are specifically named: Atrax formidabillis, Atrax infensus, Atrax robustus, Hadronyche infensa, Hadronyche versuta. Any toxic ICK peptides derived from any of the genus listed above and/or genus species and homologous to the U peptide are suitable for being made special according to the process in this invention.

[0555] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.

[0556] As noted above, many peptides are suitable candidates for combinations with Bt protein. The sequences noted above, below and in the sequence listing are especially suitable peptides that can be made special, and some of these have been made special according to this invention with the results shown in the examples below.

[0557] Examples of toxic ICK insect peptides are well known and can be found in numerous references. They can be identified by their peptidic nature and their activity, usually oral or injection insecticidal activity. Here we provide a few examples to better illustrate and describe the invention, but the invention is not limited to these examples. All of these examples and others not shown here are descriptive of new materials, described and claimed here for the first time.

[0558] Toxic ICK insect peptides are peptides of greater than 5 amino acid residues and less than 3,000 amino acid residues. They range in molecular weight from about 550 Da to about 350,000 Da. Toxic ICK insect peptides have some type of insecticidal activity. Typically they show activity when injected into insects but most do not have significant activity when applied to an insect topically. The insecticidal activity of toxic ICK insect peptides is measured in a variety of ways. Common methods of measurement are widely known to those skilled in the art. Such methods include, but are not limited to determination of median response doses (e.g., LD.sub.50, PD.sub.50, LC.sub.50, ED.sub.50) by fitting of dose-response plots based on scoring various parameters such as: paralysis, mortality, failure to gain weight, etc. Measurements can be made for cohorts of insects exposed to various doses of the insecticidal formulation in question. Analysis of the data can be made by creating curves defined by probit analysis and/or the Hill Equation, etc. In such cases, doses would be administered by hypodermic injection, by hyperbaric infusion, by presentation of the insecticidal formulation as part of a sample of food or bait, etc.

[0559] Toxic ICK insect peptides or ICK peptides are defined here as all peptides shown to be insecticidal upon delivery to insects either by hypodermic injection, hyperbaric infusion, or upon per os delivery to an insect (i.e., by ingestion as part of a sample of food presented to the insect). This class of peptides thus comprises, but is not limited to, many peptides produced naturally as components of the venoms of spiders, mites, scorpions, snakes, snails, etc. This class also comprises, but is not limited to, various peptides produced by plants (e.g., various lectins, ribosome inactivating proteins, and cysteine proteases), and various peptides produced by entomopathogenic microbes (e.g. the Cry1/Bt protein family of proteins produced by various Bacillus species.)

[0560] The insecticidal peptides may be selected from insecticidal venom, for example the venom of a spider. The spider may be an Australian funnel web spider. The peptides from may be from the genus of Atrax or Hadronyche, including U-ACTX-Hv1a and its analogs. Specific peptide examples from spiders are described in the sequence listing provided herein. These peptides can be combined with Bt protein using the procedures described herein.

[0561] ICK Peptide Sequence Examples

[0562] The following documents are incorporated by reference in the US in their entirety, in other jurisdictions where allowed and they are of common knowledge given their publication. In addition they are incorporated by reference and known specifically for their sequence listings to the extent they describe peptide sequences. See the following:

[0563] US Patents:

[0564] U.S. Pat. No. 5,763,568, issued Jun. 9, 1998, incorporated herein in its entirety, specifically the sequences in the sequence listing, and those numbered 33-58, and those known as kappa or omega toxins, including those that can form 2-4 intrachain disulphide bridges, and the peptides appearing on columns 2 and 4, and Table 5, and in FIG. 5, FIG. 15, FIG. 16, FIG. 17, FIG. 18.

[0565] U.S. Pat. No. 5,959,182, issued Sep. 28, 1999, incorporated herein in its entirety, specifically the sequences in the sequence listing, and those numbered 33-58 and those known as kappa or omega toxins, including toxins that can form 2-4 intrachain disulphide bridges, and the peptides appearing on columns 2 and 4, and Table 5, and in FIG. 5, FIG. 15, FIG. 16, FIG. 17, FIG. 18.

[0566] U.S. Pat. No. 6,583,264 B2, issued Jun. 24, 2003, and U.S. Pat. No. 7,173,106 B2, issued Feb. 6, 2007, incorporated herein in its entirety, specifically sequence number 1, named omega-atracotoxin-Hv2a or -atracotoxin-Hv2a, including toxins that can form 2-4 intrachain disulphide bridges.

[0567] U.S. Pat. No. 7,279,547 B2, issued Oct. 9, 2007, incorporated herein in its entirety, specifically the sequences in the sequence listing, and those numbered 33-67, and variants of co-atracotoxin-Hv2a, toxins that can form 2-4 intrachain disulphide bridges, and the peptides appearing on columns 4-8 of the specification, and in FIG. 3 and FIG. 4.

[0568] U.S. Pat. No. 7,354,993 B2, issued Apr. 8, 2008, incorporated herein in its entirety, specifically the peptide sequences listed in the sequence listing, and those numbered 33-71, and those named U-ACTX polypeptides, toxins that can form 2-4 intrachain disulphide bridges, and variants thereof, and the peptides appearing on columns 4-9 of the specification and in FIG. 1.

[0569] EP patent 1 812 464 B1, published and granted Aug. 10, 2008 Bulletin 2008/41, incorporated herein in its entirety, specifically the peptide sequences listed in the sequence listing, toxins that can form 2-4 intrachain disulphide bridges, and those as numbered 33-71, and those named U-ACTX polypeptides, and variants thereof, and the peptides appearing in paragraphs 0023 to 0055, and appearing in FIG. 1.

[0570] Described and incorporated by reference to the peptides identified herein are homologous variants of sequences mentioned, have homology to such sequences or referred to herein which are also identified and claimed as suitable for making special according to the processes described herein including but not limited to all homologous sequences including homologous sequences having at least any of the following percent identities to any of the sequences disclosed her or to any sequence incorporated by reference: 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% or greater identity to any and all sequences identified in the patents noted above, and to any other sequence identified herein, including each and every sequence in the sequence listing of this application. When the term homologous or homology is used herein with a number such as 30% or greater then what is meant is percent identity or percent similarity between the two peptides. When homologous or homology is used without a numeric percent then it refers to two peptide sequences that are closely related in the evolutionary or developmental aspect in that they share common physical and functional aspects like topical toxicity and similar size within 100% greater length or 50% shorter length or peptide.

[0571] Described and incorporated by reference to the peptides identified herein that are derived from any source mentioned in the US and EP patent documents referred to above, including but not limited to the following: toxins isolated from plants and insects, especially toxins from spiders, scorpions and plants that prey on or defend themselves from insects, such as, funnel web spiders and especially Australian funnel web spiders, including toxins found in, isolated from or derived from the genus Atrax or Hadronyche, including the genus species, Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, Atrax infensus including toxins known as atracotoxins, co-atracotoxins, kappa atracotoxins, omega atracotoxins also known as -atracotoxin, U-ACTX polypeptides, U-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, or mutants or variants, especially peptides of any of these types and especially those less than about 200 amino acids but greater than about 10 amino acids, and especially peptides less than about 150 amino acids but greater than about 20 amino acids, especially peptides less than about 100 amino acids but greater than about 25 amino acids, especially peptides less than about 65 amino acids but greater than about 25 amino acids, especially peptides less than about 55 amino acids but greater than about 25 amino acids, especially peptides of about 37 or 39 or about 36 to 42 amino acids, especially peptides with less than about 55 amino acids but greater than about 25 amino acids, especially peptides with less than about 45 amino acids but greater than about 35 amino acids, especially peptides with less than about 115 amino acids but greater than about 75 amino acids, especially peptides with less than about 105 amino acids but greater than about 85 amino acids, especially peptides with less than about 100 amino acids but greater than about 90 amino acids, including peptide toxins of any of the lengths mentioned here that can form 2, 3 and or 4 or more intrachain disulphide bridges, including toxins that disrupt calcium channel currents, including toxins that disrupt potassium channel currents, especially insect calcium channels or hybrids thereof, especially toxins or variants thereof of any of these types, and any combination of any of the types of toxins described herein that have topical insecticidal activity, can be made special by the processes described herein.

[0572] Venomous peptides from the Australian Funnel Web Spider, genus Atrax and Hadronyche are particularly suitable and work well when treated by the methods, procedures or processes described by this invention. These spider peptides, like many other toxic ICK peptides, including especially are toxic scorpion and toxic plant peptides, become topically active or toxic when treated by the processes described by this invention. Examples of suitable peptides tested and resulting data are provided herein. In addition to the organisms mentioned above, the following species are also specifically know to carry toxins suitable for being made special by the process of this invention. The following species are specifically named: Agelenopsis aperta, Androctonus australis Hector, Antrax formidabillis, Antrax infensus, Atrax robustus, Bacillus thuringiensis, Bothus martensii Karsch, Bothus occitanus tunetanus, Buthacus arenicola, Buthotus judaicus, Buthus occitanus mardochei, Centruroides noxius, Centruroides suffusus suffusus, Hadronyche infensa, Hadronyche versuta, Hadronyche versutus, Hololena curta, Hottentotta judaica, Leiurus quinquestriatus, Leiurus quinquestriatus hebraeus, Leiurus quinquestriatus quinquestriatus, Oldenlandia affinis, Scorpio maurus palmatus, Tityus serrulatus, Tityus zulianu. Any peptidic toxins from any of the genus listed above and or genus species are suitable for being made special according to the process in this invention.

[0573] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.

[0574] As noted above, many peptides are suitable candidates as the subject of the process to make special. The sequences noted above, below and in the sequence listing are especially suitable peptides that can be made special, and many of these have been made special according to this invention with the results shown in the examples below.

[0575] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.

[0576] As noted above, many peptides are suitable candidates as the subject of the process for the plant expression as PIP. The sequences noted above, below and in the sequence listing are especially suitable peptides that can be expressed in plants as PEP, and some of these have been expressed in plants as PEP according to this invention with the results shown in the examples below.

TABLE-US-00035 (onelettercode). SEQIDNO:1042 GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0577] Named U+2-ACTX-Hv1a, It has disulfide bridges at positions: 5-20, 12-25, 19-39. The molecular weight is 4564.85 Daltons.

[0578] Another example of an ICK motif insecticidal protein is SEQ ID NO: 1010.

TABLE-US-00036 (onelettercode) SEQIDNO:661 QYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA

[0579] SEQ ID NO: 661, named Hybrid-ACTX-Hv1a, has disulfide bridges at positions: 3-18, 10-23, 17-37. The molecular weight is 4426.84 Daltons.

TABLE-US-00037 (onelettercode) SEQIDNO:593 SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (threelettercode) SEQIDNO:593 SerProThrCysIleProSerGlyGlnProCysPro TyrAsnGluAsnCysCysSerGlnSerCysThrPhe LysGluAsnGluAsnGlyAsnThrValLysArgCys Asp

[0580] Named -ACTX-Hv1a it has disulfide bridges at positions: 4-18, 11-22 and 17-36. The molecular weight is 4096.

TABLE-US-00038 (onelettercode) SEQIDNO:650 GSSPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (threelettercode) SEQIDNO:650 GlySerSerProThrCysIleProSerGlyGlnPro CysProTyrAsnGluAsnCysCysSerGlnSerCys ThrPheLysGluAsnGluAsnGlyAsnThrValLys ArgCysAsp

[0581] Named -ACTX-Hv1a+2 it has disulfide bridges at positions: 6-20, 13-24 and 19-38. The molecular weight is 4199.

TABLE-US-00039 (onelettercode) SEQIDNO:651 GSAICTGADRPCAACCPCCPGTSCKAESNGVSYCRKDEP (threelettercode) SEQIDNO:651 GlySerAlaIleCysThrGlyAlaAspArgProCys AlaAlaCysCysProCysCysProGlyThrSerCys LysAlaGluSerAsnGlyValSerTyrCysArgLys AspGluPro

[0582] Named r-ACTX-Hv1c it has disulfide bridges at positions: 5-19, 12-24, 15-16, 18-34. The molecular weight is 3912.15

TABLE-US-00040 (threelettercode) SEQIDNO:652 GlySerGlnTyrCysValProValAspGlnProCys SerLeuAsnThrGlnProCysCysAspAspAlaThr CysThrGlnGluArgAsnGluAsnGlyHisThrVal TyrTyrCysArgAla

[0583] Named rU-ACTX-Hv1a (Hybrid)+2 it has disulfide bridges at positions: 5-20, 12-25, 19-39. The molecular weight is 4570.51.

[0584] Other ICK peptides are provided in the sequence listing. SEQ ID NOs: 534-707 are ICK peptide sequences and include the kappa/omega toxins and the hybrid toxins. SEQ ID NO: 593 is omega-ACTX-Hv1a. SEQ ID NO: 661 is hybrid-ACTX-Hv1a or U-ACTX-Hv1a.

[0585] Section II. The TMOF Motif Peptides or TMOF Peptides.

[0586] TMOF motif, or TMOF proteins means trypsin modulating oostatic factor peptide. Numerous examples and variants are provided. SEQ ID NO: 708 is the wild type TMOF sequence. Other non-limiting variants are provided in SEQ. ID. NOs: 709-721. Other examples would be known or could be created by one skilled in the art.

[0587] Section III. Bt Proteins

[0588] Bt are the initials for a bacteria called Bacillus thuringiensis. The Bt bacteria produces a family of peptides that are toxic to many insects. The Bt toxic peptides are well known for their ability to produce parasporal crystalline protein inclusions (usually referred to as crystals) that fall under two major classes of toxins; cytolysins (Cyt) and crystal Bt proteins (Cry). Because the cloning and sequencing of the first crystal proteins genes in the early-1980s, may others have been characterized and are now classified according to the nomenclature of Crickmore et al. (1998). Generally Cyt proteins are toxic towards the insect orders Coleoptera (beetles) and Diptera (flies), and Cry proteins target Lepidopterans (moths and butterflies). Cry proteins bind to specific receptors on the membranes of mid-gut (epithelial) cells resulting in rupture of those cells. If a Cry protein cannot find a specific receptor on the epithelial cell to which it can bind, then it is not toxic. Bt strains can have different complements of Cyt and Cry proteins, thus defining their host ranges. The genes encoding many Cry proteins have been identified.

[0589] Currently there are four main pathotypes of insecticidal Bt parasporal peptides based on order specificity: Lepidotera-specific (Cry1, now Cry1), Coleoptera-specific (CryIII, now Cry3), Diptera-specific (CryIV, now Cry4, Cry10, Cry11; and CytA, now Cyt1A), and CryII (Now Cry2), the only family known at that time to have dual (Lepidoptera and Diptera) specificity. Cross-order activity is now apparent in many cases.

[0590] The nomenclature assigns holotype sequences a unique name which incorporates ranks based on the degree of divergence, with the boundaries between the primary (Arabic numeral), secondary (uppercase letter), and tertiary (lower case letter) rank representing approximately 95%, 78% and 45% identities. A fourth rank (another Arabic number) is used to indicate independent isolations of holotype toxin genes with sequences that are identical or differ only slightly. Currently, the nomenclature distinguishes 174 holotype sequences that are grouping in 55 cry and 2 cyt families (Crickmore, N., Zeigler, D. R., Schnepf, E., Van Rie, J., Lereclus, D., Daum, J, Bravo, A., Dean, D. H., B. thuringiensis toxin nomenclature). Any of these crystal proteins and the genes that produce them may be used to produce a suitable Bt related toxin for this invention.

[0591] Also included in the descriptions of this invention are families of highly related crystal proteins produced by other bacteria: Cry16 and Cry17 from Clostridium bifermentans (Barloy et al., 1996, 1998), Cry18 from Bacillus popilliae (Zhang et al., 1997), Cry43 from Paenibacillus lentimorbis (Yokoyama et al., 2004) and the binary Cry48/Cry49 produced by Bacillus sphaericus (Jones et al., 2008). Other crystalline or secreted pesticidal proteins, such as the S-layer proteins (Pea et al., 2006) that are included here are, genetically altered crystal proteins, except those that were modified through single amino acid substitutions (e.g., Lambert et al., 1996). Any of these genes may be used to produce a suitable Bt related toxin for this invention.

[0592] Examples of Bt

[0593] In particular, isolated nucleic acid molecules corresponding to Bt protein nucleic acid sequences are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for an isolated nucleic acid molecule comprising a nucleotide sequence encoding the amino acid sequence shown in US 2009/0099081, published on Apr. 18, 2009, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference. SEQ ID NOs: 9, 11, 13, 15, or 18, or a nucleotide sequence set forth in SEQ ID NOs: 1, 2, 4, 6, 7, 8, 10, 12, 14, 16, or 17, as well as variants and fragments thereof. Nucleotide sequences that are complementary to a nucleotide sequence of the invention, or that hybridize to a sequence of the invention are also encompassed.

[0594] Nucleotide sequences encoding the proteins of the present invention include the sequence set forth in US 2009/0099081, published on Apr. 18, 2009, SEQ ID NOs: 1, 2, 4, 6, 7, 8, 10, 12, 14, 16, or 17, and variants, fragments, and complements thereof. By complement is intended a nucleotide sequence that is sufficiently complementary to a given nucleotide sequence such that it can hybridize to the given nucleotide sequence to thereby form a stable duplex. The corresponding amino acid sequence for the Bt protein encoded by this nucleotide sequence are set forth in SEQ ID NOs: 33-533.

[0595] Nucleic acid molecules that are fragments of these Bt protein encoding nucleotide sequences are also encompassed by the present invention (for example, US 2009/0099081, published on Apr. 18, 2009, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference. SEQ ID NO: 8 is a fragment of SEQ ID NOs: 4 and 12; SEQ ID NO: 4 is a fragment of SEQ ID NO: 2). The term fragment is intended to mean a portion of the nucleotide sequence encoding a Bt protein. A fragment of a nucleotide sequence may encode a biologically active portion of a Bt protein, or it may be a fragment that can be used as a hybridization probe or PCR primer using methods disclosed below. Nucleic acid molecules that are fragments of a Bt protein nucleotide sequence comprise at least about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1860, 1870, 1880, 1885 contiguous nucleotides, or up to the number of nucleotides present in a full-length Bt-protein encoding nucleotide sequence disclosed herein (for example, 1890 nucleotides for US 2009/0099081, published on Apr. 18, 2009, Here these are provided as SEQ ID NO: 1 and 2, 1806 nucleotides for SEQ ID NO: 4, 1743 nucleotides for SEQ ID NOs: 6, 7, 8, and 16, 1809 nucleotides for SEQ ID NO: 10, and 1752 nucleotides for SEQ ID NOs: 12 and 14, in the sequence listing) depending upon the intended use. By contiguous nucleotides is intended nucleotide residues that are immediately adjacent to one another. Fragments of the nucleotide sequences of the present invention will encode protein fragments that retain the biological activity of the Bt protein and, hence, retain pesticidal activity. By retains activity is intended that the fragment will have at least about 30%, at least about 50%, at least about 70%, 80%, 90%, 95% or higher of the pesticidal activity of the Bt protein. Methods for measuring pesticidal activity are well known in the art. See, for example, Czapla and Lang (1990) J. Econ. Entomol. 83:2480-2485; Andrews et al. (1988) Biochem. J. 252:199-206; Marrone et al. (1985) J. of Economic Entomology 78:290-293; and U.S. Pat. No. 5,743,477, all of which are herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference.

[0596] A fragment of a Bt protein encoding nucleotide sequence that encodes a biologically active portion of a protein of the invention will encode at least about 15, 25, 30, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 560, 570, 575, 580, 585, 590, 595, 600 contiguous amino acids, or up to the total number of amino acids present in a full-length Bt protein of the invention (for example, 580 amino acids for SEQ ID NO: 41, 602 amino acids for SEQ ID NO: 43, and 583 amino acids for SEQ ID NOs: 45 and 47).

[0597] Preferred Bt protein proteins of the present invention are encoded by a nucleotide sequence sufficiently identical to the nucleotide sequence of US 2009/0099081, published on Apr. 18, 2009, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference, sequences 1, 2, 4, 6, 7, 8, 10, 12, 14, 16, or 17. By sufficiently identical is intended an amino acid or nucleotide sequence that has at least about 60% or 65% sequence identity, about 70% or 75% sequence identity, about 80% or 85% sequence identity, about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity compared to a reference sequence using one of the alignment programs described herein using standard parameters. One of skill in the art will recognize that these values can be appropriately adjusted to determine corresponding identity of proteins encoded by two nucleotide sequences by taking into account codon degeneracy, amino acid similarity, reading frame positioning, and the like.

[0598] The invention also encompasses variant nucleic acid molecules (for example, US 2009/0099081, published on Apr. 18, 2009, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference, sequence 2 is a variant of sequences 1; sequence 7 and 8 are variants of sequences 6; sequence 10 is a variant of sequence 4 and 12; and sequence 14 is a variant of sequence 12). Variants of the Bt protein encoding nucleotide sequences include those sequences that encode the Bt protein disclosed herein but that differ conservatively because of the degeneracy of the genetic code as well as those that are sufficiently identical as discussed above.

[0599] Naturally occurring allelic variants can be identified with the use of well-known molecular biology techniques, such as polymerase chain reaction (PCR) and hybridization techniques as outlined below. Variant nucleotide sequences also include synthetically derived nucleotide sequences that have been generated, for example, by using site-directed mutagenesis but which still encode the Bt protein proteins disclosed in the present invention as discussed below. Variant proteins encompassed by the present invention are biologically active, that is they continue to possess the desired biological activity of the native protein, i.e., retaining pesticidal activity. By retains activity is intended that the variant will have at least about 30%, at least about 50%, at least about 70%, or at least about 80% of the pesticidal activity of the native protein. Methods for measuring pesticidal activity are well known in the art. See, for example, Czapla and Lang (1990) J. Econ. Entomol. 83: 2480-2485; Andrews et al. (1988) Biochem. J. 252:199-206; Marrone et al. (1985) J. of Economic Entomology 78:290-293; and U.S. Pat. No. 5,743,477, all of which are herein incorporated by reference in their entirety, and all sequences identified by number specifically incorporated by reference.

[0600] Examples of the Generation of Synthetic and Variant Bt Genes

[0601] In one aspect of the invention, synthetic axmi-004 sequences were generated, for example synaxmi-004 US 2009/0099081, published on Apr. 18, 2009, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference, (sequence 1) and synaxmi-004B (sequence 2). These synthetic sequences have an altered DNA sequence relative to the axmi-004 sequence (sequence 3) recited in U.S. Pat. No. 7,355,099, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference), and encode the original AXMI-004 protein. Likewise, synaxmi-004B-2M (sequence 4) was designated and encodes the axmi-004 alternate start site (herein referred to as axmi-004B-2M and set forth in sequence 5) originally identified in U.S. patent application Ser. No. 10/782,020.

[0602] In another aspect of the invention, a third start site was identified in the axmi-004 coding sequence. This coding region is designated axmi-004B-3M (US 2009/0099081, published on Apr. 18, 2009, all of which is herein incorporated by reference in its entirety, and all sequences identified by number specifically incorporated by reference, sequence 16) and encodes the AXMI-004B-3M amino acid sequence set forth in sequence 9. Synthetic sequences encoding the AXMI-004B-3M protein were also designated. These synthetic nucleotide sequences were designated synaxmi-004B-3M, synaxmi-004C-3M, and synaxmi-004D-3M and are set forth in sequences 6, 7, and 8, respectively. In another aspect of the invention, modified versions of the nucleotide sequence encoding AXMI-004B-3M protein were designed such that additional N-terminal residues are added to the encoded protein. These sequence are designated synaxmi-004B-3M-alt1 (US 2009/0099081, published on Apr. 18, 2009, sequence 10), synaxmi-004B-3M-alt2 (sequence 12), synaxmi-004B-3M-alt3 (sequence 14), and synaxmi-004B-3M-alt4 (sequence 17). The encoded proteins are designated AXMI-004B-3M-ALT1 (sequence 11), AXMI-004B-3M-ALT2 (sequence 13), AXMI-004B-3M-ALT3 (sequence 15), and AXMI-004B-3M-ALT4 (sequence 18).

[0603] Other Bt proteins and gene descriptions can be found in the following. Each and every patent publication referred to below with a note as to the Bt toxin to which the publication refers to, is hereby incorporated by reference in its entirely. These documents have also published and they and their sequences are in the public domain.

[0604] More Examples of Bt genes, proteins, and the patent documents that describe them are found in Tables 4, 5, and 6 below. The patent documents in Tables 4, 5, 6, in particular the US patents and US applications, are hereby incorporated by reference in their entirety.

TABLE-US-00041 TABLE 4 Bt Toxins Toxin Patents or Patent Publication Number Cry1 U.S. 2003046726, U.S. Pat. No. 6,833,449, CN1260397, U.S. 201026939, U.S. 2006174372, U.S. 2006174372, U.S. 642241, U.S. Pat. No. 6,229,004, U.S. 2004194165, U.S. Pat. No. 6,573,240, U.S. Pat. No. 5,424,409, U.S. Pat. No. 5,407,825, U.S. Pat. No. 5,135,867, U.S. Pat. No. 5,055,294, Cry1 WO2007107302, U.S. Pat. No. 6,855,873, WO2004020636, U.S. 2007061919, U.S. Pat. No. 6,048,839, U.S. 2007061919, AU784649B, U.S. 2007061919, U.S. Pat. No. 6,150,589, U.S. Pat. No. 5,679,343, U.S. Pat. No. 5,616,319, U.S. Pat. No. 5,322,687, Cry1 WO2007107302, U.S. 2006174372, U.S. 2005091714, U.S. 2004058860, U.S. 2008020968, U.S. Pat. No. 6,043,415, U.S. Pat. No. 5,942,664, Cry1 WO2007107302, U.S. 2007061919, U.S. Pat. No. 6,172,281, Cry1 WO03082910, MX9606262, U.S. Pat. No. 5,530,195, U.S. Pat. No. 5,407,825, U.S. Pat. No. 5,045,469, Cry1 U.S. 2006174372, Cry1 U.S. 2007061919, Cry1 U.S. 2007061919, Cry1 U.S. 2007061919, CN1401772, U.S. Pat. No. 6,063,605, Cry1 U.S. 2007061919, AU784649B, U.S. Pat. No. 5,723,758, U.S. Pat. No. 5,616,319, U.S. Pat. No. 5,356,623, U.S. Pat. No. 5,322,687 Cry1 U.S. Pat. No. 5,723,758 Cry2 CN1942582, WO9840490, U.S. 2007061919, UA75570, MXPA03006130, U.S. 2003167517, U.S. Pat. No. 6,107,278, U.S. Pat. No. 6,096,708, U.S. Pat. No. 5,073,632, U.S. Pat. No. 7,208,474, U.S. Pat. No. 7,244,880, Cry3 U.S. 2002152496, RU2278161, U.S. 2003054391, Cry3 U.S. Pat. No. 5,837,237, U.S. Pat. No. 5,723,756, U.S. Pat. No. 5,683,691, U.S. Pat. No. 5,104,974, U.S. Pat. No. 4,996,155, Cry3 U.S. Pat. No. 5,837,237, U.S. Pat. No. 5,723,756, Cry5 WO9840491, U.S. 2004018982, U.S. Pat. No. 6,166,195, U.S. 2001010932, U.S. Pat. No. 5,985,831, U.S. Pat. No. 5,824,792, U.S. 528153 Cry5 WO2007062064, U.S. 2001010932, U.S. Pat. No. 5,824,792, Cry6 WO2007062064, U.S. 2004018982, U.S. Pat. No. 5,973,231, U.S. Pat. No. 5,874,288, U.S. Pat. No. 5,236,843, U.S. 683106 Cry6 U.S. 2004018982, U.S. Pat. No. 6,166,195, Cry7 U.S. Pat. No. 6,048,839, U.S. Pat. No. 5,683,691, U.S. Pat. No. 5,378,625, U.S. 518709 Cry7 CN195215 Cry8 Cry8 Cry8 U.S. 200301796 Cry8 WO2006053473, U.S. 2007245430, Cry8 WO200605347 Cry9 U.S. 2007061919, Cry9 WO200506620 Cry9 U.S. 2007061919, U.S. Pat. No. 6,448,226, U.S. 2005097635, WO2005066202, U.S. Pat. No. 6,143,550, U.S. Pat. No. 6,028,246, U.S. Pat. No. 6,727,409, Cry9 U.S. 2005097635, WO2005066202, Cry9 U.S. Pat. No. 6,570,005, Cry9 AU784649B, U.S. 2007074308, U.S. 736180 Cry11 MXPA0200870 Cry12 U.S. 2004018982, U.S. Pat. No. 6,166,195, U.S. Pat. No. 6,077,937, U.S. Pat. No. 5,824,792, U.S. Pat. No. 5,753,492, Cry13 U.S. 2004018982, U.S. 6,166,195, U.S. Pat. No. 6,077,937, U.S. Pat. No. 5,824,792, U.S. Pat. No. 5,753,492, Cry14 JP2007006895, U.S. Pat. No. 5,831,011, Cry21 U.S. Pat. No. 5,831,011, U.S. Pat. No. 5,670,365, Cry22 U.S. 2006218666, U.S. 2001010932, MXPA01004361, U.S. Pat. No. 5,824,792, Cry22 U.S. 2003229919, Cry23 U.S. 2006051822, U.S. 2003144192, UA75317, U.S. Pat. No. 6,399,330, U.S. Pat. No. 6,326,351, U.S. Pat. No. 6,949,626, Cry26 U.S. 200315001 Cry28 U.S. 200315001 Cry31 CA2410153, Cry34 U.S. 200316752 Cry35 U.S. 2003167522, Cry37 U.S. 2006051822, U.S. 2003144192, UA75317, U.S. 6,399,330, U.S. 6,326,351, U.S. Pat. No. 6,949,626, Cry43 U.S. 200527164 Cyt1 WO2007027776, Cyt1 U.S. 6150165, Cyt2 U.S. 2007163000, EP1681351, U.S. Pat. No. 6,686,452, U.S. Pat. No. 6,537,756,

TABLE-US-00042 TABLE 5 Hybrid Insecticidal Crystal Proteins and Patents. Patents.sup.a Holotype Toxin.sup.b U.S. 2008020967 Cry29Aa U.S. 2008040827 Cry1Ca U.S. 2007245430 Cry8Aa U.S. 2008016596 Cry8Aa U.S. 2008020968 Cry1Cb

TABLE-US-00043 TABLE 6 Patents Relating to Other Hybrid Insecticidal Crystal Proteins Source toxins.sup.a Patents.sup.b Cry1A, Cry1C U.S. Pat. No. 5,593,881, U.S. Pat. No. 5,932,209 Cry1C, Cry1A, Cry1F U.S. Pat. No. 6,962,705, U.S. Pat. No. 7,250,501, U. S. 2004093637, WO0114562, WO0214517, U.S. Pat. No. 6,156,573 Cry23A, Cry37A U.S. Pat. No. 7,214,788 Cry1A U.S. Pat. No. 7,019,197 Cry1A, Cry1B U.S. Pat. No. 6,320,100 Cry1A, Cry1C AU2001285900B Cry23A, Cry37A U.S. 2007208168 Cry3A, Cry1I, Cry1B WO0134811 Cry3A, Cry3B, Cry3C U.S. 2004033523 Cry1A, Cry1C, Cry1E, U.S. Pat. No. 6,780,408 Cry1G Cry1A, Cry1F U.S. 2008047034

[0605] The sequence listing includes Bt sequences SEQ. ID. NOs: 33-533. These sequences include examples of Bt protein Cry and Cyt protein sequences. Examples are numerous and one skilled in the art would know of many other examples of various Bt sequences that are suitable substitutes for those in this disclosure.

[0606] Section IV. Pesticide Compositions and Increasing Plant Yields

[0607] The active ingredients of the present invention are normally applied in the form of compositions and can be applied to the crop area or plant to be treated, simultaneously or in succession, with other compounds. These compounds can be fertilizers, weed killers, cryoprotectants, surfactants, detergents, pesticidal soaps, dormant oils, polymers, and/or time-release or biodegradable carrier formulations that permit long-term dosing of a target area following a single application of the formulation. They can also be selective herbicides, chemical insecticides, virucides, microbicides, amoebicides, pesticides, fungicides, bacteriocides, nematocides, molluscicides or mixtures of several of these preparations, if desired, together with further agriculturally acceptable carriers, surfactants or application-promoting adjuvants customarily employed in the art of formulation. Suitable carriers and adjuvants can be solid or liquid and correspond to the substances ordinarily employed in formulation technology, e.g. natural or regenerated mineral substances, solvents, dispersants, wetting agents, tackifiers, binders or fertilizers. Likewise the formulations may be prepared into edible baits or fashioned into pest traps to permit feeding or ingestion by a target pest of the pesticidal formulation.

[0608] Methods of applying an active ingredient of the present invention or an agrochemical composition of the present invention that contains at least one of the pesticidal proteins produced by the bacterial strains of the present invention include leaf application, seed coating and soil application. The number of applications and the rate of application depend on the intensity of infestation by the corresponding pest.

[0609] The composition may be formulated as a powder, dust, pellet, granule, spray, emulsion, colloid, solution, or such like, and may be prepared by such conventional means as desiccation, lyophilization, homogenation, extraction, filtration, centrifugation, sedimentation, or concentration of a culture of cells comprising the polypeptide. In all such compositions that contain at least one such pesticidal polypeptide, the polypeptide may be present in a concentration of from about 1% to about 99% by weight.

[0610] Lepidopteran or coleopteran pests may be killed or reduced in numbers in a given area by the methods of the invention, or may be prophylactically applied to an environmental area to prevent infestation by a susceptible pest. Preferably the pest ingests, or is contacted with, a pesticidally-effective amount of the polypeptide. By pesticidally-effective amount is intended an amount of the pesticide that is able to bring about death to at least one pest, or to noticeably reduce pest growth, feeding, or normal physiological development. This amount will vary depending on such factors as, for example, the specific target pests to be controlled, the specific environment, location, plant, crop, or agricultural site to be treated, the environmental conditions, and the method, rate, concentration, stability, and quantity of application of the pesticidally-effective polypeptide composition. The formulations may also vary with respect to climatic conditions, environmental considerations, and/or frequency of application and/or severity of pest infestation.

[0611] The pesticide compositions described may be made by formulating either the bacterial cell, crystal and/or spore suspension, or isolated protein component with the desired agriculturally-acceptable carrier. The compositions may be formulated prior to administration in an appropriate means such as lyophilized, freeze-dried, desiccated, or in an aqueous carrier, medium or suitable diluent, such as saline or other buffer. The formulated compositions may be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), or water or oil/water emulsions, or as a wettable powder, or in combination with any other carrier material suitable for agricultural application. Suitable agricultural carriers can be solid or liquid and are well known in the art. The term agriculturally-acceptable carrier covers all adjuvants, inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in pesticide formulation technology; these are well known to those skilled in pesticide formulation. The formulations may be mixed with one or more solid or liquid adjuvants and prepared by various means, e.g., by homogeneously mixing, blending and/or grinding the pesticidal composition with suitable adjuvants using conventional formulation techniques. Suitable formulations and application methods are described in U.S. Pat. No. 6,468,523, herein incorporated by reference.

[0612] Methods for Increasing Plant Yield

[0613] Methods for increasing plant yield are provided. The methods comprise introducing into a plant or plant cell a polynucleotide comprising a pesticidal sequence disclosed herein. As defined herein, the yield of the plant refers to the quality and/or quantity of biomass produced by the plant. By biomass is intended any measured plant product. An increase in biomass production is any improvement in the yield of the measured plant product. Increasing plant yield has several commercial applications. For example, increasing plant leaf biomass may increase the yield of leafy vegetables for human or animal consumption. Additionally, increasing leaf biomass can be used to increase production of plant-derived pharmaceutical or industrial products. An increase in yield can comprise any statistically significant increase including, but not limited to, at least a 1% increase, at least a 3% increase, at least a 5% increase, at least a 10% increase, at least a 20% increase, at least a 30%, at least a 50%, at least a 70%, at least a 100% or a greater increase in yield compared to a plant not expressing the pesticidal sequence.

[0614] In specific methods, plant yield is increased as a result of improved pest resistance of a plant expressing a pesticidal protein disclosed herein. Expression of the pesticidal protein results in a reduced ability of a pest to infest or feed on the plant, thus improving plant yield.

[0615] Section V. Plant Transformations

[0616] Any combination of the principal components ICK motif protein and or TMOF motif protein and Bt protein, can be combined in a PIP. We also disclose the addition of ERSP (Endoplasmic Reticulum Signal Peptide) and a translational stabilizing protein and intervening linker in order to create a superior PIP (Plant-incorporated protectant) and expressed as a PEP (Plant Expressed Peptide) as long as a minimum of both Bt and ICK motif protein are used, it is preferred to use these two peptides in combination with ERSP. TMOF motif can also be used with or replacing the ICK motif. These compositions can be created, used as a PEP and expressed as a PIP.

[0617] We describe methods to increase the efficacy of the plant expression, to increase the accumulation of plant expressed proteins and to dramatically increase the insecticidal activity of plant expressed proteins. We describe targeting of the ICK motif protein to the Endoplasmic Reticulum (ER) by an Endoplasmic Reticulum Signaling Protein (ERSP) in plants, in order to provide for the correct covalent cross-linking of peptide disulfide bridges which generate the essential tertiary ICK motif structure required for insecticidal activity. We further describe targeting of the ICK motif protein to the ER by an ERSP in plants, with a translational stabilizing protein domain added in order to increase the size of the resulting ICK fusion protein which enhances peptide accumulation in the plant. We further describe targeting of the ICK motif protein to the ER by an ERSP in plants, with a translation stabilizing protein added as above, and with an intervening peptide sequence added, the latter of which allows for potential cleavage and the recovery of the active form of the ICK motif protein having insecticidal activity.

[0618] This invention describes the ICK motif proteins with insecticidal activity that are plant expressed and which can successfully protect a plant or crop from insect damage. The methods taught herein will enable peptides to not only be expressed in a plant but to be expressed and folded properly, so that they retain their insecticidal activity even after expression in the plant

[0619] We describe how the open reading frame (ORF) of a target peptide, such as an ICK motif peptide, must be modified in order for the desired biological activity to remain after plant expression of the ICK motif peptide. In one embodiment we describe a Plant Incorporated Protectant, or PIP, that expresses an active insecticidal protein. The PIP insecticidal protein is comprised of an Endoplasmic Reticulum Signal Peptide (ERSP) operably linked to a Cysteine Rich Insecticidal Peptide (CRIP) or Inhibitor Cystine knot (ICK) motif protein, wherein the ERSP is the N-terminal of the linked ERSP+ICK motif protein. The PIP insecticidal protein is then incorporated into a plant of choice to give insect resistance to the plant. The plant cells will express and accumulate the properly folded ICK motif insecticidal protein. When an insect consumes the plant cells, the properly folded ICK motif insecticidal protein will be delivered inside the insect where it will have insecticidal activity and cause the insect either to slow or to stop its feeding, slow its movements, and slow or stop reproduction, all of which provides protection for the plant from insect damage.

[0620] We describe transient expression systems to express various plant expression cassettes. One expressed transgene we use is Green Fluorescent Protein or GFP, which is detectable visually when excited by UV light. The GFP transient expression system we used for the evaluation of plant transgenic proteins is for all practical purposesequivalent to use of a stable transgenic plant system for these types of evaluations.

[0621] The CRIP, ICK, TMOF, Sea Anemone Motif can be Linked to the ERSP.

[0622] For the ICK motif insecticidal protein to be properly folded when it is expressed from a transgenic plant, it must have an ERSP fused in frame with the ICK motif insecticidal protein. This can also be done with a TMOF motif. This can be accomplished in several ways. See FIGS. 1, 2 and 3. The protein should be routed through the ER where the correct covalent bond connections for proper disulfide bond formation are formed. Without wishing to be bound by theory, we believe the ER routing results in the correct tertiary structure of the ICK motif protein. It is commonly postulated that such routing is achieved by a cellular component called a signal-recognition particle: the signal-recognition particle binds to the ribosome translating the protein, it pauses translation, and it transports the ribosome/mRNA complex to a translocator pore in the ER, where the ribosome then continues the translation and threads the resulting protein into the ER. Within the ER the ERSP is cleaved and the protein is acted upon by posttranslational modification processes in the ER. Once such process involves protein disulfide isomerases, a class of proteins that catalyze the formation of disulfide bonds. Without any additional retention protein signals, the protein is transported through the ER to the golgi apparatus, where it is finally secreted outside the plasma membrane and into the apoplastic space. Without wishing to be bound by theory, we think proteins, such as insecticidal proteins, that have an ICK motif, need to be routed through the ER, in order for the proteins to have correct disulfide bond formation, if they are expressed in plants.

[0623] The ERSP (Endoplasmic Reticulum Signaling Protein).

[0624] In addition to the text below, see Part I-1 (The EERSP or ersp component of the PEPs.

[0625] The ERSP is the N-terminal region of the ERSP+ICK motif protein complex and the ERSP portion is composed of about 3 to 60 amino acids. In some embodiments it is 5 to 50 amino acids. In some embodiments it is 10 to 40 amino acids but most often is composed of 15 to 20; 20 to 25; or 25 to 30 amino acids. The ERSP is a signal peptide so called because it directs the transport of a protein. Signal peptides may also be called targeting signals, signal sequences, transit peptides, or localization signals. The signal peptides for ER targeting are often 15 to 30 amino acid residues in length and have a tripartite organization, comprised of a core of hydrophobic residues flanked by a positively charged aminoterminal and a polar, but uncharged carboxyterminal region. See Zimmermann, Richard; Eyrisch, Susanne; Ahmad, Mazen and Helms, Volkhard: Protein translocation across the ER membrane Biochimica et Biohysica Acta 1808 (2011) 912-924, Elsevier.

[0626] About half and often more of the ERSP is usually comprised of hydrophobic amino acids, but the percentage of amino acids in an ERSP that are hydrophobic can vary. Without wishing to be bound by any theory of how the invention works, we think the hydrophobic amino acids stick in the membrane of the ER after translation and this allows the signal peptide peptidase to cleave the ERSP off of the translated protein, releasing the ICK motif protein into the ER. Many ERSPs are known. Many plant ERSPs are known. It is NOT required that the ERSP be derived from a plant ERSP, non-plant ERSPs will work with the procedures described herein. Many plant ERSPs are however well known and we describe some plant derived ERSPs here. BAAS, for example, is derived from the plant, Hordeum vulgare.

[0627] One example of a ERSP used here is BAAS, the sequence of BAAS is MANKH LSLSL FLVLL GLSAS LASG (SEQ ID NO: 1035, one letter code)

[0628] This peptide, named BAAS is cleaved from the ICK motif upon the protein's translation into the ER. The molecular weight is 2442.94 Daltons. FIGS. 1-3 show a representation of an ICK motif protein linked to an ERSP. These figures could equally represent a TMOF motif protein linked to an ERSP.

[0629] Plant ERSPs, which are selected from the genomic sequence for proteins that are known to be expressed and released into the apoplastic space of plants, and a few examples are BAAS, carrot extensin, tobacco PR1. The following references provide further descriptions, and are incorporated by reference herein in their entirety. De Loose, M. et al. The extension signal peptide allows secretion of a heterologous protein from protoplasts Gene, 99 (1991) 95-100. De Loose, M. et al. described the structural analysis of an extensin-encoding gene from Nicotiana plumbaginifolia, the sequence of which contains a typical signal peptide for translocation of the protein to the endoplasmic reticulum. Chen, M. H. et al. Signal peptide-dependent targeting of a rice alpha-amylase and cargo proteins to plastids and extracellular compartments of plant cells Plant Physiology, 2004 July; 135(3): 1367-77. Epub 2004 Jul. 2. Chen, M. H. et al. studied the subcellular localization of -amylases in plant cells by analyzing the expression of -amylase, with and without its signal peptide, in transgenic tobacco. These references and others teach and disclose translational stabilizing proteins that can be used in the methods, procedures and peptide, protein and nucleotide complexes and constructs described herein.

[0630] The Translational Stabilizing Protein.

[0631] In addition to the text below, see Part I-III (The translational stabilizing protein component, STA or sta.

[0632] The procedures described above refer to providing a ERSP+CRIP where ERSP+CRIP could be ERSP+ICK, ERSP+Non-ICK, ERSP+Av (SEA ANOMONE) or the procedures could refer to ERSP+TMOF, or they could refer to ERSP+CRIP and a TMOF sufficient to make a plant produce properly folded peptides. We also suggest that in order to more fully protect a plant from some insects, more than just proper folding is sometimes needed. With a properly constructed expression cassette, a plant can be induced to make and accumulate even greater amounts of toxic peptide. When a plant accumulates greater amounts of properly folded toxic CRIP or TMOF peptides it can more easily resist or kill the insects that attack and eat the plants. One way to increase the insecticidal activity of the PIP is with translational stabilizing proteins. The translational stabilizing protein can be used to significantly increase the accumulation of the toxic peptide in the plant and thus the potency of the PIP, especially when the PIP has a translational stabilizing protein of its own. The procedures described herein can provide for the accumulation in the plant of large amounts of the now properly folded transgenic plant proteins. Transgenic plants expressing both an ICK motif insecticidal protein and a translational stabilizing protein, demonstrate dramatically improved accumulation of toxic ICK peptides over systems without a translational stabilizing protein. Representative PIPs with a translational stabilizing protein are described herein.

[0633] Experiments comparing plant expressed peptides both with and without a translational stabilizing protein show dramatic differences. The protein expression of an ICK-motif protein without a translational stabilizing protein can be very low. When a translational stabilizing protein is fused to the ICK-motif protein, there are higher levels of detectable accumulation. The translational stabilizing protein can be a domain of another protein or it can comprise an entire protein sequence. The translational stabilizing protein is a protein with sufficient tertiary structure that it can accumulate in a cell without being targeted by the cellular process of protein degradation. The protein can be between 5 and 50 amino acids (e.g., another ICK-motif protein), 50 to 250 amino acids (GNA), 250 to 750 amino acids (e.g., chitinase) and 750 to 1500 amino acids (e.g., enhancin).

[0634] The translational stabilizing protein, (or protein domain) can contain proteins that have no useful characteristics other than translation stabilization, or they can have other useful traits in addition to translational stabilization. One embodiment of the translation stabilization protein can be multiple ICK-motif proteins in tandem. Useful traits can include: additional insecticidal activity, such as activity that is destructive to the peritrophic membrane, activity that is destructive to the gut wall, and/or activity that actively transports the ICK motif protein across the gut wall. One embodiment of the translational stabilizing protein can be a polymer of fusions proteins involving ICK motif proteins. One embodiment of the translational stabilizing protein can be a polymer of fusions proteins involving TMOF motif proteins. A specific example of a translational stabilizing protein is provided here to illustrate the use of a translational stabilizing protein. The example is not intended to limit the disclosure or claims in any way. Useful translational stabilizing proteins are well known in the art, and any proteins of this type could be used as disclosed herein. Procedures for evaluating and testing production of peptides are both known in the art and described herein. One example of one translational stabilizing protein is SEQ ID NO: 1036, one letter code, as follows:

TABLE-US-00044 (onelettercode). SEQIDNO:1036 ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG KLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNG IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

[0635] SEQ ID NO: 1036 is Named GFP. The molecular weight is 26736.02 Daltons.

[0636] Additional examples of translational stabilizing proteins can be found in the following references, incorporated by reference in their entirety: Kramer, K. J. et al. Sequence of a cDNA and expression of the gene encoding epidermal and gut chitinases of Manduca sexta Insect Biochemistry and Molecular Biology, Vol. 23, Issue 6, September 1993, pp. 691-701. Kramer, K. J. et al. isolated and sequenced a chitinase-encoding cDNA from the tobacco hornworm, Manduca sexta. Hashimoto, Y. et al. Location and nucleotide sequence of the gene encoding the viral enhancing factor of the Trichoplusia ni granulosis virus Journal of General Virology, (1991), 72, 2645-2651. Hashimoto, Y. et al. cloned the gene encoding the viral enhancing factor of a Trichoplusia ni granulosis virus and determined the complete nucleotide sequence. Van Damme, E. J. M. et al. Biosynthesis, primary structure and molecular cloning of snowdrop (Galanthus nivalis L.) lectin European Journal of Biochemistry, 202, 23-30 (1991). Van Damme, E. J. M. et al. isolated Poly(A)-rich RNA from ripening ovaries of snowdrop lectin, yielding a single 17-kDa lectin polypeptide upon translation in a wheat-germ cell-free system. These references and others teach and disclose translational stabilizing proteins that can be used in the methods, procedures and peptide, protein and nucleotide complexes and constructs described herein.

[0637] The Intervening Linker

[0638] In addition to the text below, see Part I-IV (The Intervening Linker Peptide component, LINKER, linker, L or if polynucleotide; linker or 1 of the PEPs

[0639] This invention also incorporates an intervening linker between ICK motif protein and the translational stabilizing protein. The intervening linker is between 1 and 30 amino acids. It can have either no cleavage sites or a protease cleavage site specific to serine-, threonine-, cysteine-, and aspartate proteases or metalloproteases. The cleavable linker can be the point of digestion by proteases found in the lepidopteran gut environment and/or the lepidopteran hemolymph environment. An example of the additional component to illustrate this invention is listed below, but it is not limited to this example.

[0640] The example for an intervening linker is IGER (SEQ ID NO: 1037)

[0641] Named IGER The molecular weight of this intervening linker is 473.53 Daltons.

[0642] Other examples of intervening linkers can be found in the following references, which are incorporated by reference herein in their entirety: A comparison of the folding behavior of green fluorescent proteins through six different linkers is explored in Chang, H. C. et al. De novo folding of GFP fusion proteins: high efficiency in eukaryotes but not in bacteria Journal of Molecular Biology, 2005 Oct. 21; 353(2): 397-409. An isoform of the human GalNAc-Ts family, GalNAc-T2, was shown to retain its localization and functionality upon expression in N. benthamiana plants by Daskalova, S. M. et al. Engineering of N. benthamiana L. plants for production of N-acetylgalactosamine-glycosylated proteins BMC Biotechnology, 2010 Aug. 24; 10: 62. The ability of endogenous plastid proteins to travel through stromules was shown in Kwok, E. Y. et al. GFP-labelled Rubisco and aspartate aminotransferase are present in plastid stromules and traffic between plastids Journal of Experimental Botany, 2004 March; 55(397): 595-604. Epub 2004 Jan. 30. A report on the engineering of the surface of the tobacco mosaic virus (TMV), virion, with a mosquito decapeptide hormone, trypsin-modulating oostatic factor (TMOF) was made by Borovsky, D. et al. Expression of Aedes trypsin-modulating oostatic factor on the virion of TMV: A potential larvicide Proc Natl Acad Sci, 2006 Dec. 12; 103(50): 18963-18968. These references and others teach and disclose translational stabilizing proteins that can be used in the methods, procedures and peptide, protein and nucleotide complexes and constructs described herein.

[0643] Other Plant Transformations are More Well Known.

[0644] Methods of the invention involve introducing a nucleotide construct into a plant. By introducing is intended to present to the plant the nucleotide construct in such a manner that the construct gains access to the interior of a cell of the plant. The methods of the invention do not require that a particular method for introducing a nucleotide construct to a plant is used, only that the nucleotide construct gains access to the interior of at least one cell of the plant. Methods for introducing nucleotide constructs into plants are known in the art including, but not limited to, stable transformation methods, transient transformation methods, and virus-mediated methods.

[0645] By plant is intended whole plants, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same. Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and/or pollen).

[0646] Transgenic plants or transformed plants or stably transformed plants or cells or tissues refers to plants that have incorporated or integrated exogenous nucleic acid sequences or DNA fragments into the plant cell. These nucleic acid sequences include those that are exogenous, or not present in the untransformed plant cell, as well as those that may be endogenous, or present in the untransformed plant cell. Heterologous generally refers to the nucleic acid sequences that are not endogenous to the cell or part of the native genome in which they are present, and have been added to the cell by infection, transfection, microinjection, electroporation, microprojection, or the like.

[0647] Transformation of plant cells can be accomplished by one of several techniques known in the art. The Bt-protein gene of the invention may be modified to obtain or enhance expression in plant cells. Typically a construct that expresses such a protein would contain a promoter to drive transcription of the gene, as well as a 3 untranslated region to allow transcription termination and polyadenylation. The organization of such constructs is well known in the art. In some instances, it may be useful to engineer the gene such that the resulting peptide is secreted, or otherwise targeted within the plant cell. For example, the gene can be engineered to contain a signal peptide to facilitate transfer of the peptide to the endoplasmic reticulum. It may also be preferable to engineer the plant expression cassette to contain an intron, such that mRNA processing of the intron is required for expression.

[0648] Typically this plant expression cassette will be inserted into a plant transformation vector. This plant transformation vector may be comprised of one or more DNA vectors needed for achieving plant transformation. For example, it is a common practice in the art to utilize plant transformation vectors that are comprised of more than one contiguous DNA segment. These vectors are often referred to in the art as binary vectors. Binary vectors as well as vectors with helper plasmids are most often used for Agrobacterium-mediated transformation, where the size and complexity of DNA segments needed to achieve efficient transformation is quite large, and it is advantageous to separate functions onto separate DNA molecules. Binary vectors typically contain a plasmid vector that contains the cis-acting sequences required for T-DNA transfer (such as left border and right border), a selectable marker that is engineered to be capable of expression in a plant cell, and a gene of interest (a gene engineered to be capable of expression in a plant cell for which generation of transgenic plants is desired). Also present on this plasmid vector are sequences required for bacterial replication. The cis-acting sequences are arranged in a fashion to allow efficient transfer into plant cells and expression therein. For example, the selectable marker gene and the Bt-protein are located between the left and right borders. Often a second plasmid vector contains the trans-acting factors that mediate T-DNA transfer from Agrobacterium to plant cells. This plasmid often contains the virulence functions (Vir genes) that allow infection of plant cells by Agrobacterium, and transfer of DNA by cleavage at border sequences and vir-mediated DNA transfer, as is understood in the art (Hellens and Mullineaux (2000) Trends in Plant Science 5:446-451). Several types of Agrobacterium strains (e.g. LBA4404, GV3101, EHA101, EHA105, etc.) can be used for plant transformation. The second plasmid vector is not necessary for transforming the plants by other methods such as microprojection, microinjection, electroporation, polyethylene glycol, etc.

[0649] In general, plant transformation methods involve transferring heterologous DNA into target plant cells (e.g. immature or mature embryos, suspension cultures, undifferentiated callus, protoplasts, etc.), followed by applying a maximum threshold level of appropriate selection (depending on the selectable marker gene) to recover the transformed plant cells from a group of untransformed cell mass. Explants are typically transferred to a fresh supply of the same medium and cultured routinely. Subsequently, the transformed cells are differentiated into shoots after placing on regeneration medium supplemented with a maximum threshold level of selecting agent. The shoots are then transferred to a selective rooting medium for recovering rooted shoot or plantlet. The transgenic plantlet then grows into a mature plant and produces fertile seeds (e.g. Hiei et al. (1994) The Plant Journal 6:271-282; Ishida et al. (1996) Nature Biotechnology 14:745-750). Explants are typically transferred to a fresh supply of the same medium and cultured routinely. A general description of the techniques and methods for generating transgenic plants are found in Ayres and Park (1994) Critical Reviews in Plant Science 13:219-239 and Bommineni and Jauhar (1997) Maydica 42:107-120. Since the transformed material contains many cells; both transformed and non-transformed cells are present in any piece of subjected target callus or tissue or group of cells. The ability to kill non-transformed cells and allow transformed cells to proliferate results in transformed plant cultures. Often, the ability to remove non-transformed cells is a limitation to rapid recovery of transformed plant cells and successful generation of transgenic plants.

[0650] Transformation protocols as well as protocols for introducing nucleotide sequences into plants may vary depending on the type of plant or plant cell, i.e., monocot or dicot, targeted for transformation. Generation of transgenic plants may be performed by one of several methods, including, but not limited to, microinjection, electroporation, direct gene transfer, introduction of heterologous DNA by Agrobacterium into plant cells (Agrobacterium-mediated transformation), bombardment of plant cells with heterologous foreign DNA adhered to particles, ballistic particle acceleration, aerosol beam transformation (U.S. Published Application No. 20010026941; U.S. Pat. No. 4,945,050; International Publication No. WO 91/00915; U.S. Published Application No. 2002015066), Lecl transformation, and various other non-particle direct-mediated methods to transfer DNA.

[0651] Methods for transformation of chloroplasts are known in the art. See, for example, Svab et al. (1990) Proc. Natl. Acad. Sci. USA 87:8526-8530; Svab and Maliga (1993) Proc. Natl. Acad. Sci. USA 90:913-917; Svab and Maliga (1993) EMBO J. 12:601-606. The method relies on particle gun delivery of DNA containing a selectable marker and targeting of the DNA to the plastid genome through homologous recombination. Additionally, plastid transformation can be accomplished by transactivation of a silent plastid-borne transgene by tissue-preferred expression of a nuclear-encoded and plastid-directed RNA polymerase. Such a system has been reported in McBride et al. (1994) Proc. Natl. Acad. Sci. USA 91:7301-7305.

[0652] Following integration of heterologous foreign DNA into plant cells, one then applies a maximum threshold level of appropriate selection in the medium to kill the untransformed cells and separate and proliferate the putatively transformed cells that survive from this selection treatment by transferring regularly to a fresh medium. By continuous passage and challenge with appropriate selection, one identifies and proliferates the cells that are transformed with the plasmid vector. Molecular and biochemical methods can then be used to confirm the presence of the integrated heterologous gene of interest into the genome of the transgenic plant.

[0653] The cells that have been transformed may be grown into plants in accordance with conventional ways. See, for example, McCormick et al. (1986) Plant Cell Reports 5:81-84. These plants may then be grown, and either pollinated with the same transformed strain or different strains, and the resulting hybrid having constitutive expression of the desired phenotypic characteristic identified. Two or more generations may be grown to ensure that expression of the desired phenotypic characteristic is stably maintained and inherited and then seeds harvested to ensure expression of the desired phenotypic characteristic has been achieved. In this manner, the present invention provides transformed seed (also referred to as transgenic seed) having a nucleotide construct of the invention, for example, an expression cassette of the invention, stably incorporated into their genome.

[0654] ICK and TMOF Expression in Plants.

[0655] As noted above, there are many alternatives that could be used for the components of ERSP, ICK motif protein, TMOF motif, translational stabilizing protein and intervening linker.

[0656] Evaluation of Plant Transformations

[0657] Following introduction of heterologous foreign DNA into plant cells, the transformation or integration of heterologous gene in the plant genome is confirmed by various methods such as analysis of nucleic acids, proteins and metabolites associated with the integrated gene.

[0658] PCR analysis is a rapid method to screen transformed cells, tissue or shoots for the presence of incorporated gene at the earlier stage before transplanting into the soil (Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). PCR is carried out using oligonucleotide primers specific to the gene of interest or Agrobacterium vector background, etc.

[0659] Plant transformation may be confirmed by Southern blot analysis of genomic DNA (Sambrook and Russell, 2001, supra). In general, total DNA is extracted from the transformant, digested with appropriate restriction enzymes, fractionated in an agarose gel and transferred to a nitrocellulose or nylon membrane. The membrane or blot is then probed with, for example, radiolabeled .sup.32P target DNA fragment to confirm the integration of introduced gene into the plant genome according to standard techniques (Sambrook and Russell, 2001, supra).

[0660] In Northern blot analysis, RNA is isolated from specific tissues of transformant, fractionated in a formaldehyde agarose gel, and blotted onto a nylon filter according to standard procedures that are routinely used in the art (Sambrook and Russell, 2001, supra). Expression of RNA encoded by the Bt-protein is then tested by hybridizing the filter to a radioactive probe derived from a Bt-protein, by methods known in the art (Sambrook and Russell, 2001, supra).

[0661] Western blot, biochemical assays and the like may be carried out on the transgenic plants to confirm the presence of protein encoded by the Bt-protein gene by standard procedures (Sambrook and Russell, 2001, supra) using antibodies that bind to one or more epitopes present on the Bt-protein.

[0662] Pesticidal Activity in Plants

[0663] In another aspect of the invention, one may generate transgenic plants expressing a Bt-protein that has pesticidal activity. Methods described above by way of example may be utilized to generate transgenic plants, but the manner in which the transgenic plant cells are generated is not critical to this invention. Methods known or described in the art such as Agrobacterium-mediated transformation, biolistic transformation, and non-particle-mediated methods may be used. Plants expressing a Bt-protein may be isolated by common methods described in the art, for example by transformation of callus, selection of transformed callus, and regeneration of fertile plants from such transgenic callus. In such process, one may use any gene as a selectable marker so long as its expression in plant cells confers ability to identify or select for transformed cells.

[0664] A number of markers have been developed for use with plant cells, such as resistance to chloramphenicol, the aminoglycoside G418, hygromycin, or the like. Other genes that encode a product involved in chloroplast metabolism may also be used as selectable markers. For example, genes that provide resistance to plant herbicides such as glyphosate, bromoxynil, or imidazolinone may find particular use. Such genes have been reported (Stalker et al. (1985) J. Biol. Chem. 263:6310-6314 (bromoxynil resistance nitrilase gene); and Sathasivan et al. (1990) Nucl. Acids Res. 18:2188 (AHAS imidazolinone resistance gene). Additionally, the genes disclosed herein are useful as markers to assess transformation of bacterial or plant cells. Methods for detecting the presence of a transgene in a plant, plant organ (e.g., leaves, stems, roots, etc.), seed, plant cell, propagule, embryo or progeny of the same are well known in the art. In one embodiment, the presence of the transgene is detected by testing for pesticidal activity.

[0665] Fertile plants expressing a Bt-protein may be tested for pesticidal activity, and the plants showing optimal activity selected for further breeding. Methods are available in the art to assay for pest activity. Generally, the protein is mixed and used in feeding assays. See, for example Marrone et al. (1985) J. of Economic Entomology 78:290-293.

[0666] Section VI. Descriptions and Examples of CRIP and Bt Protein Combinations

[0667] The Bt and ICK peptides may inhibit the growth, impair the movement, or even kill an insect when the combination of toxin is appropriately delivered to the locus inhabited by the insect. SDP 1234604, 1234605 and 609 are spray-dried powder preparations of hybrid+2-ACTX-Hv1a peptide, here Hv1a peptide. The spray-dried Hv1a peptide powders are made from the peptide, various excipients and fermentation by-products. The '604 and '605 formulations use the same peptide, only the excipients are different. The concentration of the active hybrid peptide was quantified at about 26% weight/weight in both the '604 and '605 powders. The concentration of the active hybrid peptide was quantified at about 35% weight/weight in the 609 powders. The Hv1a peptide in each powder was quantified using a C18 rpHPLC methods known by those skilled in the art.

[0668] Inhibitory cysteine knot or ICK peptides can have remarkable stability when exposed to the environment. Many ICK peptides are isolated from venomous animals such as spiders, scorpions, and snakes. Bt proteins are well known because of their specific pesticidal activities. Surprisingly, we have found that, when Bt proteins are selectively mixed with ICK peptides, the combination of Bt and ICK peptides produces a highly effective insecticide with a potency much greater than expected.

[0669] We describe an insecticidal combination peptide composition comprising both a Bt (Bacillus thuringiensis) protein; and an insecticidal ICK (Inhibitor Cystine Knot) peptide. The composition can be in the ratio of Bt to ICK, on a dry weight basis, from about any or all of the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. We also describe a composition where the ratio of Bt to ICK, on a on a dry weight basis, is selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[0670] The procedures described herein can be applied to any PFIP or CRIP peptide. The combination of PFIP and CRIP peptides includes either or both of the PFIP and CRIP peptides being are derived from more than 1 different types or bacterial strain origins for either one or both of PFIP and CRIP peptides. By bacterial strain origins we mean the peptides can be described as having been expressed by a bacterial strain that expresses the peptides with the understanding that many PFIP peptides including many Bt proteins are also artificial in the sense that they are no longer all developed from bacterial strains.

[0671] In another embodiment the combination of PFIP and CRIP peptides includes either or both of the PFIP such as Bt in combination with ICK, Non-ICK and TMOF peptides being derived from more than 1 different types or bacterial strain origins for either one or both of Bt and ICK peptides. By bacterial strain origins we mean the peptides can be described as having been expressed by a bacterial strain that expresses the peptides with the understanding that many Bt proteins are also artificial in the sense that they are no longer all developed from bacterial strains.

[0672] We also disclose compositions where either or both of the PFIP such as Bt in combination with ICK, Non-ICK and TMOF peptides are derived from between 2 and 5, 2-15, 2-30, 5-10, 5-15, 5-30, 5-50 and various other different types or bacterial strains origins of either one or both of Bt or ICK peptides. We disclose a composition where either or both of the Bt and ICK peptides are encoded by from 2 to 15 different types or bacterial strain origins of either one or both of Bt and ICK peptides. And any of these combinations of 2-5, 2-15, 2-30, 5-10, 5-15, 5-30, 5-50 and various other different types and mixtures of Bt and ICK peptides can contribute more than at least 1% of each strain type to the composition.

[0673] We disclose composition of Bt and ICK peptides where the total concentration of PFIP such as Bt in combination with ICK, Non-ICK and TMOF peptides in the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients. We disclose compositions wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the ICK, Non-ICK and/or TMOF peptides insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide. We disclose compositions wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, wherein the ERSP is BAAS.

[0674] We disclose compositions wherein said combination peptide is produced using a genetic cassette that further comprises a dipeptide operably linked to the insecticidal ICK peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal ICK peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide, including embodiments where the dipeptide is glycine-serine, including embodiments where the insecticidal ICK peptide is any insecticidal peptide that inhibits both voltage-gated Calcium channels and Calcium-activated potassium channels in insects, including embodiments where the insecticidal ICK peptide origins from any species of Australian Funnel-web spider, including embodiments where the spider is selected from the Australian Funnel-web spiders of genus Atrax or Hadronyche, including embodiments where the spider is selected from the Australian Funnel-web spiders of genus Hadronyche, including embodiments where the spider is selected from the Australian Blue Mountains Funnel-web, Hadronyche versuta, including embodiments where the insecticidal ICK peptide is Hybrid-ACTX-Hv1a, including embodiments where the insecticidal ICK peptide contains 20-100 amino acids and 2-4 disulfide bonds, including embodiments where said insecticidal ICK peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the ICK sequences disclosed herein, including embodiments where the insecticidal ICK peptide is selected from publications incorporated by reference, including embodiments where the Bt protein is any insecticidal Bt protein, including embodiments where the Bt protein is a Cry or Cyt protein, including embodiments where the Bt protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1, including embodiments where the Bt Protein is selected from a Cry protein, a Cry1A protein or a Cry1F protein, including embodiments where the Bt protein is a combination Cry1F-Cry1A protein, including embodiments where the Bt protein comprises an amino acid sequence at least 90% identical to SEQ ID NOs: 10, 12, 14, 26, 28, or 34 of U.S. Pat. No. 7,304,206, including embodiments where the Bt Protein is Dipel, including embodiments where the Bt protein is Thuricide.

[0675] We disclose a composition comprising the nucleotides of: Bt (Bacillus thuringiensis) Protein; and an insecticidal ICK (Inhibitor Cystine Knot) protein, in a transformed plant or plant genome; where the ratio of Bt to ICK, on a dry weight basis, is selected from about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values.

[0676] We disclose transformed plant or plant genome wherein the ratio of PFIP such as Bt to ICK, Non-ICK and TMOF peptides; and preferably Bt to ICK, or Bt to an Anemone toxin, on a dry weight basis, is selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. The transformed plant or plant genome may have either or both of the Bt and ICK or Bt and Anemone proteins are derived from more than 1 different type or bacterial strain origin of Bt or ICK proteins, or either or both of the Bt and ICK proteins are derived from between 2 and 5 different type or bacterial strain origin of either Bt or ICK proteins or both Bt and ICK proteins are derived from between 2 and 5 different types or strain origins, or either or both of the Bt and ICK proteins are derived from 2 to 15 different type or bacterial strain origins of either or both of Bt and ICK proteins and at least one strain of either Bt or ICK or both Bt and ICK proteins encoded by more than one copy of the Bt or ICK genes, or either or both of the Bt and ICK proteins are derived from more than one different type or bacterial strain origin of Bt and/or ICK proteins where all the strains of Bt and/or ICK proteins contribute more than at least 1% of each strain type to said composition, or either or both of the Bt and ICK proteins are derived from 2 to 5 different type or bacterial strain origins of either or both of Bt and ICK proteins and at least one strain of either Bt or ICK or both Bt and ICK proteins encoded by more than one copy of the Bt of ICK genes, or the total concentration of Bt and ICK protein in the composition can be selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0677] The compositions and plants described herein include an insecticidal combination protein produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide. In another embodiment the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, wherein the ERSP is BAAS. In another embodiment the transgenic plant incorporating and expressing the combination peptides from the nucleotides described herein, wherein said combination peptide is produced using a genetic cassette that further comprises nucleotides expressing a dipeptide operably linked to the insecticidal ICK peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal ICK peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide. In another embodiment the transgenic plant has a dipeptide that glycine-serine. In another embodiment the transgenic plant has insecticidal ICK peptides expressed that are comprised of an insecticidal peptide combination of ICK and Bt proteins. The transgenic plants can have an insecticidal ICK peptide derived from any species of Australian Funnel-web spider, or the Australian Funnel-web spiders of genus Atrax or Hadronyche, and the Australian Blue Mountains Funnel-web, Hadronyche versuta.

[0678] We describe and claim a transgenic plant wherein the insecticidal ICK peptide expressed is Hybrid-ACTX-Hv1a, and or the insecticidal ICK peptide expressed may contain 20-100 amino acids and 2-4 disulfide bonds and or the insecticidal ICK peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the ICK peptides described herein. The transgenic plants disclosed can contain any known Bt protein, including peptides where the Bt protein is a Cry or Cyt protein, and/or the Bt protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1. The Bt protein can be selected from a Cry protein, a Cry1A protein or a Cry1F protein, or a combination Cry1F-Cry1A protein, or it comprises an amino acid sequence at least 90% identical to SEQ ID NOs: 10, 12, 14, 26, 28, or 34 of U.S. Pat. No. 7,304,206. We describe a transgenic plant wherein the Bt protein is Dipel and we describe a transgenic plant wherein the Bt protein is Thuricide.

[0679] We specifically describe and claim a transformed plant expressing the peptides described herein where the average concentration of Bt and ICK peptide, in an average leaf of a transformed plant is about: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values. We specifically describe and claim a transformed plant expressing properly folded toxic peptides in the transformed plant. We specifically describe and claim a transformed plant expressing properly folded combination toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase in the plant's yield or resistance to insect damage and they control insect pests in crops and forestry. We describe plants made by any of the products and processes described herein.

[0680] We describe expression cassettes comprising any of the nucleotides which express any peptides described herein, including embodiments having a functional expression cassette incorporated into a transformed plant, comprising nucleotides that code for any of the peptides disclosed herein or that could be made by one skilled in the art given the teaching disclosed herein. We describe and claim procedures for the generation of transformed plants having or expressing any of the peptides described herein.

[0681] We describe the use of any of the peptides or nucleotides described herein, to make a plant or transform these peptides or nucleotides into a plant, and methods and techniques for generating these proteins in plants and/or expression cassettes comprising any of the peptides and methods to transform them into a plant genome and any method of using, making, transforming any of the described peptides or nucleotides into a plant and methods and techniques for generating transformed plants having or expressing any of the peptides and functional expression cassettes in plants comprising any of the disclosed peptides and their corresponding nucleotides and any plants made by the products and processes described herein.

[0682] In some embodiments we disclose a chimeric gene comprising a promoter active in plants operatively linked to the nucleic acids or expression cassettes as described herein. We disclose a method of making, producing, or using the combination of genes described herein. We disclose a recombinant vector comprising the combination of genes described herein. We disclose a method of making, producing, or using the recombinant vector. We disclose a transgenic host cell comprising the combination of genes described herein and the method of making, producing or using the transgenic host cell, which can be a transgenic plant cell and we disclose a method of making, producing or using such a transgenic plant cell as well as the transgenic plant comprising the transgenic plant cell and how to make and use the transgenic plant. We disclose transgenic plant and seed having the properties described herein that is derived from corn, soybean, cotton, rice, sorghum, switchgrass, sugarcane, alfalfa, potatoes or tomatoes. The transgenic seed may have a chimeric gene that we describe herein. We describe methods of making, producing or using the transgenic plant and or seed of this disclosure.

[0683] We also describe methods of using the invention and provide novel formulations. The invention is most useful to control insects. We describe a method of controlling an insect comprising: Applying Bt (Bacillus thuringiensis) protein to said insect; and Applying an insecticidal ICK (Inhibitor Cystine Knot) peptide to said insect. This method may be used where the Bt protein and the insecticidal ICK peptide are applied together at the same time in the same compositions or separately in different compositions and at different times. The Bt protein and the insecticidal ICK peptide may be applied sequentially, and it may be applied to (Bt protein)-resistant insects. The ratio of Bt to ICK, on a dry weight basis, can be selected from at least about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. The ratio of Bt to ICK, on a dry weight basis, can be selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. Either or both of the Bt and ICK peptides are derived from more than 1 different types or bacterial strain origins of Bt and ICK peptides. Either or both of the Bt and ICK peptides are derived from between 2 and 5 different types or bacterial strain origins of either Bt or ICK peptides or both Bt and ICK peptides. Either or both of the Bt and ICK peptides are derived from 2 to 15 different types or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides are encoded by more than one copy of the Bt or ICK genes. Either one or both of the Bt and ICK peptides are derived from more than 1 different types or bacterial strain origins of Bt and/or ICK peptides with all the strains of Bt and/or ICK peptides contributing more than at least 1% of the peptides from each strain type in said composition. Either or both of the Bt and ICK peptides are derived from 2 to 5 different types or bacterial strain origins of either one or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides are encoded by more than one copy of the Bt or ICK genes. The total concentration of Bt and ICK peptide in the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0684] The methods can be used where the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide. In some embodiments the insecticidal combination peptides used are produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, wherein the ERSP is BAAS.

[0685] Any of the peptides and plants described herein can be used to control insects, their growth and damage, especially their damage to plants. The combination Bt Protein and insecticidal ICK peptide can be applied by being sprayed on a plant, or the insect's locus, or the locus of a plant in need of protecting.

[0686] We also describe formulations comprising: Bt Protein; and an insecticidal ICK peptide which can include any of the compositions described herein or capable of being made by one skilled in the art given this disclosure. Some of the described formulations include the use of a polar aprotic solvent, and or water, and or where the polar aprotic solvent is present in an amount of 1-99 wt %, the polar protic solvent is present in an amount of 1-99 wt %, and the water is present in an amount of 0-98 wt %. The formulations include formulations where the Bt protein is Dipel and where the insecticidal ICK peptide is a hybrid-ACTX-Hv1a peptide. The polar aprotic solvent formulations are especially effective when they contain MSO. The examples below are intended to illustrate and not limit the invention in any manner.

[0687] Section VII. Descriptions and Examples of TMOF and Bt Combinations

[0688] The Bt and TMOF peptides may inhibit the growth, impair the movement, or even kill an insect when the combination of toxin is appropriately delivered to the locus inhabited by the insect. The spray-dried powders are made from the peptide, various excipients and fermentation by-products.

[0689] We describe an insecticidal combination peptide composition comprising both a Bt (Bacillus thuringiensis) protein; and an insecticidal TMOF peptide. The composition can be in the ratio of Bt to TMOF, on a dry weight basis, from about any or all of the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. We also describe a composition where the ratio of Bt to TMOF, on a on a dry weight basis, is selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[0690] In another embodiment the combination of Bt and TMOF peptides includes either or both of the Bt and TMOF peptides being are derived from more than 1 different types or bacterial strain origins for either one or both of Bt and TMOF peptides. By bacterial strain origins we mean the peptides can be described as having been expressed by a bacterial strain that expresses the peptides with the understanding that many Bt proteins are also artificial in the sense that they are no longer all developed from bacterial strains.

[0691] We also disclose compositions where either or both of the Bt and TMOF peptides are derived from between 2 and 5, 2-15, 2-30, 5-10, 5-15, 5-30, 5-50 and various other different types or bacterial strains origins of either one or both of Bt or TMOF peptides. We disclose a composition where either or both of the Bt and TMOF peptides are encoded by from 2 to 15 different types or bacterial strain origins of either one or both of Bt and TMOF peptides. And any of these combinations of 2-5, 2-15, 2-30, 5-10, 5-15, 5-30, 5-50 and various other different types and mixtures of Bt and TMOF peptides can contribute more than at least 1% of each strain type to the composition.

[0692] We disclose composition of Bt and TMOF where the total concentration of Bt and TMOF peptide in the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients. We disclose compositions wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal TMOF peptide, wherein said ERSP is linked at the N-terminal of the insecticidal TMOF peptide. We disclose compositions wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal TMOF peptide, wherein said ERSP is linked at the N-terminal of the insecticidal TMOF peptide, wherein the ERSP is BAAS.

[0693] We disclose compositions wherein said combination peptide is produced using a genetic cassette that further comprises a dipeptide operably linked to the insecticidal TMOF peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal TMOF peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide, including embodiments where the dipeptide is glycine-serine, including embodiments where the insecticidal TMOF peptide is any includes embodiments where the insecticidal TMOF peptide is at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the TMOF sequences disclosed herein, including embodiments where the Bt Protein is any insecticidal Bt Protein, including embodiments where the Bt Protein is a Cry or Cyt protein, including embodiments where the Bt Protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1, including embodiments where the Bt protein is selected from a Cry protein, a Cry1A protein or a Cry1F protein, including embodiments where the Bt protein is a combination Cry1F-Cry1A protein, including embodiments where the Bt protein comprises an amino acid sequence at least 90% identical to SEQ ID NOs: 10, 12, 14, 26, 28, or 34 of U.S. Pat. No. 7,304,206, including embodiments where the Bt Endotoxin is Dipel, including embodiments where the Bt Protein is Thuricide.

[0694] We disclose a composition comprising the nucleotides of: Bt (Bacillus thuringiensis) protein; and an insecticidal TMOF peptide, in a transformed plant or plant genome; where the ratio of Bt to TMOF, on a dry weight basis, is selected from about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values.

[0695] We disclose transformed plant or plant genome wherein the ratio of Bt to TMOF, on a dry weight basis, is selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. The transformed plant or plant genome may have either or both of the Bt and TMOF peptides are derived from more than 1 different type or bacterial strain origin of Bt or TMOF peptides, or either or both of the Bt and TMOF peptides are derived from between 2 and 5 different type or bacterial strain origin of either Bt or TMOF peptides or both Bt and TMOF peptides are derived from between 2 and 5 different types or strain origins, or either or both of the Bt and TMOF peptides are derived from 2 to 15 different type or bacterial strain origins of either or both of Bt and TMOF peptides and at least one strain of either Bt or TMOF or both Bt and TMOF peptides encoded by more than one copy of the Bt or TMOF genes, or either or both of the Bt and TMOF peptides are derived from more than one different type or bacterial strain origin of Bt and/or TMOF peptides where all the strains of Bt and/or TMOF peptides contribute more than at least 1% of each strain type to said composition, or either or both of the Bt and TMOF peptides are derived from 2 to 5 different type or bacterial strain origins of either or both of Bt and TMOF peptides and at least one strain of either Bt or TMOF or both Bt and TMOF peptides encoded by more than one copy of the Bt of TMOF genes, or the total concentration of Bt and TMOF peptide in the composition can be selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0696] The compositions and plants described herein include an insecticidal combination peptide produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal TMOF peptide, wherein said ERSP is linked at the N-terminal of the insecticidal TMOF peptide. In another embodiment the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal TMOF peptide, wherein said ERSP is linked at the N-terminal of the insecticidal TMOF peptide, wherein the ERSP is BAAS. In another embodiment the transgenic plant incorporating and expressing the combination peptides from the nucleotides described herein, wherein said combination peptide is produced using a genetic cassette that further comprises nucleotides expressing a dipeptide operably linked to the insecticidal TMOF peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal TMOF peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide. In another embodiment the transgenic plant has a dipeptide that is glycine-serine. In another embodiment the transgenic plant has insecticidal TMOF peptides expressed that are comprised of an insecticidal peptide combination of TMOF and Bt proteins. The transgenic plants can have an insecticidal TMOF peptide derived from any TMOF species.

[0697] We describe and claim a transgenic plant wherein the insecticidal TMOF peptide expressed is may contain 20-100 amino acids and or the insecticidal TMOF peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the TMOF peptides described herein. The transgenic plants disclosed can contain any known Bt Protein, including peptides where the Bt Protein is a Cry or Cyt protein, and/or the Bt Protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1. The Bt Protein can be selected from a Cry protein, a Cry1A protein or a Cry1F protein, or a combination Cry1F-Cry1A protein, or it comprises an amino acid sequence at least 90% identical to SEQ ID NOs: 10, 12, 14, 26, 28, or 34 of U.S. Pat. No. 7,304,206. We describe a transgenic plant wherein the Bt Protein is Dipel and we describe a transgenic plant wherein the Bt Protein is Thuricide.

[0698] We specifically describe and claim a transformed plant expressing the peptides described herein where the average concentration of Bt and TMOF peptide, in an average leaf of a transformed plant is about: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values. We specifically describe and claim a transformed plant expressing properly folded toxic peptides in the transformed plant. We specifically describe and claim a transformed plant expressing properly folded combination toxic peptides in the transformed plant and to cause the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase in the plant's yield or resistance to insect damage and they control insect pests in crops and forestry. We describe plants made by any of the products and processes described herein.

[0699] We describe expression cassettes comprising any of the nucleotides which express any peptides described herein, including embodiments having a functional expression cassette incorporated into a transformed plant, comprising nucleotides that code for any of the peptides disclosed herein or that could be made by one skilled in the art given the teaching disclosed herein. We describe and claim procedures for the generation of transformed plants having or expressing any of the peptides described herein.

[0700] We describe the use of any of the peptides or nucleotides described herein, to make a plant or transform these peptides or nucleotides into a plant, and methods and techniques for generating these proteins in plants and/or expression cassettes comprising any of the peptides and methods to transform them into a plant genome and any method of using, making, transforming any of the described peptides or nucleotides into a plant and methods and techniques for generating transformed plants having or expressing any of the peptides and functional expression cassettes in plants comprising any of the disclosed peptides and their corresponding nucleotides and any plants made by the products and processes described herein.

[0701] In some embodiments we disclose a chimeric gene comprising a promoter active in plants operatively linked to the nucleic acids or expression cassettes as described herein. We disclose a method of making, producing, or using the combination of genes described herein. We disclose a recombinant vector comprising the combination of genes described herein. We disclose a method of making, producing, or using the recombinant vector. We disclose a transgenic host cell comprising the combination of genes described herein and the method of making, producing or using the transgenic host cell, which can be a transgenic plant cell and we disclose a method of making, producing or using such a transgenic plant cell as well as the transgenic plant comprising the transgenic plant cell and how to make and use the transgenic plant. We disclose transgenic plant and seed having the properties described herein that is derived from corn, soybean, cotton, rice, sorghum, switchgrass, sugarcane, alfalfa, potatoes or tomatoes. The transgenic seed may have a chimeric gene that we describe herein. We describe methods of making, producing or using the transgenic plant and or seed of this disclosure.

[0702] We also describe methods of using the invention and provide novel formulations. The invention is most useful to control insects. We describe a method of controlling an insect comprising: Applying Bt (Bacillus thuringiensis) protein to said insect; and Applying an insecticidal TMOF peptide to said insect. This method may be used where the Bt protein and the insecticidal ICK peptide are applied together at the same time in the same compositions or separately in different compositions and at different times. The Bt Protein and the insecticidal TMOF peptide may be applied sequentially, and it may be applied to (Bt Protein)-resistant insects. The ratio of Bt to TMOF, on a dry weight basis, can be selected from at least about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. The ratio of Bt to TMOF, on a dry weight basis, can be selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. Either or both of the Bt and TMOF peptides are derived from more than 1 different types or bacterial strain origins of Bt and TMOF peptides. Either or both of the Bt and TMOF peptides are derived from between 2 and 5 different types or bacterial strain origins of either Bt or TMOF peptides or both Bt and TMOF peptides. Either or both of the Bt and TMOF peptides are derived from 2 to 15 different types or bacterial strain origins of either or both of Bt and TMOF peptides and at least one strain of either Bt or TMOF or both Bt and TMOF peptides are encoded by more than one copy of the Bt or TMOF genes. Either one or both of the Bt and TMOF peptides are derived from more than 1 different types or bacterial strain origins of Bt and/or TMOF peptides with all the strains of Bt and/or TMOF peptides contributing more than at least 1% of the peptides from each strain type in said composition. Either or both of the Bt and TMOF peptides are derived from 2 to 5 different types or bacterial strain origins of either one or both of Bt and TMOF peptides and at least one strain of either Bt or TMOF or both Bt and TMOF peptides are encoded by more than one copy of the Bt or TMOF genes. The total concentration of Bt and TMOF peptide in the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0703] The methods can be used where the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal TMOF peptide, wherein said ERSP is linked at the N-terminal of the insecticidal TMOF peptide. In some embodiments the insecticidal combination peptides used are produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal TMOF peptide, wherein said ERSP is linked at the N-terminal of the insecticidal TMOF peptide, wherein the ERSP is BAAS.

[0704] Any of the peptides and plants described herein can be used to control insects, their growth and damage, especially their damage to plants. The combination Bt protein and insecticidal TMOF peptide can be applied by being sprayed on a plant, or the insect's locus, or the locus of a plant in need of protecting.

[0705] We also describe formulations comprising: Bt proteins; and an insecticidal TMOF peptide which can include any of the compositions described herein or capable of being made by one skilled in the art given this disclosure. Some of the described formulations include the use of a polar aprotic solvent, and or water, and or where the polar aprotic solvent is present in an amount of 1-99 wt %, the polar protic solvent is present in an amount of 1-99 wt %, and the water is present in an amount of 0-98 wt %. The formulations include formulations where the Bt protein is Dipel and where the insecticidal TMOF peptide is a peptide like any of the TMOF peptides provided in the sequence listing. The polar aprotic solvent formulations are especially effective when they contain MSO. The examples below are intended to illustrate and not limit the invention in any manner.

[0706] To summarize, we describe in Part III, the following:

[0707] A composition comprising at least two types of insecticidal protein or peptides wherein one type is a Pore Forming Insecticidal Protein (PFIP) and the other type is a Cysteine Rich Insecticidal Peptide (CRIP). Where the composition can comprise at least two types of insecticidal peptides wherein one type is Pore Forming Insecticidal Protein (PFIP), wherein said PFIP is a Bt protein and the other type is Cysteine Rich Insecticidal Peptide (CRIP), wherein said CRIP is an ICK protein, wherein said ICK protein is derived from the funnel web spider. We describe a process of: a) evaluation and optional testing of an insect or a sample of insects to determine whether or not the insects show resistance to a PFIP and b) when the result of said evaluation leads to the conclusion that said sample of insects are resistant to a PFIP then c) the application of one or more CRIPS and optionally the CRIPS can be an ICK from Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, Atrax infensus, including toxins known as U-ACTX polypeptides, U-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, or mutants or variants, or the CRIP can be a Non-ICK from sea anemones, from the sea anemone named Anemonia viridi, the peptides named Av2 and Av3 especially peptides of similar to these in the sequence listing. We describe a method of controlling Insects including Bt resistant insects comprising, creating composition of at least two types of peptides wherein one type of peptide is a pore forming insecticidal peptide (PFIP) and the other type of peptide is a cysteine rich insecticidal peptide (CRIP) and the PFIP and CRIP proteins are selected from any of the compositions described herein and from any of the proteins provided in the sequence listing and then applying said composition to the locus of the insect. We describe a method of controlling Insects including Bt resistant insects comprising protecting a plant from Bt resistant insects comprising, creating a plant which expresses a combination of at least two properly folded peptides wherein one type of peptide is a pore forming insecticidal peptide (PFIP) and the other type of peptide is a cysteine rich insecticidal peptide (CRIP) and the PFIP and CRIP proteins are selected from any of the compositions described herein and from any of the proteins provided in the sequence listing. We describe a process of: a) evaluation and optional testing of an insect or a sample of insects to determine whether or not the insects show resistance to a PFIP and b) when the result of said evaluation leads to the conclusion that said sample of insects are resistant to a PFIP then c) the application of one or more CRIPS and optionally d) the application of a combination of PFIP and CRIP, in either concurrent or sequential applications.

[0708] We describe a composition comprising at least two types of insecticidal protein or peptides wherein one type is a Pore Forming Insecticidal Protein (PFIP) and the other type is a Cysteine Rich Insecticidal Peptide (CRIP). A composition where the CRIP is an ICK and optionally, said ICK is derived from, or originates from, Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, Atrax infensus, including toxins known as U-ACTX polypeptides, U-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, or mutants or variants. A composition where the CRIP is a Non-ICK CRIP and optionally said Non-ICK CRIP is derived from, or originates from, animals having Non-ICK CRIPS such as sea anemones, sea urchins and sea slugs, optionally including the sea anemone named Anemonia viridi, optionally including the peptides named Av2 and Av3 especially peptides similar to Av2 and Av3 including such peptides listed in the sequence listing or mutants or variants. A method of using the composition control Insects including Bt resistant insects comprising, creating composition of at least two types of peptides wherein one type of peptide is a pore forming insecticidal protein (PFIP) and the other type of peptide is a cysteine rich insecticidal peptide (CRIP) and the PFIP and CRIP proteins are selected from any of the compositions described in claim 1 and herein and from any of the proteins provided in the sequence listing and then applying said composition to the locus of the insect. A method controlling Insects including Bt resistant insects comprising protecting a plant from Bt resistant insects comprising, creating a plant which expresses a combination of at least two properly folded peptides wherein one type of peptide is a pore forming insecticidal protein (PFIP) and the other type of peptide is a cysteine rich insecticidal peptide (CRIP) and the PFIP and CRIP proteins are selected from any of the compositions described herein and from any of the proteins provided in the sequence listing. A method of controlling insects including Bt resistant insects where the CRIP is administered any time during which the PFIP is affecting the lining of the insect gut. A method of controlling insects including Bt resistant insects where the CRIP is administered following the testing of the insect for Bt resistance and wherein said insect tested positive for Bt resistance. The application or delivery of any of the compounds described herein in solid or liquid form to either the insect, the locus of the insect or as a Plant Incorporated Protectant.

[0709] We describe a composition comprising at least two types of insecticidal peptides wherein one type is a pore forming insecticidal protein (PFIP), wherein said PFIP is a cry protein and the other type is a cysteine rich insecticidal peptide (CRIP), wherein said CRIP is an ICK protein, wherein said ICK protein is derived from the funnel web spider. We describe a composition comprising at least two types of insecticidal peptides wherein one type is a pore forming insecticidal peptide (PFIP), wherein said PFIP has as its origin the Bt organism and the other type is a cysteine rich insecticidal peptide (CRIP), wherein said CRIP is a Non-ICK protein. We describe a composition comprising at least two types of insecticidal peptides wherein one type is a pore forming insecticidal peptide (PFIP) and the other type is a TMOF. We describe a method of protecting a plant from Insects including Bt resistant insects comprising creating a Plant Incorporating a combination of at least two different types of peptides wherein one type of peptide is a pore forming insecticidal peptide (PFIP) and the other type is a cysteine rich insecticidal peptide (CRIP). We describe a method of protecting a plant from Insects including Bt resistant insects comprising, creating a plant which expresses a combination of at least two properly folded peptides wherein one type of peptide is a pore forming insecticidal peptide (PFIP) and the other type of peptide is a cysteine rich insecticidal peptide (CRIP) and the PFIP and CRIP proteins are selected from any of the compositions described herein and from any of the proteins provided in the sequence listing.

[0710] We describe an insecticidal combination peptide composition comprising Cysteine Rich Insecticidal protein (CRIP); such as an insecticidal ICK (Inhibitor Cystine Knot) peptide like a spider peptide or Non-ICK like a sea anemone toxin combined with a with pore forming insecticidal protein (PFIP) like a Bt peptide, such as cry, cyt or VIP; or a or a Cysteine Rich Insecticidal protein (CRIP); such as an insecticidal ICK (Inhibitor Cystine Knot) peptide combined with a with a TMOF (trypsin modulating oostatic factor) peptide. Note the CRIP can be a Non-ICK protein like a sea anemone peptide, such as Av2 and Av3 and other similar sequences in the Sequence Listing. We describe such compositions where the ratio of Bt to CRIP, Bt to ICK, Bt to non-ICK CRIP, Bt to TMOF, or Bt to ICK and TMOF on a dry weight basis, is selected from about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. Alternatively where the ratio of Bt to CRIP, Bt to ICK, Bt to non-ICK CRIP, Bt to TMOF, and TMOF, and sea anemone on a on a dry weight basis, is selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values. Alternatively where ratio of Bt to CRIP, Bt to ICK, Bt to non-ICK CRIP, Bt to TMOF, or Bt to ICK and TMOF, and sea anemone peptides are derived from more than 1 different types or bacterial strain origins of either one or both of Bt and ICK peptides. Alternatively where the Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides are derived from between 2 and 5 different types or bacterial strains origins of either one or both of Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides are derived from between 2 and 5 different strains. Alternatively where either or both of the Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides are derived from 2 to 5 different types or bacterial strain origins of either one or all of Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides. Alternatively where either or both of the Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides are encoded by from 2 to 15 different types or bacterial strain origins of either one or all of Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides. Alternatively where one or all of the Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides are derived from 2 to 15 different types or bacterial strain origins of either one or all of Bt, ICK, and TMOF peptides and at least one strain of either Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides or both Bt, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides and Bt and ICK, Bt and TMOF, or Bt and ICK+TMOF peptides are encoded by more than one copy of the Bt or ICK genes. Alternatively where either or both of the Bt, CRIP, ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides are derived from 2 to 15 strains or bacterial types of Bt and/or ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides with all the strains of Bt and/or ICK peptides contributing more than at least 1% of each strain type to said composition.

[0711] We describe a composition of Bt and ICK, non-ICK CRIP, sea anemone peptides and TMOF peptides of numbers 1-9 where the total concentration of Bt and CRIP peptide in the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients. We describe a composition wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal CRIP peptide, wherein said ERSP is linked at the N-terminal of the insecticidal CRIP peptide. We describe a composition wherein the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal CRIP peptide, wherein the ERSP is BAAS. We describe a composition wherein said combination peptide is produced using a genetic cassette that further comprises a dipeptide operably linked to the insecticidal CRIP peptide, wherein said dipeptide is linked at the N-terminal of the insecticidal CRIP peptide; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide. We describe a composition wherein said dipeptide is glycine-serine.

[0712] We describe a composition wherein the insecticidal CRIP peptide is any insecticidal peptide that inhibits both voltage-gated Calcium channels and Calcium-activated potassium channels in insects, and wherein the insecticidal CRIP peptide origins from any species of Australian Funnel-web spider, and wherein said spider is selected from the Australian Funnel-web spiders of genus Atrax or Hadronyche, and wherein said spider is selected from the Australian Funnel-web spiders of genus Hadronyche, and wherein said spider is selected from the Australian Blue Mountains Funnel-web, Hadronyche versuta, and wherein the insecticidal CRIP peptide is Hybrid-ACTX-Hv1a, and wherein said insecticidal CRIP peptide contains 20-100 amino acids and 2-4 disulfide bonds, wherein said insecticidal CRIP peptide is any insecticidal peptide with at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to any of the peptides in the sequence listing.

[0713] We describe insecticidal CRIP peptide is from Bt protein and where the Bt protein is a Cry or Cyt protein, or selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1. We describe Bt protein selected from a Cry protein, a Cry1A protein or a Cry1F protein. We describe wherein said Bt protein is a combination Cry1F-Cry1A protein, Dipel or Thuricide and where the Bt protein is derived from Bacillus thuringiensis kurstaki.

[0714] We describe compositions comprising the nucleotides of a PFIP such as Bt (Bacillus thuringiensis) protein; and a CRIP such as an insecticidal ICK (Inhibitor Cystine Knot) peptide, or a Non-ICK peptide; in a transformed plant or plant genome; and where the ratio of Bt to ICK, on a dry weight basis, is selected from about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values, or where the composition of number 33, in a transformed plant or plant genome and wherein the ratio of Bt to ICK, on a dry weight basis, is selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[0715] We describe a composition where either or both of the encoded Bt and ICK peptides are derived from more than 1 different type or bacterial strain origin of Bt or ICK peptides, where either or both of the encoded Bt and ICK peptides are derived from between 2 and 5 different type or bacterial strain origin of either Bt or ICK peptides or both Bt and ICK peptides are derived from between 2 and 5 different types or strain origins, where either or both of the encoded Bt and ICK peptides are derived from 2 to 15 different type or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides encoded by more than one copy of the Bt or ICK genes, where either or both of the encoded Bt and ICK peptides are derived from more than one different type or bacterial strain origin of Bt and/or ICK peptides where all the strains of Bt and/or ICK peptides contribute more than at least 1% of each strain type to said composition, where either or both of the encoded Bt and ICK peptides are derived from 2 to 5 different type or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either Bt or ICK or both Bt and ICK peptides encoded by more than one copy of the Bt of ICK genes.

[0716] We describe a composition where the total concentration of transgenically expressed Bt and ICK peptide resulting from the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients. We describe a composition where the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal ICK peptide, wherein said ERSP is linked at the N-terminal of the insecticidal ICK peptide, and where the insecticidal combination peptide is produced using a genetic cassette that further comprises an ERSP (Endoplasmic Reticulum Signal Peptide) operably linked to the insecticidal CRIP peptide, wherein said ERSP is linked at the N-terminal of the insecticidal CRIP peptide, wherein the ERSP is BAAS.

[0717] We describe a transgenic plant incorporating and expressing the combination peptides disclosed herein where said combination peptide is produced using a genetic cassette that further comprises nucleotides expressing a dipeptide operably linked to the insecticidal CRIP (peptide), wherein said dipeptide is encoded so that it is covalently linked at the N-terminal of the insecticidal CRIP; and wherein the dipeptide is comprised of one nonpolar amino acid on the N-terminal of the dipeptide and one polar amino acid on the C-terminal of the dipeptide. We describe a transgenic plant wherein the transformed peptide includes a dipeptide with an N terminal glycine-serine. We describe transgenic plant wherein the insecticidal peptides expressed are any insecticidal peptide combination of CRIP and PFIP (or Bt peptides) that allows the peptide to both enter the gut and then inhibits both voltage-gated Calcium channels and Calcium-activated potassium channels in insects.

[0718] We describe a transgenic plant wherein the recombinantly produced insecticidal CRIP peptide is derived from an Australian Funnel-web spider or sea anemone and we describe and provide either real or notional examples of transformed plants, transformed with a CRIP from a spider is selected from the Australian Funnel-web spiders of genus Atrax or Hadronyche or a sea anemone is selected from Anemonia viridis. The transgenic plant can have insecticidal ICK peptide expressed that is Hybrid-ACTX-Hv1a. The CRIP can be an ICK or Non-ICK that when expressed contains 20-100 amino acids and 2-4 disulfide bonds. The PIP peptides can have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater sequence identity to SEQ ID NO: 33 and or peptide selected from SEQ ID NOs: 33-1032.

[0719] We describe a transgenic plant wherein the Bt protein is any insecticidal Bt protein and where the Bt protein is a Cry or Cyt protein, and where the Bt protein is selected from the group consisting of a Cry1, Cry3, TIC851, CryET70, Cry22, TIC901, TIC201, TIC407, TIC417, a binary insecticidal protein CryET80, and CryET76, a binary insecticidal protein TIC100 and TIC101, a combination of an insecticidal protein ET29 or ET37 with an insecticidal protein TIC810 or TIC812 and a binary insecticidal protein PS149B1 and where the Bt protein is selected from a Cry protein, a Cry1A protein or a Cry1F protein, and where the Bt protein is a combination Cry1F-Cry1A protein, and/or Dipel and or Thuricide.

[0720] We describe a transgenic plant wherein the average concentration of Bt and ICK/Non-ICK peptide, in an average leaf of a transformed plant is about: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99% of total recoverable soluble protein, or any range between any two of these values, and where the transformed plant expressing the peptides properly folded toxic peptides in the transformed plant, and where it causes the accumulation of the expressed and properly folded toxic peptides in said plant and to cause an increase in the plant's yield or resistance to insect damage. We describe these compositions and procedures to control insects.

[0721] We describe expression cassettes comprising any of the nucleotides which express any peptides mentioned here. We describe a functional expression cassette incorporated into a transformed plant, comprising nucleotides that code for any of the peptides disclosed herein or that could be made by one skilled in the art given the teaching disclosed herein. We describe procedures for the generation of transformed plants having or expressing any of the combination peptides described herein. We describe a plant made by any of the products and processes described herein.

[0722] We describe the use of any of the peptides or nucleotides described herein, to make a plant or transform these peptides or nucleotides into a plant, and methods and techniques for generating these proteins in plants and/or expression cassettes comprising any of the peptides and methods to transform them into a plant genome and any method of using, making, transforming any of the described peptides or nucleotides into a plant and methods and techniques for generating transformed plants having or expressing any of the peptides and functional expression cassettes in plants comprising any of the disclosed peptides and their corresponding nucleotides and any plants made by the products and processes described herein.

[0723] We describe a chimeric gene comprising a promoter active in plants operatively linked to the nucleic acids or expression cassettes as described herein and the methods of making, producing, or using the combination of genes described herein. We describe a recombinant vector comprising the combination of genes described herein. We describe a method of making, producing, or using the recombinant vectors, a transgenic host cell comprising the combination of genes, the transgenic host cell which is a transgenic plant cell, the transgenic plant and transgenic plants which are corn, soybean, cotton, rice, sorghum, switchgrass, sugarcane, alfalfa, potatoes or tomatoes, and the seeds for these and other plants, and where the seed comprises a chimeric gene.

[0724] We describe methods of controlling an insect or the locus of an insect comprising: applying a PFIP, like Bt (Bacillus thuringiensis) protein to said insect; followed with an application of any or any combination of the following: a cysteine rich insecticidal peptide (CRIP) to said insect and in combination or in the alternative, applying an insecticidal ICK (Inhibitor Cystine Knot) peptide to said insect and in combination or in the alternative, applying a Non-ICK CRIP peptide to said insect and in combination or in the alternative, applying a TMOF peptide to said insect, applying a sea anemone peptide to said insect.

[0725] We explain that Bt protein and the insecticidal CRIP, ICK and or TMOF peptide are applied such that they work together, but they do not have to be applied at the same time. The PFIP like a Bt protein and the insecticidal CRIP, ICK and or TMOF peptide can be are applied concurrently or sequentially.

[0726] We explain the amounts as follows: the ratio of Bt to CRIP, Bt to ICK, Bt to non-ICK CRIP, Bt to TMOF, or Bt to ICK and TMOF; on a dry weight basis, is selected from about the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values; alternatively, the ratio of Bt to CRIP, Bt to ICK, Bt to non-ICK CRIP, Bt to TMOF, or Bt to ICK and TMOF; on a on a dry weight basis, is selected from about the following ratios: 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[0727] We explain both or all of the Bt+CRIP; Bt+ICK, Bt+Non-ICK CRIP, Bt+TMOF or Bt+ICK+TMOF; are derived from more than 1 different types or bacterial strain origins of Bt, o ICK, and TMOF peptides and or both of the Bt and CRIP, ICK, non-ICK CRIP, Bt and TMOF or Bt and ICK+TMOF; Bt+sea anemone peptides are derived from between 2 and 5 different types or bacterial strain origins of either one, two or more of Bt, CRIP, ICK, non-ICK CRIP, sea anemone peptides or TMOF peptides, and or either one, two or all Bt, ICK and TMOF peptides are derived from 2 to 15 different types or bacterial strain origins of either or both of Bt and ICK peptides and at least one strain of either one, two or all of Bt, CRIP, ICK, non-ICK CRIP, sea anemone peptides or TMOF peptides are encoded by more than one copy one, two or all of Bt, CRIP, ICK, non-ICK CRIP, sea anemone peptides or TMOF genes.

[0728] We explain that one, two or all Bt, ICK and TMOF peptides are derived from more than 1 different types or bacterial strain origins of one, two or all Bt, ICK and TMOF peptides with all the strains of one, two or all Bt, ICK and TMOF peptides contributing more than at least 1% of the peptides from each strain type in said composition. The total concentration of Bt and CRIP peptide in the mixture is selected from the following percent concentrations: 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 99%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[0729] We either provide or provide enough information that one skilled in the art could make a formulation comprising: a PFIP such as a Bt protein; and a CRIP such as an insecticidal ICK or Non-ICK peptide; and/or a TMOF peptide. We explain such formulations could be made using a polar aprotic solvent and a polar protic solvent and further comprising water. In some formulations the polar aprotic solvent is present in an amount of 1-99 wt %, the polar protic solvent is present in an amount of 1-99 wt %, and the water is present in an amount of 0-98 wt %, and it can further comprise MSO.

PART III. EXAMPLES

Example 1

[0730] Foliar Bioassay Using SDP 1234604 and 1234605 Against Spodoptera exigua on Romaine Lettuce

[0731] Purpose: The purpose of this experiment is designed to determine the percent mortality which occurs against S. exigua when SDP 1234604 (wp formulation) and 605 (pre-gran formulation) are sprayed against 1st, 2nd, 3rd and 4th Instar larvae in a foliar leaf disk bioassay.

[0732] Assay Preparation and Treatment Formulation: S. exigua eggs were received from Benzon Research. Eggs were placed at 10 C. in the wine cooler for two days then moved to the VWR Low Temperature Incubator set at 28 C. and 2-30% Relative Humidity on a rack under LED lights, until freshly hatched neonate were 24 hr old for the first experiment. Mud Lake Farms Lettuce was received on Jul. 9, 2012 and stored at 4 C. in a refrigerator until used. For each instar, larvae were placed on mud lakes farms lettuce after 24 hours in the incubator. Lettuce leaves were cut and placed into a medium square polyethylene container and larvae were tapped into the container. After 24 hours, larvae were removed from the old lettuce and fresh lettuce was replaced so that larvae were not reared on less than superior tissue. This occurred once a day, for three days, until larvae were 96 hours old. Lettuce leaves were cut into disks using a 2 inch arch which has been sanitized with 70% ethanol and cleaned to remove any leaf tissue from previous assays. Leaf disks were punched on a true bamboo cutting board. A very dilute 12 ppm bleach solution ( 1/500th dilution of 6ppt hypochlorite {Clorox Bleach} Stock) was used to sanitize the leaf tissue without damaging leaf disks before the quadruple rinse. Leaf disks were subjected to the 12 ppm bleach treatment by placing the cut leaf disk in a 12 ppm solution of bleach in a large rectangular polyethylene container (covered with a lid) and shaking at 3500 rpm on an orbital shaker for 1.5 minutes. Bleach solution was then drained from the bin and leaves were rinsed in bins with dH2O four times to remove residual bleach with slight agitation in diH2O on the orbital shaker. Leaf disks were placed onto the paper towels and covered with additional paper towels so that they do not dry out. Only the flattest, circular and uniform disks were then hand dried with Kimwipes to remove any remaining water and placed into labeled Tupperware containers abaxial side up for spraying. During this time, formulations were made (as described in the table that follows) for the spray solutions of spray dried powders on the leaf disks in 50 mL Falcon tube being sure to fill tubes with deionized H2O before adding the precisely massed amount of spray dried powders. Spraying was performed in the Labconco fume hood in E207 starting with the ventral side of the leaf disk. For spraying, a double action, internal mix airbrush (Paasch Airbrush Company, Chicago Ill.) with the airline set at a rate of 200 L/second (20 psi). Leaf disks were sprayed in a circular fashion with the airbrush perpendicular to the leaf surface so that a fine mist covered the entire leaf surface evenly (3-4 seconds). Between each treatment spray, the cup containing spray solution was rinsed with dH2O to remove any residues from previous treatments. After spraying, drying was allowed for one hour then disks were flipped so their adaxial side was now orientated facing up in the Tupperware Container and sprayed in the same manner. After spraying the adaxial side, an hour was allowed for drying and leaf disks were placed in labeled petri dishes with 2 90 mm Whatman 3 Qualitative Filter Papers (GE Healthcare UK Limited, Amersham Place Little Chalfont, Buckinghamshire, HP7 9NA, UK) at the bottom that have been wetted with 4 mL of diH2O using a Eppendorf Repeater Plus and a 25 mL tip. Petri dishes were covered and randomized before 7-9 freshly hatched neonates S. exigua were applied to each leaf disk using a #0 fine haired brush by obtaining a white board and emptying a container of 24, 48, 72 or 96 hr neonates onto it. Plates were sealed with parafilm and placed randomly on the rack for statistical purposes at 27 C. The assay was scored over the following day at 18, 24, 40 and 48 hours by observing mortality and noting any differences between untreated and treated leaves.

[0733] FIG. 19 shows the percent mortality results of four experiments recorded for each experiment at 18, 24, 40 and 48 hours. The non-spray dried control treatment showed the lowest average mortality of any treatments. The majority of insect mortality is observed at the 18 hour scoring and additional mortality is observed at 40 and 48 hours shown by the 40 and 48 hour scoring. Healthy insects have noticeable green, chlorophyll like color, fast evasion response when prodded with paint brush and average growth for 48 hours. Percent mortality results of 72 and 96 hour larvae are significantly reduced compared to the 24 and 48 hour old larvae. Clearly, both Bt protein and Hybrid peptide treatments alone are ineffective in controlling older insects.

Example 2

[0734] Foliar Bioassay Using SDP 1234605 Against Spodoptera exigua on Mud Lakes Farms Romaine Lettuce.

[0735] Purpose: The purpose of this experiment is designed to determine the percent mortality which occurs against S. exigua when SDP 1234605 is sprayed against 72 hour old larvae in a foliar leaf disk bioassay and when Dipel DF is co-sprayed with SDP 1234605.

[0736] Assay Preparation and Treatment Formulation: See preparation in Example 1. S. exigua eggs were received from Benzon Research. Petri dishes were covered and randomized before 7-9 freshly hatched neonates S. exigua were applied to each leaf disk using a #0 fine haired brush by obtaining a white board and emptying a container of 72 hr old larvae onto it. Plates were sealed with parafilm and placed randomly on the rack for statistical purposes at 27 C. The assay was scored over the following day at 18, 24 and 48 hours by observing mortality and noting any differences between untreated and treated leaves.

[0737] FIG. 20 shows a column graph Example 2 data at 18, 24 and 48 hours. Individually 10 parts per thousand (ppt) of Hybrid peptide in formulation '605 and Dipel at 300 parts per million (ppm) show little improvement over either the untreated control or surfactant mortalities. However, when combined the resultant mortality at 48 hours of 84.4% surprisingly exceeds that which would be expected from the additive effects of the individual treatments (29.1%). The insecticidal activity of the individual components is at least 2.9 fold (84.4/29.1). It is unexpected that an insecticidal protein that kills through sepsis would be synergistic with an insecticidal peptide that modulates ion channels in the CNS.

Example 3

[0738] Additive and/or Synergistic Effects of Combinations of Bacillus thuringiensis (Bt) Proteins and the Av2 Peptide from Sea Anemones.

[0739] We used the Bt product: Dipel DF which is commercially available and commercially available Av2, a toxic sea anemone peptide.

[0740] Methods: Small leaf disks (2 cm) were cut into the inner leaves of cabbage purchased from a local grocery store. Disks were dipped into 400 L of treatment and placed on 4.25 cm #4 filter disks (Whatman) in the bottom of 4.5 cm condiment cups. Four disks were prepared per treatment. 75 L of water was applied to a second smaller 3.2 cm #1 filter disk (Whatman) atop the larger filter disk. Leaf disks were allowed to dry approximately ten minutes before adding four 120 hr old Cry1a resistant Plutella xylostella per leaf disk. Condiment cups were sealed with non-perforated lids. Treatments were placed in the incubator and scored for mortality and feeding damage at 24 and 48 hrs. Due to large consumption of leaf disks in many treatments, an additional 3.2 cm untreated leaf disk was added at 24 hr to ensure larval starvation did not occur.

[0741] At 24 and 48 hours, pictures of leaf disks were taken using an Iphone 4S (Apple Inc.), and saved. Individual leaf disk photos were cropped from the group treatment photo and assigned random numbers. Using the program ImageJ, leaf area eaten was calculated. The image was opened in imageJ and the scale in the photo was set. To set the scale, a known distance in the photo in centimeters (cm) was drawn using the segment line tool and measured in units of pixels. For this experiment, the known diameter of filter paper disk is 1.5 cm for #1 filter disk and 4.5 cm for the #4 Whatman Filter disk. Using this known length in cm, pixel units are converted in the image to centimeters. Once the scale is set, a freehand selection tool is used to draw around the area where leaf tissue remains. This process was repeated for all photos being sure to log area calculated by image J in the lab notebook. For this experiment the control area of uneaten leaf disk is 2.54 cm.sup.2 and calculations were made to determine % area eaten.

[0742] Treatments:

[0743] 150 PPM Dipel DF: 200 L 300 PPM Dipel DF+200 L water

[0744] 1 PPT Av2: 0.1 mg Av2 in 100 L water (combined four vials 1 PPT Av2 for necessary 400 L treatments)

[0745] 150 PPM Dipel DF+1PPT Av2: 100 L 150 PPM Dipel DF was added to 0.1 mg Av2 (four vials were combined for necessary 400 L treatment)

[0746] FIG. 21 shows the percent feeding damage resulting from Bt protein resistant diamondback moth larvae (120 hrs old) on cabbage leaf disks. Scoring at both 24 hours and 48 hours shows significant improvement over treatment with Dipel alone. While these insects are resistant to Bt, they do still feed to a limited extent without mortality. The combination treatment results in significantly improved protection of the foliar material. Further, treatment with Av2 alone has no effect on feeding damage and it is only in combination with the Bt protein that its effect is made apparent. This is consistent with increased bioavailability of Av2 made possible by the Bt protein.

Example 4

[0747] Foliar Bioassay Using SDP 1234609 and DiPel DF on Earthbound Farms Romaine Lettuce

[0748] Purpose: The purpose of this experiment is to determine the percent mortality which occurs against Bt resistant (HD-1) P. xylostella when SDP 1234609 is sprayed against 120 hour old larvae in a foliar leaf disk bioassay and when Dipel DF is co-sprayed with SDP 1234609.

[0749] Assay Preparation and Treatment Formulation: See preparation in Example 1.

[0750] FIG. 22 shows a column graph Example 4 data at 24 and 48 hours. Individually 1 parts per thousand (ppt) of Hybrid peptide in formulation '609 and Dipel at 150 parts per million (ppm) show little improvement over either the untreated control or surfactant mortalities. However, when combined the resultant mortality at 48 hours of 62.5% surprisingly exceeds that which would be expected from the additive effects of the individual treatments (21.8%). The synergy of the individual components is at least 2.86 fold (62.5/21.8). Again, it is unexpected that an insecticidal protein that kills through sepsis would be synergistic with an insecticidal peptide that modulates ion channels in the CNS.

PART IV. INSECTICIDAL COMBINATIONS

Definitions

[0751] 5- and 3-homology arms or 5 and 3 arms or left and right arms refers to the polynucleotide sequences in a vector and/or targeting vector that homologously recombine with the target genome sequence and/or endogenous gene of interest in the host organism in order to achieve successful genetic modification of the host organism's chromosomal locus.

[0752] -CNTX-Pn1a or -CNTX-Pn1a or gamma-CNTX-Pn1a or gamma refers to an insecticidal neurotoxin derived from the Brazilian armed spider, Phoneutria nigriventer. -CNTX-Pn1a targets the N-methyl-D-aspartate (NMDA)-subtype of ionotropic glutamate receptor (GRIN), and sodium channels.

[0753] /-HXTX-Hv1a or omega/kappa-HXTX-Hv1a, refers to the insecticidal toxin derived from the Australian Blue Mountain Funnel-web Spider, Haydronyche versuta. /-HXTX-Hv1a is a positive allosteric modulators of the nicotinic acetylcholine receptor, and may also be a dual antagonist to insect voltage-gated Ca.sup.2+ channels and voltage-gated K.sup.+ channels. See Chambers et al., Insecticidal spider toxins are high affinity positive allosteric modulators of the nicotinic acetylcholine receptor. FEBS Lett. 2019 June; 593(12):1336-1350; and Windley et al., Lethal effects of an insecticidal spider venom peptide involve positive allosteric modulation of insect nicotinic acetylcholine receptors. Neuropharmacology. 2017 December; 127:224-242, the disclosures of which are incorporated herein by reference in their entireties. As used herein, /-HXTX-Hv1a is synonymous with U+2 peptide, U+2 protein, U+2 toxin, U+2, and U+2-ACTX-Hv1a.

[0754] Agent can refer to one or more chemical substances, molecules, nucleotides, polynucleotides, peptides, polypeptides, proteins, poisons, insecticides, pesticides, organic compounds, inorganic compounds, prokaryote organisms, or eukaryote organisms, and/or any subsequent agent produced therefrom.

[0755] Arachnid refers to a class of arthropods. For example in some embodiments, arachnid can mean spiders, scorpions, ticks, mites, harvestmen, or solifuges.

[0756] Av2 or ATX-II or neurotoxin 2 or Anemonia viridis toxin 2 or -AITX-Avd1c refers to a toxin isolated from the venom of Anemonia sulcata. One example of an Av2 polypeptide is a polypeptide having the amino acid sequence of SEQ ID NO: 1779.

[0757] Av3 refers to a polypeptide isolated from the sea anemone, Anemonia viridis, which can target receptor site 3 on -subunit III of voltage-gated sodium channels. One example of an Av3 polypeptide is an Av3 polypeptide having the amino acid sequence of SEQ ID NO: 1780 (NCBI Accession No. P01535.1).

[0758] AVP or Av3 variant polypeptides refers to an Av3 polypeptide sequence and/or a polypeptide encoded by a variant Av3 polynucleotide sequence that has been altered to produce a non-naturally occurring polypeptide and/or polynucleotide sequence.

[0759] bp or base pair refers to a molecule comprising two chemical bases bonded to one another forming a. For example, a DNA molecule consists of two winding strands, wherein each strand has a backbone made of an alternating deoxyribose and phosphate groups. Attached to each deoxyribose is one of four bases, i.e., adenine (A), cytosine (C), guanine (G), or thymine (T), wherein adenine forms a base pair with thymine, and cytosine forms a base pair with guanine.

[0760] Bt-resistant or Bt-resistance or Bt-resistant insect or Bacillus thuringiensis-toxin-resistant insects refers to a heritable change in the sensitivity of a pest population that is reflected in the repeated failure of a product (e.g., Bt) to achieve the expected level of control when used against that pest species.

[0761] CEW refers to Corn earworm.

[0762] Cone shell or cone snails or cones refers to organisms belonging to the Conus genus of predatory marine gastropods. For example, in some embodiments, a cone shell can be one of the following species: Conus amadis; Conus catus; Conus ermineus; Conus geographus; Conus gloriamaris; Conus kinoshitai; Conus magus; Conus marmoreus; Conus purpurascens; Conus stercusmuscarum; Conus striatus; Conus textile; or Conus tulipa.

[0763] Conotoxin refers to the toxins isolated from cone shells that act by interfering with neuronal communication. For example, in some embodiments, a conotoxin can be an -, -, -, -, or -conotoxins. Briefly, the -conotoxins (and A-&-conotoxins) target nicotinic ligand gated channels; -conotoxins target voltage-gated calcium channels; -conotoxins target the voltage-gated sodium channels; -conotoxins target the voltage-gated sodium channel; and -conotoxins target the voltage-gated potassium channel.

[0764] Homologous refers to Homologous refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared 100. Homologous refers to the sequence similarity between two polypeptide molecules or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomeric subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology.

[0765] The term homology, when used in relation to nucleic acids, refers to a degree of complementarity. There may be partial homology, or complete homology and thus identical. Sequence identity refers to a measure of relatedness between two or more nucleic acids, and is given as a percentage with reference to the total comparison length. The identity calculation takes into account those nucleotide residues that are identical and in the same relative positions in their respective larger sequences.

[0766] Identity refers to a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing said sequences. The term identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. Identity and similarity can be readily calculated by any one of the myriad methods known to those having ordinary skill in the art, including but not limited to those described in: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994, Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988), the disclosures of which are incorporated herein by reference in their entireties. Furthermore, methods to determine identity and similarity are codified in publicly available computer programs. For example in some embodiments, methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Altschul, S. F. et al., J. Molec. Biol. 215: 403-410 (1990). The BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990), the disclosures of which are incorporated herein by reference in their entireties.

[0767] in vivo refers to the natural environment (e.g., an animal or a cell) and to processes or reactions that occur within a natural environment.

[0768] Kappa-ACTX peptide refers to an excitatory toxin that inhibits insect calcium-activated potassium (KCa) channels (Slo-type). As used herein, Kappa-ACTX peptide can refer to peptides isolated from the Australian Blue Mountains Funnel-web Spider, Haydronyche versuta, or variants thereof.

[0769] kb refers to kilobase, i.e., 1000 bases. As used herein, the term kb means a length of nucleic acid molecules. For example, 1 kb refers to a nucleic acid molecule that is 1000 nucleotides long. A length of double-stranded DNA that is 1 kb long, contains two thousand nucleotides (i.e., one thousand on each strand). Alternatively, a length of single-stranded RNA that is 1 kb long, contains one thousand nucleotides.

[0770] kDa refers to kilodalton, a unit equaling 1,000 daltons; a Dalton or dalton is a unit of molecular weight (MW).

[0771] LD.sub.20 refers to a dose required to kill 20% of a population.

[0772] MOA refers to mechanism of action.

[0773] Molecular weight (MW) refers to the mass or weight of a molecule, and is typically measured in daltons (Da) or kilodaltons (kDa). In some embodiments, MW can be calculated using sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), analytical ultracentrifugation, or light scattering. In some embodiments, the SDS-PAGE method is as follows: the sample of interest is separated on a gel with a set of molecular weight standards. The sample is run, and the gel is then processed with a desired stain, followed by destaining for about 2 to 14 hours. The next step is to determine the relative migration distance (Rf) of the standards and protein of interest. The migration distance can be determined using the following equation: Rf=(migration distance of the protein)/(Migration distance of the dye front). Next, the logarithm of the MW can be determined based on the values obtained for the bands in the standard; e.g., in some embodiments, the logarithm of the molecular weight of an SDS-denatured polypeptide and its relative migration distance (Rf) is plotted into a graph. After plotting the graph, interpolating the value derived will provide the molecular weight of the unknown protein band.

[0774] NCBI refers to the National Center for Biotechnology Information.

[0775] Operable refers to the ability to be used, the ability to do something, and/or the ability to accomplish some function or result. For example, in some embodiments, operable refers to the ability of a site-specific integration (SSI) sequence to knock-out a gene (e.g., Gal80 or ndt80), and/or knock-in a gene encoding a heterologous polypeptide of interest.

[0776] Parasporal crystal toxin refers to any of the peptides, polypeptides, and/or proteins that are part of the parasporal body or parasporal crystal, which is a bipyramidal crystal containing one or more peptides, polypeptides, and/or proteins. When the parasporal body or parasporal crystal is ingested by an insect, this toxin-containing parasporal crystal dissolves in the alkaline gut juices, followed by cleavage via midgut proteases of the protoxin, which yields an active peptide toxin, e.g., a -endotoxin.

[0777] Pesticidally-effective amount refers to an amount of the pesticide that is able to bring about death to at least one pest, or to noticeably reduce pest growth, feeding, or normal physiological development. This amount will vary depending on such factors as, for example, the specific target pests to be controlled, the specific environment, location, plant, crop, or agricultural site to be treated, the environmental conditions, and the method, rate, concentration, stability, and quantity of application of the pesticidally-effective polypeptide composition. The formulations may also vary with respect to climatic conditions, environmental considerations, and/or frequency of application and/or severity of pest infestation.

[0778] Protein has the same meaning as Peptide in this document.

[0779] Ratio refers to the quantitative relation between two amounts showing the number of times one value contains or is contained within the other.

[0780] Sea anemone refers to a group of marine animals of the order Actiniaria. Sea anemones are named after the anemone, which is a terrestrial flowering plant, due to colorful appearance many sea anemones possess. For example, in some embodiments, a sea anemone is one of the following species: Actinia equine; Anemonia erythraea; Anemonia sulcata; Anemonia viridis; Anthopleura elegantissima; Anthopleura fuscoviridis; Anthopleura xanthogrammica; Bunodosoma caissarum; Bunodosoma cangicum; Bunodosoma granulifera; Heteractis crispa; Parasicyonis actinostoloides; Radianthus paumotensis; or Stoichactis helianthus.

[0781] Serovar or serotype refers to a group of closely related microorganisms distinguished by a characteristic set of antigens. In some embodiments, a serovar is an antigenically and serologically distinct variety of microorganism

[0782] sp. refers to species.

[0783] ssp. or subsp. refers to subspecies.

[0784] The acronym SSI is context dependent. In some contexts, it can refer to Site-specific integration, which is used to refer to a sequence that will permit in vivo homologous recombination to occur. However, in other contexts, SSI can refer to Surface spraying indoors, which is a technique of applying a variable volume sprayable volume of an insecticide onto indoor surfaces where vectors rest, such as on walls, windows, floors and ceilings.

[0785] var. refers to varietas or variety. The term var. is used to indicate a taxonomic category that ranks below the species level and/or subspecies (where present). In some embodiments, the term var. represents members differing from others of the same subspecies or species in minor but permanent or heritable characteristics.

[0786] Variant or variant sequence or variant peptide refers to an amino acid sequence that possesses one or more conservative amino acid substitutions or conservative modifications. The conservative amino acid substitutions in a variant does not substantially diminish the activity of the variant in relation to its non-varied form. For example, in some embodiments, a variant possesses one or more conservative amino acid substitutions when compared to a peptide with a disclosed and/or claimed sequence, as indicated by a SEQ ID NO.

[0787] The present disclosure is performed without undue experimentation using, unless otherwise indicated, conventional techniques of molecular biology, microbiology, virology, recombinant DNA technology, solid phase and liquid nucleic acid synthesis, peptide synthesis in solution, solid phase peptide synthesis, immunology, cell culture, and formulation. Such procedures are described, for example, in Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, New York, Second Edition (1989), whole of Vols I, II, and III; DNA Cloning: A Practical Approach, Vols. I and II (D. N. Glover, ed., 1985), IRL Press, Oxford, whole of text; Oligonucleotide Synthesis: A Practical Approach (M. J. Gait, ed, 1984) IRL Press, Oxford, whole of text, and particularly the papers therein by Gait, pp 1-22; Atkinson et al, pp 35-81; Sproat et al, pp 83-115; and Wu et al, pp 135-151; 4. Nucleic Acid Hybridization: A Practical Approach (B. D. Hames & S. J. Higgins, eds., 1985) IRL Press, Oxford, whole of text; Immobilized Cells and Enzymes: A Practical Approach (1986) IRL Press, Oxford, whole of text; Perbal, B., A Practical Guide to Molecular Cloning (1984); Methods In Enzymology (S. Colowick and N. Kaplan, eds., Academic Press, Inc.), whole of series; J. F. Ramalho Ortigao, The Chemistry of Peptide Synthesis In: Knowledge database of Access to Virtual Laboratory website (Interactiva, Germany); Sakakibara, D., Teichman, J., Lien, E. Land Fenichel, R. L. (1976). Biochem. Biophys. Res. Commun. 73 336-342; Merrifield, R. B. (1963). J. Am. Chem. Soc. 85, 2149-2154; Barany, G. and Merrifield, R. B. (1979) in The Peptides (Gross, E. and Meienhofer, 3. eds.), vol. 2, pp. 1-284, Academic Press, New York. 12. Wiinsch, E., ed. (1974) Synthese von Peptiden in Houben-Weyls Metoden der Organischen Chemie (Muler, E., ed.), vol. 15, 4th edn., Parts 1 and 2, Thieme, Stuttgart; Bodanszky, M. (1984) Principles of Peptide Synthesis, Springer-Verlag, Heidelberg; Bodanszky, M. & Bodanszky, A. (1984) The Practice of Peptide Synthesis, Springer-Verlag, Heidelberg; Bodanszky, M. (1985) Int. J. Peptide Protein Res. 25, 449-474; Handbook of Experimental Immunology, Vols. I-IV (D. M. Weir and C. C. Blackwell, eds., 1986, Blackwell Scientific Publications); and Animal Cell Culture: Practical Approach, Third Edition (John R. W. Masters, ed., 2000); each of these references are incorporated herein by reference in their entireties.

[0788] Throughout this specification, unless the context requires otherwise, the word comprise, or variations such as comprises or comprising, will be understood to imply the inclusion of a stated step or element or integer or group of steps or elements or integers but not the exclusion of any other step or element or integer or group of elements or integers.

[0789] Exemplary PFIPs

[0790] In some embodiments, a PFIP can be a MTX2 toxin, e.g., a MTX2 toxin isolated from Lysinibacillus sphaericus.

[0791] In some embodiments, a PFIP can be a Bin-like toxin, e.g., a Bin-like toxin isolated from Lysinibacillus sphaericus.

[0792] In some embodiments, a PFIP can be a Bacillus thuringiensis subspecies. For example, in some embodiments, the Bacillus thuringiensis subspecies can be one of the following subspecies: aizawai; aizawai/pacificus; alesti; amagiensis; andalousiensis; argentinensis; asturiensis; azorensis; balearica; berliner; bolivia; brasilensis; cameroun; canadensis; chanpaisis; chinensis; colmeri; coreanensis; dakota; darmstadiensis; dendrolimus; entomocidus; entomocidus/subtoxicus; finitimus; fukuokaensis; galechiae; galleriae; graciosensis; guiyangiensis; higo; huazhongensis; iberica; indiana; israelensis; israelensis/tochigiensis; japonensis; jegathesan; jinghongiensis; kenyae; kim; kumamtoensis; kurstaki; kyushuensis; leesis; londrina; malayensis; medellin; mexicanensis; mogi; monterrey; morrisoni; muju; navarrensis; neoleonensis; nigeriensis; novosibirsk; ostriniae; oswaldocruzi; pahangi; pakistani; palmanyolensis; pingluonsis; pirenaica; poloniensis; pondicheriensis; pulsiensis; rongseni; roskildiensis; san diego; seoulensis; shandongiensis; silo; sinensis; sooncheon; sotto; sotto/dendrolimus; subtoxicus; sumiyoshiensis; sylvestriensis; tenebrionis; thailandensis; thompsoni; thuringiensis; tochigiensis; toguchini; tohokuensis; tolworthi; toumanoffi; vazensis; wratislaviensis; wuhanensis; xiaguangiensis; yosoo; yunnanensis; zhaodongensis; str. Al Hakam; or konkukian.

[0793] In some embodiments, a PFIP can be a Bacillus thuringiensis var. or varietas. For example, in some embodiments, a PFIP can be a Bacillus thuringiensis var. selected from the following group: Bacillus thuringiensis var. aizawai; Bacillus thuringiensis var. aizawai/pacificus; Bacillus thuringiensis var. alesti; Bacillus thuringiensis var. amagiensis; Bacillus thuringiensis var. andalousiensis; Bacillus thuringiensis var. argentinensis; Bacillus thuringiensis var. asturiensis; Bacillus thuringiensis var. azorensis; Bacillus thuringiensis var. balearica; Bacillus thuringiensis var. berliner; Bacillus thuringiensis var. bolivia; Bacillus thuringiensis var. brasilensis; Bacillus thuringiensis var. cameroun; Bacillus thuringiensis var. canadensis; Bacillus thuringiensis var. chanpaisis; Bacillus thuringiensis var. chinensis; Bacillus thuringiensis var. colmeri; Bacillus thuringiensis var. coreanensis; Bacillus thuringiensis var. dakota; Bacillus thuringiensis var. darmstadiensis; Bacillus thuringiensis var. dendrolimus; Bacillus thuringiensis var. entomocidus; Bacillus thuringiensis var. entomocidus/subtoxicus; Bacillus thuringiensis var. finitimus; Bacillus thuringiensis var. fukuokaensis; Bacillus thuringiensis var. galechiae; Bacillus thuringiensis var. galleriae; Bacillus thuringiensis var. graciosensis; Bacillus thuringiensis var. guiyangiensis; Bacillus thuringiensis var. higo; Bacillus thuringiensis var. huazhongensis; Bacillus thuringiensis var. iberica; Bacillus thuringiensis var. indiana; Bacillus thuringiensis var. israelensis; Bacillus thuringiensis var. israelensis/tochigiensis; Bacillus thuringiensis var. japonensis; Bacillus thuringiensis var. jegathesan; Bacillus thuringiensis var. jinghongiensis; Bacillus thuringiensis var. kenyae; Bacillus thuringiensis var. kim; Bacillus thuringiensis var. kumamtoensis; Bacillus thuringiensis var. kunthalanags3; Bacillus thuringiensis var. kunthalaRX24; Bacillus thuringiensis var. kunthalaRX27; Bacillus thuringiensis var. kunthalaRX28; Bacillus thuringiensis var. kurstaki; Bacillus thuringiensis var. kyushuensis; Bacillus thuringiensis var. leesis; Bacillus thuringiensis var. londrina; Bacillus thuringiensis var. malayensis; Bacillus thuringiensis var. medellin; Bacillus thuringiensis var. mexicanensis; Bacillus thuringiensis var. mogi; Bacillus thuringiensis var. monterrey; Bacillus thuringiensis var. morrisoni; Bacillus thuringiensis var. muju; Bacillus thuringiensis var. navarrensis; Bacillus thuringiensis var. neoleonensis; Bacillus thuringiensis var. nigeriensis; Bacillus thuringiensis var. novosibirsk; Bacillus thuringiensis var. ostriniae; Bacillus thuringiensis var. oswaldocruzi; Bacillus thuringiensis var. pahangi; Bacillus thuringiensis var. pakistani; Bacillus thuringiensis var. palmanyolensis; Bacillus thuringiensis var. pingluonsis; Bacillus thuringiensis var. pirenaica; Bacillus thuringiensis var. poloniensis; Bacillus thuringiensis var. pondicheriensis; Bacillus thuringiensis var. pulsiensis; Bacillus thuringiensis var. rongseni; Bacillus thuringiensis var. roskildiensis; Bacillus thuringiensis var. san diego; Bacillus thuringiensis var. seoulensis; Bacillus thuringiensis var. shandongiensis; Bacillus thuringiensis var. silo; Bacillus thuringiensis var. sinensis; Bacillus thuringiensis var. sooncheon; Bacillus thuringiensis var. sotto; Bacillus thuringiensis var. sotto/dendrolimus; Bacillus thuringiensis var. subtoxicus; Bacillus thuringiensis var. sumiyoshiensis; Bacillus thuringiensis var. sylvestriensis; Bacillus thuringiensis var. tenebrionis; Bacillus thuringiensis var. thailandensis; Bacillus thuringiensis var. thompsoni; Bacillus thuringiensis var. thuringiensis; Bacillus thuringiensis var. tochigiensis; Bacillus thuringiensis var. toguchini; Bacillus thuringiensis var. tohokuensis; Bacillus thuringiensis var. tolworthi; Bacillus thuringiensis var. toumanoffi; Bacillus thuringiensis var. vazensis; Bacillus thuringiensis var. wratislaviensis; Bacillus thuringiensis var. wuhanensis; Bacillus thuringiensis var. xiaguangiensis; Bacillus thuringiensis var. yosoo; Bacillus thuringiensis var. yunnanensis; Bacillus thuringiensis var. zhaodongensis; Bacillus thuringiensis str. Al Hakam; Bacillus thuringiensis T01-328; Bacillus thuringiensis YBT-1518; or Bacillus thuringiensis var. konkukian.

[0794] In some embodiments, a PFIP can be a Bacillus thuringiensis serovar. For example, in some embodiments, a PFIP can be a Bacillus thuringiensis serovar selected from the following group: Bacillus thuringiensis AKS-7; Bacillus thuringiensis Bt18247; Bacillus thuringiensis Bt18679; Bacillus thuringiensis Bt407; Bacillus thuringiensis DAR 81934; Bacillus thuringiensis DB27; Bacillus thuringiensis F14-1; Bacillus thuringiensis FC1; Bacillus thuringiensis FC10; Bacillus thuringiensis FC2; Bacillus thuringiensis FC6; Bacillus thuringiensis FC7; Bacillus thuringiensis FC8; Bacillus thuringiensis FC9; Bacillus thuringiensis HD-771; Bacillus thuringiensis HD-789; Bacillus thuringiensis HD1002; Bacillus thuringiensis IBL 200; Bacillus thuringiensis IBL 4222; Bacillus thuringiensis JM-Mgvxx-63; Bacillus thuringiensis LDC 391; Bacillus thuringiensis LM1212; Bacillus thuringiensis MC28; Bacillus thuringiensis Sbt003; Bacillus thuringiensis serovar aizawai; Bacillus thuringiensis serovar aizawai/pacificus; Bacillus thuringiensis serovar alesti; Bacillus thuringiensis serovar amagiensis; Bacillus thuringiensis serovar andalousiensis; Bacillus thuringiensis serovar argentinensis; Bacillus thuringiensis serovar asturiensis; Bacillus thuringiensis serovar azorensis; Bacillus thuringiensis serovar balearica; Bacillus thuringiensis serovar berliner; Bacillus thuringiensis serovar bolivia; Bacillus thuringiensis serovar brasilensis; Bacillus thuringiensis serovar cameroun; Bacillus thuringiensis serovar canadensis; Bacillus thuringiensis serovar chanpaisis; Bacillus thuringiensis serovar chinensis; Bacillus thuringiensis serovar colmeri; Bacillus thuringiensis serovar coreanensis; Bacillus thuringiensis serovar dakota; Bacillus thuringiensis serovar darmstadiensis; Bacillus thuringiensis serovar dendrolimus; Bacillus thuringiensis serovar entomocidus; Bacillus thuringiensis serovar entomocidus/subtoxicus; Bacillus thuringiensis serovar finitimus; Bacillus thuringiensis serovar fukuokaensis; Bacillus thuringiensis serovar galechiae; Bacillus thuringiensis serovar galleriae; Bacillus thuringiensis serovar graciosensis; Bacillus thuringiensis serovar guiyangiensis; Bacillus thuringiensis serovar higo; Bacillus thuringiensis serovar huazhongensis; Bacillus thuringiensis serovar iberica; Bacillus thuringiensis serovar indiana; Bacillus thuringiensis serovar israelensis; Bacillus thuringiensis serovar israelensis/tochigiensis; Bacillus thuringiensis serovar japonensis; Bacillus thuringiensis serovar jegathesan; Bacillus thuringiensis serovar jinghongiensis; Bacillus thuringiensis serovar kenyae; Bacillus thuringiensis serovar kim; Bacillus thuringiensis serovar kumamtoensis; Bacillus thuringiensis serovar kunthalanags3; Bacillus thuringiensis serovar kunthalaRX24; Bacillus thuringiensis serovar kunthalaRX27; Bacillus thuringiensis serovar kunthalaRX28; Bacillus thuringiensis serovar kurstaki; Bacillus thuringiensis serovar kyushuensis; Bacillus thuringiensis serovar leesis; Bacillus thuringiensis serovar londrina; Bacillus thuringiensis serovar malayensis; Bacillus thuringiensis serovar medellin; Bacillus thuringiensis serovar mexicanensis; Bacillus thuringiensis serovar mogi; Bacillus thuringiensis serovar monterrey; Bacillus thuringiensis serovar morrisoni; Bacillus thuringiensis serovar muju; Bacillus thuringiensis serovar navarrensis; Bacillus thuringiensis serovar neoleonensis; Bacillus thuringiensis serovar nigeriensis; Bacillus thuringiensis serovar novosibirsk; Bacillus thuringiensis serovar ostriniae; Bacillus thuringiensis serovar oswaldocruzi; Bacillus thuringiensis serovar pahangi; Bacillus thuringiensis serovar pakistani; Bacillus thuringiensis serovar palmanyolensis; Bacillus thuringiensis serovar pingluonsis; Bacillus thuringiensis serovar pirenaica; Bacillus thuringiensis serovar poloniensis; Bacillus thuringiensis serovar pondicheriensis; Bacillus thuringiensis serovar pulsiensis; Bacillus thuringiensis serovar rongseni; Bacillus thuringiensis serovar roskildiensis; Bacillus thuringiensis serovar san diego; Bacillus thuringiensis serovar seoulensis; Bacillus thuringiensis serovar shandongiensis; Bacillus thuringiensis serovar silo; Bacillus thuringiensis serovar sinensis; Bacillus thuringiensis serovar sooncheon; Bacillus thuringiensis serovar sotto; Bacillus thuringiensis serovar sotto/dendrolimus; Bacillus thuringiensis serovar subtoxicus; Bacillus thuringiensis serovar sumiyoshiensis; Bacillus thuringiensis serovar sylvestriensis; Bacillus thuringiensis serovar tenebrionis; Bacillus thuringiensis serovar thailandensis; Bacillus thuringiensis serovar thompsoni; Bacillus thuringiensis serovar thuringiensis; Bacillus thuringiensis serovar tochigiensis; Bacillus thuringiensis serovar toguchini; Bacillus thuringiensis serovar tohokuensis; Bacillus thuringiensis serovar tolworthi; Bacillus thuringiensis serovar toumanoffi; Bacillus thuringiensis serovar vazensis; Bacillus thuringiensis serovar wratislaviensis; Bacillus thuringiensis serovar wuhanensis; Bacillus thuringiensis serovar xiaguangiensis; Bacillus thuringiensis serovar yosoo; Bacillus thuringiensis serovar yunnanensis; Bacillus thuringiensis serovar zhaodongensis; Bacillus thuringiensis str. Al Hakam; Bacillus thuringiensis T01-328; Bacillus thuringiensis YBT-1518; and Bacillus thuringiensis serovar konkukian.

[0795] In some preferred embodiments, a PFIP can be a one of the following organisms: Bacillus thuringiensis. For example, in some embodiments, the PFIP can be isolated from Bacillus thuringiensis var. israelensis, Bacillus thuringiensis var. aizawai, Bacillus thuringiensis var. kurstaki, or Bacillus thuringiensis var. tenebrionensis.

[0796] In some embodiments, a PFIP can be a PFIP, wherein said PFIP is a protein isolated from Bacillus thuringiensis. For example, in some embodiments, the PFIP can be isolated from Bacillus thuringiensis var. israelensis, Bacillus thuringiensis var. aizawai, Bacillus thuringiensis var. kurstaki, or Bacillus thuringiensis var. tenebrionensis.

[0797] In some embodiments, the PFIP isolated from a Bacillus thuringiensis can be contained in a commercially available product. For example, in some embodiments, the commercially available product comprising a PFIP can be AQUABAC XT from Becker Microbial Products, Inc.; NOVODOR FC from VALENT U.S.A. LLC Agricultural Products; and/or BioProtec Plus from AEF Global Inc.

[0798] In some embodiments, a PFIP can be one or more toxins produced by Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 cells.

[0799] In some embodiments, a PFIP can be one or more fermentation solids, spores, and/or insecticidal toxins isolated from Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 cells.

[0800] In some embodiments, a PFIP can be one or more fermentation solids, spores, and/or insecticidal toxins isolated from Bacillus thuringiensis ssp. tenebrionis strain NB-176 cells.

[0801] In some embodiments, a PFIP can be one or more fermentation solids, spores, and/or insecticidal toxins isolated from Bacillus thuringiensis ssp. israelensis Strain BMP 144 cells.

[0802] In some embodiments, a PFIP can be AQUABAC XT, consisting of the following ingredients: 6-10% (8%) Bacillus thuringiensis ssp. israelensis Strain BMP 144 solids, spores & insecticidal toxins, wherein said insecticidal toxins are -endotoxins, and equivalent to 1,200 International Toxic Units (ITU/mg) (4.84 Billion ITU/gallon or 1.2 Billion ITU/Liter); and 92% other/inactive ingredients.

[0803] In some embodiments, a PFIP can be NOVODOR FC (or flowable concentrate), consisting of 10% Bacillus thuringiensis ssp. tenebrionis strain NB-176 fermentation solids and solubles, with a potency of 15,000 Leptinotarsa Units (LTU) per gram of product (equivalent to 16.3 Million LTU's per quart of product); and 90% other/inactive ingredients.

[0804] In some embodiments, a PFIP can be BioProtec Plus, consisting of 14.49% Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 fermentation solids, spores, and insecticidal toxins with a potency of 17,500 Cabbage Looper Units (CLU) per mg of product (equivalent to 76 billion CLU per gallon of product); and 85.51% other/inactive ingredients.

[0805] In some embodiments, a PFIP can be a 6-endotoxin (e.g., a Crystal (Cry) toxin and/or a cytolytic (Cyt) toxin); a vegetative insecticidal protein (Vip); a secreted insecticidal protein (Sip); or a Bin-like toxin.

[0806] In some embodiments, a PFIP has an amino acid sequence as set forth in SEQ ID NOs: 33-46, 49-533, or 1366-1552.

[0807] In some embodiments, a PFIP can be one or more of the following Cry proteins: Cry1Aa1, Cry1Aa2, Cry1Aa3, Cry1Aa4, Cry1Aa5, Cry1Aa6, Cry1Aa7, Cry1Aa8, Cry1Aa9, Cry1Aa10, Cry1Aa11, Cry1Aa12, Cry1Aa13, Cry1Aa14, Cry1Aa15, Cry1Aa16, Cry1Aa17, Cry1Aa18, Cry1Aa19, Cry1Aa20, Cry1Aa21, Cry1Aa22, Cry1Aa23, Cry1Aa24, Cry1Aa25, Cry1Ab1, Cry1Ab2, Cry1Ab3, Cry1Ab4, Cry1Ab5, Cry1Ab6, Cry1Ab7, Cry1Ab8, Cry1Ab9, Cry1Ab10, Cry1Ab11, Cry1Ab12, Cry1Ab13, Cry1Ab14, Cry1Ab15, Cry1Ab16, Cry1Ab17, Cry1Ab18, Cry1Ab19, Cry1Ab20, Cry1Ab21, Cry1Ab22, Cry1Ab23, Cry1Ab24, Cry1Ab25, Cry1Ab26, Cry1Ab27, Cry1Ab28, Cry1Ab29, Cry1Ab30, Cry1Ab31, Cry1Ab32, Cry1Ab33, Cry1Ab34, Cry1Ab35, Cry1Ab36, Cry1Ab-like, Cry1Ab-like, Cry1Ab-like, Cry1Ab-like, Cry1Ac1, Cry1Ac2, Cry1Ac3, Cry1Ac4, Cry1Ac5, Cry1Ac6, Cry1Ac7, Cry1Ac8, Cry1Ac9, Cry1Ac10, Cry1Ac11, Cry1Ac12, Cry1Ac13, Cry1Ac14, Cry1Ac15, Cry1Ac16, Cry1Ac17, Cry1Ac18, Cry1Ac19, Cry1Ac20, Cry1Ac21, Cry1Ac22, Cry1Ac23, Cry1Ac24, Cry1Ac25, Cry1Ac26, Cry1Ac27, Cry1Ac28, Cry1Ac29, Cry1Ac30, Cry1Ac31, Cry1Ac32, Cry1Ac33, Cry1Ac34, Cry1Ac35, Cry1Ac36, Cry1Ac37, Cry1Ac38, Cry1Ac39, Cry1Ad1, Cry1Ad2, Cry1Ae1, Cry1Af1, Cry1Ag1, Cry1Ah1, Cry1Ah2, Cry1Ah3, Cry1Ai1, Cry1Ai2, Cry1Aj1, Cry1A-like, Cry1Ba1, Cry1Ba2, Cry1Ba3, Cry1Ba4, Cry1Ba5, Cry1Ba6, Cry1Ba7, Cry1Ba8, Cry1Bb1, Cry1Bb2, Cry1Bb3, Cry1Bc1, Cry1Bd1, Cry1Bd2, Cry1Bd3, Cry1Be1, Cry1Be2, Cry1Be3, Cry1Be4, Cry1Be5, Cry1Bf1, Cry1Bf2, Cry1Bg1, Cry1Bh1, Cry1Bi1, Cry1Bj1, Cry1Ca1, Cry1Ca2, Cry1Ca3, Cry1Ca4, Cry1Ca5, Cry1Ca6, Cry1Ca7, Cry1Ca8, Cry1Ca9, Cry1Ca10, Cry1Ca11, Cry1Ca12, Cry1Ca13, Cry1Ca14, Cry1Ca15, Cry1Cb1, Cry1Cb2, Cry1Cb3, Cry1Cb-like, Cry1Da1, Cry1Da2, Cry1Da3, Cry1Da4, Cry1Da5, Cry1Db1, Cry1Db2, Cry1Dc1, Cry1Dd1, Cry1Ea1, Cry1Ea2, Cry1Ea3, Cry1Ea4, Cry1Ea5, Cry1Ea6, Cry1Ea7, Cry1Ea8, Cry1Ea9, Cry1Ea10, Cry1Ea11, Cry1Ea12, Cry1Eb1, Cry1Fa1, Cry1Fa2, Cry1Fa3, Cry1Fa4, Cry1Fb1, Cry1Fb2, Cry1Fb3, Cry1Fb4, Cry1Fb5, Cry1Fb6, Cry1Fb7, Cry1Ga1, Cry1Ga2, Cry1Gb1, Cry1Gb2, Cry1Gc1, Cry1Ha1, Cry1Hb1, Cry1Hb2, Cry1Hc1, Cry1H-like, Cry1Ia1, Cry1Ia2, Cry1Ia3, Cry1Ia4, Cry1Ia5, Cry1Ia6, Cry1Ia7, Cry1Ia8, Cry1Ia9, Cry1Ia10, Cry1Ia11, Cry1Ia12, Cry1Ia13, Cry1Ia14, Cry1Ia15, Cry1Ia16, Cry1Ia17, Cry1Ia18, Cry1Ia19, Cry1Ia20, Cry1Ia21, Cry1Ia22, Cry1Ia23, Cry1Ia24, Cry1Ia25, Cry1Ia26, Cry1Ia27, Cry1Ia28, Cry1Ia29, Cry1Ia30, Cry1Ia31, Cry1Ia32, Cry1Ia33, Cry1Ia34, Cry1Ia35, Cry1Ia36, Cry1Ia37, Cry1Ia38, Cry1Ia39, Cry1Ia40, Cry1Ib1, Cry1Ib2, Cry1Ib3, Cry1Ib4, Cry1Ib5, Cry1Ib6, Cry1Ib7, Cry1Ib8, Cry1Ib9, Cry1Ib10, Cry1Ib11, Cry1Ic1, Cry1Ic2, Cry1Id1, Cry1Id2, Cry1Id3, Cry1Ie1, Cry1Ie2, Cry1Ie3, Cry1Ie4, Cry1Ie5, Cry1If1, Cry1Ig1, Cry1I-like, Cry1I-like, Cry1Ja1, Cry1Ja2, Cry1Ja3, Cry1Jb1, Cry1Jc1, Cry1Jc2, Cry1Jd1, Cry1Ka1, Cry1Ka2, Cry1La1, Cry1La2, Cry1La3, Cry1Ma1, Cry1Ma2, Cry1Na1, Cry1Na2, Cry1Na3, Cry1Nb1, Cry1-like, Cry2Aa1, Cry2Aa2, Cry2Aa3, Cry2Aa4, Cry2Aa5, Cry2Aa6, Cry2Aa7, Cry2Aa8, Cry2Aa9, Cry2Aa10, Cry2Aa11, Cry2Aa12, Cry2Aa13, Cry2Aa14, Cry2Aa15, Cry2Aa16, Cry2Aa17, Cry2Aa18, Cry2Aa19, Cry2Aa20, Cry2Aa21, Cry2Aa22, Cry2Aa23, Cry2Aa23, Cry2Aa25, Cry2Ab1, Cry2Ab2, Cry2Ab3, Cry2Ab4, Cry2Ab5, Cry2Ab6, Cry2Ab7, Cry2Ab8, Cry2Ab9, Cry2Ab10, Cry2Ab11, Cry2Ab12, Cry2Ab13, Cry2Ab14, Cry2Ab15, Cry2Ab16, Cry2Ab17, Cry2Ab18, Cry2Ab19, Cry2Ab20, Cry2Ab21, Cry2Ab22, Cry2Ab23, Cry2Ab24, Cry2Ab25, Cry2Ab26, Cry2Ab27, Cry2Ab28, Cry2Ab29, Cry2Ab30, Cry2Ab31, Cry2Ab32, Cry2Ab33, Cry2Ab34, Cry2Ab35, Cry2Ab36, Cry2Ac1, Cry2Ac2, Cry2Ac3, Cry2Ac4, Cry2Ac5, Cry2Ac6, Cry2Ac7, Cry2Ac8, Cry2Ac9, Cry2Ac10, Cry2Ac11, Cry2Ac12, Cry2Ad1, Cry2Ad2, Cry2Ad3, Cry2Ad4, Cry2Ad5, Cry2Ae1, Cry2Af1, Cry2Af2, Cry2Ag1, Cry2Ah1, Cry2Ah2, Cry2Ah3, Cry2Ah4, Cry2Ah5, Cry2Ah6, Cry2Ai1, Cry2Aj1, Cry2Ak1, Cry2Al1, Cry2Ba1, Cry2Ba2, Cry3Aa1, Cry3Aa2, Cry3Aa3, Cry3Aa4, Cry3Aa5, Cry3Aa6, Cry3Aa7, Cry3Aa8, Cry3Aa9, Cry3Aa10, Cry3Aa11, Cry3Aa12, Cry3Ba1, Cry3Ba2, Cry3Ba3, Cry3Bb1, Cry3Bb2, Cry3Bb3, Cry3Ca1, Cry4Aa1, Cry4Aa2, Cry4Aa3, Cry4Aa4, Cry4A-like, Cry4Ba1, Cry4Ba2, Cry4Ba3, Cry4Ba4, Cry4Ba5, Cry4Ba-like, Cry4Ca1, Cry4Ca2, Cry4Cb1, Cry4Cb2, Cry4Cb3, Cry4Cc1, Cry5Aa1, Cry5Ab1, Cry5Ac1, Cry5Ad1, Cry5Ba1, Cry5Ba2, Cry5Ba3, Cry5Ca1, Cry5Ca2, Cry5Da1, Cry5Da2, Cry5Ea1, Cry5Ea2, Cry6Aa1, Cry6Aa2, Cry6Aa3, Cry6Ba1, Cry7Aa1, Cry7Aa2, Cry7Ab1, Cry7Ab2, Cry7Ab3, Cry7Ab4, Cry7Ab5, Cry7Ab6, Cry7Ab7, Cry7Ab8, Cry7Ab9, Cry7Ac1, Cry7Ba1, Cry7Bb1, Cry7Ca1, Cry7Cb1, Cry7Da1, Cry7Da2, Cry7Da3, Cry7Ea1, Cry7Ea2, Cry7Ea3, Cry7Fa1, Cry7Fa2, Cry7Fb1, Cry7Fb2, Cry7Fb3, Cry7Ga1, Cry7Ga2, Cry7Gb1, Cry7Gc1, Cry7Gd1, Cry7Ha1, Cry7Ia1, Cry7Ja1, Cry7Ka1, Cry7Kb1, Cry7La1, Cry8Aa1, Cry8Ab1, Cry8Ac1, Cry8Ad1, Cry8Ba1, Cry8Bb1, Cry8Bc1, Cry8Ca1, Cry8Ca2, Cry8Ca3, Cry8Ca4, Cry8Ca5, Cry8Da1, Cry8Da2, Cry8Da3, Cry8Db1, Cry8Ea1, Cry8Ea2, Cry8Ea3, Cry8Ea4, Cry8Ea5, Cry8Ea6, Cry8Fa1, Cry8Fa2, Cry8Fa3, Cry8Fa4, Cry8Ga1, Cry8Ga2, Cry8Ga3, Cry8Ha1, Cry8Hb1, Cry8Ia1, Cry8Ia2, Cry8Ia3, Cry8Ia4, Cry8Ib1, Cry8Ib2, Cry8Ib3, Cry8Ja1, Cry8Ka1, Cry8Ka2, Cry8Ka3, Cry8Kb1, Cry8Kb2, Cry8Kb3, Cry8La1, Cry8Ma1, Cry8Ma2, Cry8Ma3, Cry8Na1, Cry8Pa1, Cry8Pa2, Cry8Pa3, Cry8Qa1, Cry8Qa2, Cry8Ra1, Cry8Sa1, Cry8Ta1, Cry8-like, Cry8-like, Cry9Aa1, Cry9Aa2, Cry9Aa3, Cry9Aa4, Cry9Aa5, Cry9Aa, like, Cry9Ba1, Cry9Ba2, Cry9Bb1, Cry9Ca1, Cry9Ca2, Cry9Cb1, Cry9Da1, Cry9Da2, Cry9Da3, Cry9Da4, Cry9Db1, Cry9Dc1, Cry9Ea1, Cry9Ea2, Cry9Ea3, Cry9Ea4, Cry9Ea5, Cry9Ea6, Cry9Ea7, Cry9Ea8, Cry9Ea9, Cry9Ea10, Cry9Ea11, Cry9Eb1, Cry9Eb2, Cry9Eb3, Cry9Ec1, Cry9Ed1, Cry9Ee1, Cry9Ee2, Cry9Fa1, Cry9Ga1, Cry9-like, Cry10Aa1, Cry10Aa2, Cry10Aa3, Cry10Aa4, Cry10A-like, Cry11Aa1, Cry11Aa2, Cry11Aa3, Cry11Aa4, Cry11Aa5, Cry11Aa-like, Cry11Ba1, Cry11Bb1, Cry11Bb2, Cry12Aa1, Cry13Aa1, Cry13Aa2, Cry14Aa1, Cry14Ab1, Cry15Aa1, Cry16Aa1, Cry17Aa1, Cry18Aa1, Cry18Ba1, Cry18Ca1, Cry19Aa1, Cry19Ba1, Cry19Ca1, Cry20Aa1, Cry20Ba1, Cry20Ba2, Cry20-like, Cry21Aa1, Cry21Aa2, Cry21Aa3, Cry21Ba1, Cry21Ca1, Cry21Ca2, Cry21Da1, Cry21Ea1, Cry21Fa1, Cry21Ga1, Cry21Ha1, Cry22Aa1, Cry22Aa2, Cry22Aa3, Cry22Ab1, Cry22Ab2, Cry22Ba1, Cry22Bb1, Cry23Aa1, Cry24Aa1, Cry24Ba1, Cry24Ca1, Cry24Da1, Cry25Aa1, Cry26Aa1, Cry27Aa1, Cry28Aa1, Cry28Aa2, Cry29Aa1, Cry29Ba1, Cry30Aa1, Cry30Ba1, Cry30Ca1, Cry30Ca2, Cry30Da1, Cry30Db1, Cry30Ea1, Cry30Ea2, Cry30Ea3, Cry30Ea4, Cry30Fa1, Cry30Ga1, Cry30Ga2, Cry31Aa1, Cry31Aa2, Cry31Aa3, Cry31Aa4, Cry31Aa5, Cry31Aa6, Cry31Ab1, Cry31Ab2, Cry31Ac1, Cry31Ac2, Cry31Ad1, Cry31Ad2, Cry32Aa1, Cry32Aa2, Cry32Ab1, Cry32Ba1, Cry32Ca1, Cry32Cb1, Cry32Da1, Cry32Ea1, Cry32Ea2, Cry32Eb1, Cry32Fa1, Cry32Ga1, Cry32Ha1, Cry32Hb1, Cry32Ia1, Cry32Ja1, Cry32Ka1, Cry32La1, Cry32Ma1, Cry32Mb1, Cry32Na1, Cry32a1, Cry32Pa1, Cry32Qa1, Cry32Ra1, Cry32Sa1, Cry32Ta1, Cry32Ua1, Cry32Va1, Cry32Wa1, Cry32Wa2, Cry32Xa1, Cry32Ya1, Cry33Aa1, Cry34Aa1, Cry34Aa2, Cry34Aa3, Cry34Aa4, Cry34Ab1, Cry34Ac1, Cry34Ac2, Cry34Ac3, Cry34Ba1, Cry34Ba2, Cry34Ba3, Cry35Aa1, Cry35Aa2, Cry35Aa3, Cry35Aa4, Cry35Ab1, Cry35Ab2, Cry35Ab3, Cry35Ac1, Cry35Ba1, Cry35Ba2, Cry35Ba3, Cry36Aa1, Cry37Aa1, Cry38Aa1, Cry39Aa1, Cry40Aa1, Cry40Ba1, Cry40Ca1, Cry40Da1, Cry41Aa1, Cry41Ab1, Cry41Ba1, Cry41Ba2, Cry41Ca1, Cry42Aa1, Cry43Aa1, Cry43Aa2, Cry43Ba1, Cry43Ca1, Cry43Cb1, Cry43Cc1, Cry43-like, Cry44Aa1, Cry45Aa1, Cry45Ba1, Cry46Aa1, Cry46Aa2, Cry46Ab1, Cry47Aa1, Cry48Aa1, Cry48Aa2, Cry48Aa3, Cry48Ab1, Cry48Ab2, Cry49Aa1, Cry49Aa2, Cry49Aa3, Cry49Aa4, Cry49Ab1, Cry50Aa1, Cry50Ba1, Cry50Ba2, Cry51Aa1, Cry51Aa2, Cry52Aa1, Cry52Ba1, Cry52Ca1, Cry53Aa1, Cry53Ab1, Cry54Aa1, Cry54Aa2, Cry54Ab1, Cry54Ba1, Cry54Ba2, Cry55Aa1, Cry55Aa2, Cry55Aa3, Cry56Aa1, Cry56Aa2, Cry56Aa3, Cry56Aa4, Cry57Aa1, Cry57Ab1, Cry58Aa1, Cry59Ba1, Cry59Aa1, Cry60Aa1, Cry60Aa2, Cry60Aa3, Cry60Ba1, Cry60Ba2, Cry60Ba3, Cry61Aa1, Cry61Aa2, Cry61Aa3, Cry62Aa1, Cry63Aa1, Cry64Aa1, Cry64Ba1, Cry64Ca1, Cry65Aa1, Cry65Aa2, Cry66Aa1, Cry66Aa2, Cry67Aa1, Cry67Aa2, Cry68Aa1, Cry69Aa1, Cry69Aa2, Cry69Ab1, Cry70Aa1, Cry70Ba1, Cry70Bb1, Cry71Aa1, Cry72Aa1, Cry72Aa2, Cry73Aa1, Cry74Aa, Cry75Aa1, Cry75Aa2, Cry75Aa3, Cry76Aa1, Cry77Aa1, and/or Cry78Aa1.

[0808] In some embodiments, a mixture comprising one or more PFIPs and one or more CRIPs, can have one or more of the PFIPs be a Cry toxin as described herein, or presented in Table 7.

TABLE-US-00045 TABLE 7 Non-limiting examples of Cry toxins, their accession numbers on NCBI, and strain. Here, if a cell is left blank, then the accession number and/or strain is not applicable. Name NCBI Accession No. Strain/Other ID Cry1Aa1 AAA22353 Bt kurstaki HD1 Cry1Aa2 AAA22552 Bt sotto Cry1Aa3 BAA00257 Bt aizawai IPL7 Cry1Aa4 CAA31886 Bt entomocidus Cry1Aa5 BAA04468 Bt Fu-2-7 Cry1Aa6 AAA86265 Bt kurstaki NRD-12 Cry1Aa7 AAD46139 Bt C12 Cry1Aa8 I26149 Cry1Aa9 BAA77213 Bt dendrolimus T84A1 Cry1Aa10 AAD55382 Bt kurstaki HD-1-02 Cry1Aa11 CAA70856 Bt kurstaki Cry1Aa12 AAP80146 Bt Ly30 Cry1Aa13 AAM44305 Bt sotto Cry1Aa14 AAP40639 unpublished Cry1Aa15 AAY66993 Bt INTA Mol-12 Cry1Aa16 HQ439776 Bt Ps9-E2 Cry1Aa17 HQ439788 Bt PS9-C12 Cry1Aa18 HQ439790 Bt PS9-D12 Cry1Aa19 HQ685121 Bt LS-R-21 Cry1Aa20 JF340156 Bt SK-798 Cry1Aa21 JN651496 Bt LTS-209 Cry1Aa22 KC158223 Bt Lip Cry1Aa23 KJ125392 Bt Cry1Aa24 AGH68331 Btk NAIMCC-B-00167 Cry1Aa25 MK391629 Bt MPUB5 Cry1Ab1 AAA22330 Bt berliner 1715 Cry1Ab2 AAA22613 Bt kurstaki Cry1Ab3 AAA22561 Bt kurstaki HD1 Cry1Ab4 BAA00071 Bt kurstaki HD1 Cry1Ab5 CAA28405 Bt berliner 1715 Cry1Ab6 AAA22420 Bt kurstaki NRD-12 Cry1Ab7 CAA31620 Bt aizawai IC1 Cry1Ab8 AAA22551 Bt aizawai IPL7 Cry1Ab9 CAA38701 Bt aizawai HD133 Cry1Ab10 A29125 Bt kurstaki HD1 Cry1Ab11 I12419 Bt A20 Cry1Ab12 AAC64003 Bt kurstaki S93 Cry1Ab13 AAN76494 Bt c005 Cry1Ab14 AAG16877 Native Chilean Bt Cry1Ab15 AAO13302 Bt B-Hm-16 Cry1Ab16 AAK55546 Bt AC-11 Cry1Ab17 AAT46415 Bt WB9 Cry1Ab18 AAQ88259 Bt Cry1Ab19 AAW31761 Bt X-2 Cry1Ab20 ABB72460 BtC008 Cry1Ab21 ABS18384 Bt IS5056 Cry1Ab22 ABW87320 BtS2491Ab Cry1Ab23 HQ439777 Bt N32-2-2 Cry1Ab24 HQ439778 Bt HD12 Cry1Ab25 HQ685122 Bt LS-R-30 Cry1Ab26 HQ847729 DOR BT-1 Cry1Ab27 JN135249 Cry1Ab28 JN135250 Cry1Ab29 JN135251 Cry1Ab30 JN135252 Cry1Ab31 JN135253 Cry1Ab32 JN135254 Cry1Ab33 AAS93798 Bt kenyae K3 Cry1Ab34 KC156668 ARP102 Cry1Ab35 KT692985 Bt GS36 Cry1Ab36 KY440260 Bt NEAUB-X5 Cry1Ab-like AAK14336 Bt kunthala RX24 Cry1Ab-like AAK14337 Bt kunthala RX28 Cry1Ab-like AAK14338 Bt kunthala RX27 Cry1Ab-like ABG88858 Bt ly4a3 Cry1Ac1 AAA22331 Bt kurstaki HD73 Cry1Ac2 AAA22338 Bt kenyae Cry1Ac3 CAA38098 Bt BTS89A Cry1Ac4 AAA73077 Bt kurstaki PS85A1 Cry1Ac5 AAA22339 Bt kurstaki PS81GG Cry1Ac6 AAA86266 Bt kurstaki NRD-12 Cry1Ac7 AAB46989 Bt kurstaki HD73 Cry1Ac8 AAC44841 Bt kurstaki HD73 Cry1Ac9 AAB49768 Bt DSIR732 Cry1Ac10 CAA05505 Bt kurstaki YBT-1520 Cry1Ac11 CAA10270 Cry1Ac12 I12418 Bt A20 Cry1Ac13 AAD38701 Bt kurstaki HD1 Cry1Ac14 AAQ06607 Bt Ly30 Cry1Ac15 AAN07788 Bt from Taiwan Cry1Ac16 AAU87037 Bt H3 Cry1Ac17 AAX18704 Bt kenyae HD549 Cry1Ac18 AAY88347 Bt SK-729 Cry1Ac19 ABD37053 Bt C-33 Cry1Ac20 ABB89046 Cry1Ac21 AAY66992 INTA Mol-12 Cry1Ac22 ABZ01836 Bt W015-1 Cry1Ac23 CAQ30431 Bt Cry1Ac24 ABL01535 Bt 146-158-01 Cry1Ac25 FJ513324 Bt Tm37-6 Cry1Ac26 FJ617446 Bt Tm41-4 Cry1Ac27 FJ617447 Bt Tm44-lB Cry1Ac28 ACM90319 Bt Q-12 Cry1Ac29 DQ438941 INTA TA24-6 Cry1Ac30 GQ227507 Bt S1478-1 Cry1Ac31 GU446674 Bt S3299-1 Cry1Ac32 HM061081 Bt ZQ-89 Cry1Ac33 GQ866913 Bt SK-711 Cry1Ac34 HQ230364 Bt SK-783 Cry1Ac35 JF340157 Bt SK-784 Cry1Ac36 JN387137 Bt SK-958 Cry1Ac37 JQ317685 Bt SK-793 Cry1Ac38 ACC86135 Bt LSZ9408 Cry1Ac39 ALT07695 LBIT1200 Cry1Ad1 AAA22340 Bt aizawai PS81I Cry1Ad2 CAA01880 Bt PS81RR1 Cry1Ae1 AAA22410 Bt alesti Cry1Af1 AAB82749 Bt NT0423 Cry1Ag1 AAD46137 Cry1Ah1 AAQ14326 Cry1Ah2 ABB76664 Bt alesti Cry1Ah3 HQ439779 Bt S6 Cry1Ai1 AAO39719 Cry1Ai2 HQ439780 Bt SC6H8 Cry1Aj1 KJ28846 Cry1A-like AAK14339 Bt kunthala nags3 Cry1Ba1 CAA29898 Bt thuringiensis HD2 Cry1Ba2 CAA65003 Bt entomocidus HD110 Cry1Ba3 AAK63251 Cry1Ba4 AAK51084 Bt entomocidus HD9 Cry1Ba5 ABO20894 Bt sfw-12 Cry1Ba6 ABL60921 Bt S601 Cry1Ba7 HQ439781 Bt N17-37 Cry1Ba8 KJ868173 Bt Na205-3 Cry1Bb1 AAA22344 Bt EG5847 Cry1Bb2 HQ439782 Bt WBT-2 Cry1Bb3 KJ619659 Bt FH21 Cry1Bc1 CAA86568 Bt morrisoni Cry1Bd1 AAD10292 Bt wuhanensis HD525 Cry1Bd2 AAM93496 Bt 834 Cry1Bd3 KX398132 Bt K4 Cry1Be1 AAC32850 Bt PS158C2 Cry1Be2 AAQ52387 Cry1Be3 ACV96720 Bt g9 Cry1Be4 HM070026 Cry1Be5 KU761578 Bt LBR2 Cry1Bf1 CAC50778 Cry1Bf2 AAQ52380 Cry1Bg1 AAO39720 Cry1Bh1 HQ589331 Bt PS46L Cry1Bi1 KC156700 ARP260 Cry1Bj1 KT952325 Bt Cry1Ca1 CAA30396 Bt entomocidus 60.5 Cry1Ca2 CAA31951 Bt aizawai 7.29 Cry1Ca3 AAA22343 Bt aizawai PS81I Cry1Ca4 CAA01886 Bt entomocidus HD110 Cry1Ca5 CAA65457 Bt aizawai 7.29 Cry1Ca6 [1] AAF37224 Bt AF-2 Cry1Ca7 AAG50438 Bt J8 Cry1Ca8 AAM00264 Bt c002 Cry1Ca9 AAL79362 Bt G10-01A Cry1Ca10 AAN16462 Bt E05-20a Cry1Ca11 AAX53094 Bt C-33 Cry1Ca12 HM070027 mo3-E7 Cry1Ca13 HQ412621 Bt LB-R-78 Cry1Ca14 JN651493 Bt LTS-38 Cry1Ca15 MK391630 Bt MPU B5 Cry1Cb1 M97880 Bt galleriae HD29 Cry1Cb2 AAG35409 Bt c001 Cry1Cb3 ACD50894 Bt 087 Cry1Cb-like AAX63901 Bt TA476-1 Cry1Da1 CAA38099 Bt aizawai HD68 Cry1Da2 I76415 Cry1Da3 HQ439784 Bt HD12 Cry1Da4 KJ619660 Bt FH21 Cry1Da5 MG181949 QL75-2 Cry1Db1 CAA80234 Bt BTS00349A Cry1Db2 AAK48937 Bt B-Pr-88 Cry1Dc1 ABK35074 Bt JC291 Cry1Dd1 KJ28844 Cry1Ea1 CAA37933 Bt kenyae 4F1 Cry1Ea2 CAA39609 Bt kenyae Cry1Ea3 AAA22345 Bt kenyae PS81F Cry1Ea4 AAD04732 Bt kenyae LBIT-147 Cry1Ea5 A15535 Cry1Ea6 AAL50330 Bt YBT-032 Cry1Ea7 AAW72936 Bt JC190 Cry1Ea8 ABX11258 Bt HZM2 Cry1Ea9 HQ439785 Bt S6 Cry1Ea10 ADR00398 Bt BR64 Cry1Ea11 JQ652456 Bt Cry1Ea12 KF601559 Bt strain V4 Cry1Eb1 AAA22346 Bt aizawai PS81A2 Cry1Fa1 AAA22348 Bt aizawai EG6346 Cry1Fa2 AAA22347 Bt aizawai PS81I Cry1Fa3 HM070028 Bt mo3-D8 Cry1Fa4 HM439638 Bt mo3-D10 Cry1Fb1 CAA80235 Bt BTS00349A Cry1Fb2 BAA25298 Bt morrisoni INA67 Cry1Fb3 AAF21767 Bt morrisoni Cry1Fb4 AAC10641 Cry1Fb5 AAO13295 Bt B-Pr-88 Cry1Fb6 ACD50892 Bt 012 Cry1Fb7 ACD50893 Bt 087 Cry1Ga1 CAA80233 Bt BTS0349A Cry1Ga2 CAA70506 Bt wuhanensis Cry1Gb1 AAD10291 Bt wuhanensis HD525 Cry1Gb2 AAO13756 Bt B-Pr-88 Cry1Gc1 AAQ52381 Cry1Ha1 CAA80236 Bt BTS02069AA Cry1Hb1 AAA79694 Bt morrisoni BF190 Cry1Hb2 HQ439786 Bt WBT-2 Cry1Hc1 KJ28845 Cry1H-like AAF01213 Bt JC291 Cry1Ia1 CAA44633 Bt kurstaki Cry1Ia2 AAA22354 Bt kurstaki Cry1Ia3 AAC36999 Bt kurstaki HD1 Cry1Ia4 AAB00958 Bt AB88 Cry1Ia5 CAA70124 Bt 61 Cry1Ia6 AAC26910 Bt kurstaki S101 Cry1Ia7 AAM73516 Bt Cry1Ia8 AAK66742 Cry1Ia9 AAQ08616 Bt Ly30 Cry1Ia10 AAP86782 Bt thuringiensis Cry1Ia11 CAC85964 Bt kurstaki BNS3 Cry1Ia12 AAV53390 Bt Cry1Ia13 ABF83202 Bt Cry1Ia14 ACG63871 Bt11 Cry1Ia15 FJ617445 Bt E-1B Cry1Ia16 FJ617448 Bt E-1A Cry1Ia17 GU989199 Bt MX2 Cry1Ia18 ADK23801 Bt MX9 Cry1Ia19 HQ439787 Bt SC6H6 Cry1Ia20 JQ228426 Bt wu1H-3 Cry1Ia21 JQ228424 Bt you1D-9 Cry1Ia22 JQ228427 Bt wu1E-3 Cry1Ia23 JQ228428 Bt wu1E-4 Cry1Ia24 JQ228429 Bt wu2B-6 Cry1Ia25 JQ228430 Bt wu2G-11 Cry1Ia26 JQ228431 Bt wu2G-12 Cry1Ia27 JQ228432 Bt you2D-3 Cry1Ia28 JQ228433 Bt you2E-3 Cry1Ia29 JQ228434 Bt you2F-3 Cry1Ia30 JQ317686 Bt 4J4 Cry1Ia31 JX944038 Bt SC-7 Cry1Ia32 JX944039 Bt SC-13 Cry1Ia33 JX944040 Bt SC-51 Cry1Ia34 KJ868171 Bt Na205-3 Cry1Ia35 AIF79803 Bt V4 Cry1Ia36 KY212747 Bt YC-10 Cry1Ia37 MG674828 Bt SY80 Cry1Ia38 MG584186 Cry1Ia39 MK393238 Bt INTA H4-3 Cry1Ia40 MK391631 Bt MPU B9 Cry1Ib1 AAA82114 Bt entomocidus BP465 Cry1Ib2 ABW88019 Bt PP61 Cry1Ib3 ACD75515 Bt GS8 Cry1Ib4 HM051227 Bt BF-4 Cry1Ib5 HM070028 Bt mo3-D8 Cry1Ib6 ADK38579 Bt LB52 Cry1Ib7 JN571740 Bt SK-935 Cry1Ib8 JN675714 Cry1Ib9 JN675715 Cry1Ib10 JN675716 Cry1Ib11 JQ228423 Bt HD12 Cry1Ic1 AAC62933 Bt C18 Cry1Ic2 AAE71691 Cry1Id1 AAD44366 Cry1Id2 JQ228422 Bt HD12 Cry1Id3 KJ619661 Bt FH21 Cry1Ie1 AAG43526 Bt BTC007 Cry1Ie2 HM439636 Bt T03B001 Cry1Ie3 KC156647 ARP058 Cry1Ie4 KC156681 ARP131 Cry1Ie5 KJ710646 BN23-5 Cry1If1 AAQ52382 Cry1Ig1 KC156701 ARP166 Cry1I-like AAC31094 Cry1I-like ABG88859 Bt ly4a3 Cry1Ja1 AAA22341 Bt EG5847 Cry1Ja2 HM070030 WBT-1 Cry1Ja3 JQ228425 Bt FH21 Cry1Jb1 AAA98959 Bt EG5092 Cry1Jc1 AAC31092 Cry1Jc2 AAQ52372 Cry1Jd1 CAC50779 Bt Cry1Ka1 AAB00376 Bt morrisoni BF190 Cry1Ka2 HQ439783 Bt WBT-2 Cry1La1 AAS60191 Bt kurstaki K1 Cry1La2 HM070031 Bt SC6H8 Cry1La3 KT692983 Bt GS27 Cry1Ma1 FJ884067 LBIT 1189 Cry1Ma2 KC156659 ARP080 Cry1Na1 KC156648 ARP009 Cry1Na2 AEH31422 Bt T03B001 Cry1Na3 AKQ08661 Bt BRC-ZYR2 Cry1Nb1 KC156678 ARP146 Cry1-like AAC31091 Cry2Aa1 AAA22335 Bt kurstaki Cry2Aa2 AAA83516 Bt kurstaki HD1 Cry2Aa3 D86064 Bt sotto Cry2Aa4 AAC04867 Bt kenyae HD549 Cry2Aa5 CAA10671 Bt SL39 Cry2Aa6 CAA10672 Bt YZ71 Cry2Aa7 CAA10670 Bt CY29 Cry2Aa8 AAO13734 Bt Dongbei 66 Cry2Aa9 AAO13750 Cry2Aa10 AAQ04263 Cry2Aa11 AAQ52384 Cry2Aa12 ABI83671 Bt Rpp39 Cry2Aa13 ABL01536 Bt 146-158-01 Cry2Aa14 ACF04939 Bt HD-550 Cry2Aa15 JN426947 Bt SSy77 Cry2Aa16 KF667522 Bt V4 Cry2Aa17 KF860848 Cry2Aa18 ANF99565 Bt SY49.1 Cry2Aa19 MG983752 Bt-T32 Cry2Aa20 MG983753 Bt-T405 Cry2Aa21 MG983754 Bt-T414 Cry2Aa22 MH475904 Bt-T527 Cry2Aa23 MH475905 Bt-T532 Cry2Aa23 MH475906 Bt-T536 Cry2Aa25 MH475907 Bt-T543 Cry2Ab1 AAA22342 Bt kurstaki HD1 Cry2Ab2 CAA39075 Bt kurstaki HD1 Cry2Ab3 AAG36762 Bt BTC002 Cry2Ab4 AAO13296 Bt B-Pr-88 Cry2Ab5 AAQ04609 Bt ly30 Cry2Ab6 AAP59457 Bt WZ-7 Cry2Ab7 AAZ66347 Bt 14-1 Cry2Ab8 ABC95996 Bt WB2 Cry2Ab9 ABC74968 Bt LLB6 Cry2Ab10 ABM21766 Bt LyL Cry2Ab11 CAM84575 Bt CMBL-BT1 Cry2Ab12 ABM21764 Bt LyD Cry2Ab13 ACG76120 Bt ywc5-4 Cry2Ab14 ACG76121 Bt Bts Cry2Ab15 HM037126 Bt BF-4 Cry2Ab16 GQ866914 SK-793 Cry2Ab17 HQ439789 Bt PS9-C12 Cry2Ab18 JN135255 Cry2Ab19 JN135256 Cry2Ab20 JN135257 Cry2Ab21 JN135258 Cry2Ab22 JN135259 Cry2Ab23 JN135260 Cry2Ab24 JN135261 Cry2Ab25 JN415485 Btk MnD Cry2Ab26 JN426946 Bt SSy77 Cry2Ab27 JN415764 Cry2Ab28 JN651494 Bt LTS-7 Cry2Ab29 KF860847 Cry2Ab30 EU623976 Bt LSZ9408 Cry2Ab31 AHM93475 Bt HTS-S-38 Cry2Ab32 KJ710647 BN23-5 Cry2Ab33 KP053646 Bt CYZ-4 Cry2Ab34 KX236449 Bt BJH406 Cry2Ab35 KY212748 Bt YC-10 Cry2Ab36 MK391632 MPU B5 Cry2Ac1 CAA40536 Bt shanghai S1 Cry2Ac2 AAG35410 Cry2Ac3 AAQ52385 Cry2Ac4 ABC95997 Bt WB9 Cry2Ac5 ABC74969 Cry2Ac6 ABC74793 Bt wuhanensis Cry2Ac7 CAL18690 Bt SBSBT-1 Cry2Ac8 CAM09325 Bt CMBL-BT1 Cry2Ac9 CAM09326 Bt CMBL-BT2 Cry2Ac10 ABN15104 Bt QCL-1 Cry2Ac11 CAM83895 Bt HD29 Cry2Ac12 CAM83896 Bt CMBL-BT3 Cry2Ad1 AAF09583 Bt BR30 Cry2Ad2 ABC86927 Bt WB10 Cry2Ad3 CAK29504 Bt 5_2AcT(1) Cry2Ad4 CAM32331 Bt CMBL-BT2 Cry2Ad5 CAO78739 Bt HD29 Cry2Ae1 AAQ52362 Cry2Af1 ABO30519 Bt C81 Cry2Af2 GQ866915 SK-758 Cry2Ag1 ACH91610 Bt JF19-2 Cry2Ah1 EU939453 Bt SC6H8 Cry2Ah2 ACL80665 Bt BRC-ZQL3 Cry2Ah3 GU073380 HYW-8 Cry2Ah4 KC156702 ARP193 Cry2Ah5 KT692984 Bt GS3 Cry2Ah6 KX034204 Cry2Ai1 FJ788388 Bt Cry2Aj1 Cry2Ak1 KC156660 ARP067 Cry2Al1 KJ149819 Bt SWK1 Cry2Ba1 KC156658 ARP026 Cry2Ba2 KF014123 HD395 Cry3Aa1 AAA22336 Bt san diego Cry3Aa2 AAA22541 Bt tenebrionis Cry3Aa3 CAA68482 Cry3Aa4 AAA22542 Bt tenebrionis Cry3Aa5 AAA50255 Bt morrisoni EG2158 Cry3Aa6 AAC43266 Bt tenebrionis Cry3Aa7 CAB41411 Bt 22 Cry3Aa8 AAS79487 Bt YM-03 Cry3Aa9 AAW05659 Bt UTD-001 Cry3Aa10 AAU29411 Bt 886 Cry3Aa11 AAW82872 Bt tenebrionis Mm2 Cry3Aa12 ABY49136 Bt tenebrionis Cry3Ba1 CAA34983 Bt tolworthi 43F Cry3Ba2 CAA00645 Bt PGSI208 Cry3Ba3 JQ397327 Bt ML090 Cry3Bb1 AAA22334 Bt EG4961 Cry3Bb2 AAA74198 Bt EG5144 Cry3Bb3 I15475 Cry3Ca1 CAA42469 Bt kurstaki BtI109P Cry4Aa1 CAA68485 Bt israelensis Cry4Aa2 BAA00179 Bt israelensis HD522 Cry4Aa3 CAD30148 Bt israelensis Cry4Aa4 AFB18317 Bti BRC-LLP29 Cry4A-like AAY96321 Bt LDC-9 Cry4Ba1 CAA30312 Bt israelensis 4Q2-72 Cry4Ba2 CAA30114 Bt israelensis Cry4Ba3 AAA22337 Bt israelensis Cry4Ba4 BAA00178 Bt israelensis HD522 Cry4Ba5 CAD30095 Bt israelensis Cry4Ba-like ABC47686 Bt LDC-9 Cry4Ca1 EU646202 Bt Y41 Cry4Ca2 KM053252 Bt SK700 Cry4Cb1 FJ403208 Bt HS18-1 Cry4Cb2 FJ597622 Bt Ywc2-8 Cry4Cb3 AHG25301 Bt S2160-1 Cry4Cc1 FJ403207 Bt MC28 Cry5Aa1 AAA67694 Bt darmstadiensis PS17 Cry5Ab1 AAA67693 Bt darmstadiensis PS17 Cry5Ac1 I34543 Cry5Ad1 ABQ82087 Bt L366 Cry5Ba1 AAA68598 Bt PS86Q3 Cry5Ba2 ABW88931 YBT 1518 Cry5Ba3 AFJ04417 Bt zjfc85 Cry5Ca1 HM461869 Sbt003 Cry5Ca2 ZP_04123426 Bt T13001 Cry5Da1 HM461870 Sbt003 Cry5Da2 ZP_04123980 Bt T13001 Cry5Ea1 HM485580 Sbt003 Cry5Ea2 ZP_04124038 Bt T13001 Cry6Aa1 AAA22357 Bt PS52A1 Cry6Aa2 AAM46849 YBT 1518 Cry6Aa3 ABH03377 Bt 96418 Cry6Ba1 AAA22358 Bt PS69D1 Cry7Aa1 AAA22351 Bt galleriae PGSI245 Cry7Aa2 MK840959 Bt BM311.1 Cry7Ab1 AAA21120 Bt dakota HD511 Cry7Ab2 AAA21121 Bt kumamotoensis 867 Cry7Ab3 ABX24522 Bt WZ-9 Cry7Ab4 EU380678 Bt HQ122 Cry7Ab5 ABX79555 Bt monterrey GM-33 Cry7Ab6 ACI44005 Bt HQ122 Cry7Ab7 ADB89216 Bt GW6 Cry7Ab8 GU145299 Cry7Ab9 ADD92572 Bt QG-121 Cry7Ac1 KJ789922 Bt QZL20-1 Cry7Ba1 ABB70817 Bt huazhongensis Cry7Bb1 KC156653 ARP013 Cry7Ca1 ABR67863 Bt BTH-13 Cry7Cb1 KC156698 ARP269 Cry7Da1 ACQ99547 Bt LH-2 Cry7Da2 HM572236 Cry7Da3 KC156679 ARP140 Cry7Ea1 HM035086 Sbt009 Cry7Ea2 HM132124 HD868(D8) Cry7Ea3 EEM19403 BGSC 4Y1 Cry7Fa1 HM035088 SBt009 Cry7Fa2 EEM 19090 BGSC 4Y1 Cry7Fb1 HM572235 Bt Cry7Fb2 KC156682 ARP162 Cry7Fb3 HM572235 Cry7Ga1 HM572237 Bt Cry7Ga2 KC156669 ARP103 Cry7Gb1 KC156650 ARP011 Cry7Gc1 KC156654 ARP012 Cry7Gd1 KC156697 ARP271 Cry7Ha1 KC156651 ARP021 Cry7Ia1 KC156665 ARP112 Cry7Ja1 KC156671 ARP114 Cry7Ka1 KC156680 ARP171 Cry7Kb1 BAM99306 Bt dakota Cry7La1 BAM99307 Bt dakota Cry8Aa1 AAA21117 Bt kumamotoensis Cry8Ab1 EU044830 Bt B-JJX Cry8Ac1 KC156662 ARP068 Cry8Ad1 KC156684 ARP215 Cry8Ba1 AAA21118 Bt kumamotoensis Cry8Bb1 CAD57542 Cry8Bc1 CAD57543 Cry8Ca1 AAA21119 Bt japonensis Buibui Cry8Ca2 AAR98783 Bt HBF-1 Cry8Ca3 EU625349 Bt FTL-23 Cry8Ca4 ADB54826 Bt S185 Cry8Ca5 MK167020 Bt BJH500 Cry8Da1 BAC07226 Bt galleriae Cry8Da2 BD133574 Bt Cry8Da3 BD133575 Bt Cry8Db1 BAF93483 Bt BBT2-5 Cry8Ea1 AAQ73470 Bt 185 Cry8Ea2 EU047597 Bt B-DLL Cry8Ea3 KC855216 Bt GWL Cry8Ea4 AGM16383 QZL144-1 Cry8Ea5 AGM16384 QZL144-4 Cry8Ea6 KT692742 ZK1 Cry8Fa1 AAT48690 Bt 185 Cry8Fa2 HQ174208 Bt DLL Cry8Fa3 AFH78109 Bt L-27 Cry8Fa4 AGM16382 QHW7-2 Cry8Ga1 AAT46073 Bt HBF-18 Cry8Ga2 ABC42043 Bt 145 Cry8Ga3 FJ198072 Bt FCD114 Cry8Ha1 AAW81032 Bt 185 Cry8Hb1 KP713881 Bt Cry8Ia1 EU381044 Bt su4 Cry8Ia2 GU073381 Bt HW-11 Cry8Ia3 HM044664 Sbt030 Cry8Ia4 KC156674 ARP124 Cry8Ib1 GU325772 Bt F4 Cry8Ib2 KC156677 ARP135 Cry8Ib3 AHG25076 Bt TS3 Cry8Ja1 EU625348 Bt FPT-2 Cry8Ka1 FJ422558 Cry8Ka2 ACN87262 Bt kenyae Cry8Ka3 AGM16381 QHW7-2 Cry8Kb1 HM123758 ST8 Cry8Kb2 KC156675 ARP158 Cry8Kb3 KJ123823 INTA Fr7-4 Cry8La1 GU325771 Bt F4 Cry8Ma1 Sbt016 Cry8Ma2 EEM86551 BGSC 4CC1 Cry8Ma3 HM210574 NARC Bt17 (C6) Cry8Na1 HM640939 BtQ52-7 Cry8Pa1 HQ388415 Bt ST8 Cry8Pa2 HQ413324 Bt QCM(T1) Cry8Pa3 KJ123823 INTA Fr7-4 Cry8Qa1 HQ441166 Bt ST8 Cry8Qa2 KC152468 Bt INTA Fr7-4 Cry8Ra1 AFP87548 Bt R36 Cry8Sa1 JQ740599 Bt Strain 62 Cry8Ta1 KC156673 ARP110 Cry8-like FJ770571 Bt canadensis Cry8-like ABS53003 Bt Cry9Aa1 CAA41122 Bt galleriae Cry9Aa2 CAA41425 Bt DSIR517 Cry9Aa3 GQ249293 Bt SC5(D2) Cry9Aa4 GQ249294 Bt T03C001 Cry9Aa5 JX174110 BGSN1 Cry9Aa like AAQ52376 Cry9Ba1 CAA52927 Bt galleriae Cry9Ba2 GU299522 Bt B-SC5 Cry9Bb1 AAV28716 Bt japonensis Cry9Ca1 CAA85764 Bt tolworthi Cry9Ca2 AAQ52375 Cry9Cb1 MK005301 Cry9Da1 BAA19948 Bt japonensis N141 Cry9Da2 AAB97923 Bt japonensis Cry9Da3 GQ249293 Bt SC5 (D2) Cry9Da4 GQ249297 Bt T03B001 Cry9Db1 AAX78439 Bt kurstaki DP 1019 Cry9Dc1 KC156683 ARP168 Cry9Ea1 BAA34908 Bt aizawai SSK-10 Cry9Ea2 AAO12908 Bt B-Hm-16 Cry9Ea3 ABM21765 Bt lyA Cry9Ea4 ACE88267 Bt ywc5-4 Cry9Ea5 ACF04743 Bts Cry9Ea6 ACG63872 Bt 11 Cry9Ea7 FJ380927 Bt 4 Cry9Ea8 GQ249292 Bt SC5(E8) Cry9Ea9 JN651495 Bt LTS-7 Cry9Ea10 KT692743 ZK2 Cry9Ea11 MK391633 Bt MPU B9 Cry9Eb1 CAC50780 Cry9Eb2 GQ249298 BtT23001 Cry9Eb3 KC156646 ARP057 Cry9Ec1 AAC63366 Bt galleriae Cry9Ed1 AAX78440 Bt kurstaki DP 1019 Cry9Ee1 GQ249296 Bt T03B001 Cry9Ee2 KC156664 ARP095 Cry9Fa1 KC156692 ARP212 Cry9Ga1 KC156699 ARP 188 Cry9-like AAC63366 Bt galleriae Cry10Aa1 AAA22614 Bt israelensis Cry10Aa2 E00614 Bt israelensis ONR-60A Cry10Aa3 CAD30098 Bt israelensis Cry10Aa4 AFB18318 Bti BRC-LLP29 Cry10A-like DQ167578 Bt LDC-9 Cry11Aa1 AAA22352 Bt israelensis Cry11Aa2 AAA22611 Bt israelensis Cry11Aa3 CAD30081 Bt israelensis Cry11Aa4 AFB18319 Bti BRC-LLP29 Cry11Aa5 MH253686 Cry11Aa-like DQ166531 Bt LDC-9 Cry11Ba1 CAA60504 Bt jegathesan 367 Cry11Bb1 AAC97162 Bt medellin Cry11Bb2 HM068615 Bt K34 Cry12Aa1 AAA22355 Bt PS33F2 Cry13Aa1 AAA22356 Bt PS63B Cry13Aa2 CP015350 Bt MYBT18246 Cry14Aa1 AAA21516 Bt sotto PS80JJ1 Cry14Ab1 KC156652 ARP001 Cry15Aa1 AAA22333 Bt thompsoni Cry16Aa1 CAA63860 Cb malaysia CH18 Cry17Aa1 CAA67841 Cb malaysia CH18 Cry18Aa1 CAA67506 Paenibacillus popilliae Cry18Ba1 AAF89667 Paenibacillus popilliae Cry18Ca1 AAF89668 Paenibacillus popilliae Cry19Aa1 CAA68875 Bt jegathesan 367 Cry19Ba1 BAA32397 Bt higo Cry19Ca1 AFM37572 BGSC 4CE1 Cry20Aa1 AAB93476 Bt fukuokaensis Cry20Ba1 ACS93601 Bt higo LBIT-976 Cry20Ba2 KC156694 ARP192 Cry20-like GQ144333 Bt Y-5 Cry21Aa1 I32932 Cry21Aa2 I66477 Cry21Aa3 MF893204 Cry21Ba1 BAC06484 Bt roskildiensis Cry21Ca1 JF521577 Cry21Ca2 KC156687 ARP258 Cry21Da1 JF521578 Sbt072 Cry21Ea1 KC865049 Cry21Fa1 KF701307 DB27 Cry21Ga1 KF771885 DB27 Cry21Ha1 KF771886 DB27 Cry22Aa1 I34547 Cry22Aa2 CAD43579 Bt Cry22Aa3 ACD93211 Bt FZ-4 Cry22Ab1 AAK50456 Bt EG4140 Cry22Ab2 CAD43577 Bt Cry22Ba1 CAD43578 Bt Cry22Bb1 KC156672 ARP148 Cry23Aa1 AAF76375 Bt Cry24Aa1 AAC61891 Bt jegathesan Cry24Ba1 BAD32657 Bt sotto Cry24Ca1 CAJ43600 Bt FCC-41 Cry24Da1 KJ439561 BLB32 Cry25Aa1 AAC61892 Bt jegathesan Cry26Aa1 AAD25075 Bt finitimus B-1166 Cry27Aa1 BAA82796 Bt higo Cry28Aa1 AAD24189 Bt finitimus B-161 Cry28Aa2 AAG00235 Bt finitimus Cry29Aa1 CAC80985 Bt medellin Cry29Ba1 KC865046 Cry30Aa1 CAC80986 Bt medellin Cry30Ba1 BAD00052 Bt entomocidus Cry30Ca1 BAD67157 Bt sotto Cry30Ca2 ACU24781 Bt jegathesan 367 Cry30Da1 EF095955 Bt Y41 Cry30Db1 BAE80088 Bt aizawai BUN 1-14 Cry30Ea1 ACC95445 Bt S2160-1 Cry30Ea2 FJ499389 Bt Ywc2-8 Cry30Ea3 FJ527836 Bt Hs18-1 Cry30Ea4 KJ740649 BN15-6 Cry30Fa1 ACI22625 Bt MC28 Cry30Ga1 ACG60020 Bt HS18-1 Cry30Ga2 HQ638217 Bt S2160-1 Cry31Aa1 BAB11757 Bt 84-HS-1-11 Cry31Aa2 AAL87458 Bt M15 Cry31Aa3 BAE79808 Bt B0195 Cry31Aa4 BAF32571 Bt 79-25 Cry31Aa5 BAF32572 Bt 92-10 Cry31Aa6 BAI44026 M019 Cry31Ab1 BAE79809 Bt B0195 Cry31Ab2 BAF32570 Bt 31-5 Cry31Ac1 BAF34368 Bt 87-29 Cry31Ac2 AB731600 Bt B0462 Cry31Ad1 BAI44022 Bt MO19 Cry31Ad2 AGO57767 Bt 64-1-94 Cry32Aa1 AAG36711 Bt yunnanensis Cry32Aa2 GU063849 Bt FBG-1 Cry32Ab1 GU063850 Bt FZ-2 Cry32Ba1 BAB78601 Bt Cry32Ca1 BAB78602 Bt Cry32Cb1 KC156708 ARP227 Cry32Da1 BAB78603 Bt Cry32Ea1 GU324274 Bt HYD-3 Cry32Ea2 KC156686 ARP239 Cry32Eb1 KC156663 ARP092 Cry32Fa1 KC156656 ARP055 Cry32Ga1 KC156657 ARP052 Cry32Ha1 KC156661 ARP076 Cry32Hb1 KC156666 ARP096 Cry32Ia1 KC156667 ARP104 Cry32Ja1 KC156685 ARP262 Cry32Ka1 KC156688 ARP259 Cry32La1 KC156689 ARP203 Cry32Ma1 KC156690 ARP256 Cry32Mb1 KC156704 ARP242 Cry32Na1 KC156691 ARP179 Cry320a1 KC156703 ARP218 Cry32Pa1 KC156705 ARP277 Cry32Qa1 KC156706 ARP174 Cry32Ra1 KC156707 ARP229 Cry32Sa1 KC156709 ARP185 Cry32Ta1 KC156710 ARP220 Cry32Ua1 KC156655 ARP050 Cry32Va1 LM1212 Cry32Wa1 LM1212 Cry32Wa2 AHN52957 Bt B3 Cry32Xa1 KX094974 Cry32Ya1 KX094973 Cry33Aa1 AAL26871 Bt dakota Cry34Aa1 AAG50341 Bt PS80JJ1 Cry34Aa2 AAK64560 Bt EG5899 Cry34Aa3 AAT29032 Bt PS69Q Cry34Aa4 AAT29030 Bt PS185GG Cry34Ab1 AAG41671 Bt PS149B1 Cry34Ac1 AAG50118 Bt PS167H2 Cry34Ac2 AAK64562 Bt EG9444 Cry34Ac3 AAT29029 Bt KR1369 Cry34Ba1 AAK64565 Bt EG4851 Cry34Ba2 AAT29033 Bt PS201L3 Cry34Ba3 AAT29031 Bt PS201HH2 Cry35Aa1 AAG50342 Bt PS80JJ1 Cry35Aa2 AAK64561 Bt EG5899 Cry35Aa3 AAT29028 Bt PS69Q Cry35Aa4 AAT29025 Bt PS185GG Cry35Ab1 AAG41672 Bt PS149B1 Cry35Ab2 AAK64563 Bt EG9444 Cry35Ab3 AY536891 Bt KR1369 Cry35Ac1 AAG50117 Bt PS167H2 Cry35Ba1 AAK64566 Bt EG4851 Cry35Ba2 AAT29027 Bt PS201L3 Cry35Ba3 AAT29026 Bt PS201HH2 Cry36Aa1 AAK64558 Bt Cry37Aa1 AAF76376 Bt Cry38Aa1 AAK64559 Bt Cry39Aa1 BAB72016 Bt aizawai Cry40Aa1 BAB72018 Bt aizawai Cry40Ba1 BAC77648 Bun1-14 Cry40Ca1 EU381045 Bt Y41 Cry40Da1 ACF15199 Bt S2096-2 Cry41Aa1 BAD35157 Bt A1462 Cry41Ab1 BAD35163 Bt A1462 Cry41Ba1 HM461871 Sbt021 Cry41Ba2 ZP_04099652 BGSC 4AW1 Cry41Ca1 LM1212 Cry42Aa1 BAD35166 Bt A1462 Cry43Aa1 BAD15301 P. lentimorbus semadara Cry43Aa2 BAD95474 P. popilliae popilliae Cry43Ba1 BAD15303 P. lentimorbus semadara Cry43Ca1 KC156676 ARP132 Cry43Cb1 KC156695 ARP252 Cry43Cc1 KC156696 ARP191 Cry43-like BAD15305 P. lentimorbus semadara Cry44Aa1 BAD08532 Bt entomocidus INA288 Cry45Aa1 BAD22577 Bt 89-T-34-22 Cry45Ba1 LM1212 Cry46Aa1 BAC79010 Bt dakota Cry46Aa2 BAG68906 Bt A1470 Cry46Ab1 BAD35170 Bt Cry47Aa1 AAY24695 Bt CAA890 Cry48Aa1 CAJ18351 Bs IAB59 Cry48Aa2 CAJ86545 Bs 47-6B Cry48Aa3 CAJ86546 Bs NHA15b Cry48Ab1 CAJ86548 Bs LP1G Cry48Ab2 CAJ86549 Bs 2173 Cry49Aa1 CAH56541 Bs IAB59 Cry49Aa2 CAJ86541 Bs 47-6B Cry49Aa3 CAJ86543 BsNHA15b Cry49Aa4 CAJ86544 Bs 2173 Cry49Ab1 CAJ86542 Bs LP1G Cry50Aa1 BAE86999 Bt sotto Cry50Ba1 GU446675 Bt S2160-1 Cry50Ba2 GU446676 Bt S3161-3 Cry51Aa1 ABI14444 Bt F14-l Cry51Aa2 GU570697 EG2934 Cry52Aa1 EF613489 Bt Y41 Cry52Ba1 FJ361760 Bt BM59-2 Cry52Ca1 KM053253 Bt SK700 Cry53Aa1 EF633476 Bt Y41 Cry53Ab1 FJ361759 Bt MC28 Cry54Aa1 ACA52194 Bt MC28 Cry54Aa2 GQ140349 Bt FBG25 Cry54Ab1 JQ916908 Bt MC28 Cry54Ba1 GU446677 Bt S2160-1 Cry54Ba2 KJ740650 BN15-6 Cry55Aa1 ABW88932 YBT 1518 Cry55Aa2 AAE33526 Bt Y41 Cry55Aa3 HG764207 Bt T44 Cry56Aa1 ACU57499 Bt Ywc2-8 Cry56Aa2 GQ483512 Bt G7-1 Cry56Aa3 JX025567 Bt HS18-1 Cry56Aa4 KJ740651 BN7-5 Cry57Aa1 ACN87261 Bt kim Cry57Ab1 KF638650 Bt LTS290 Cry58Aa1 ACN87260 Bt entomocidus Cry59Ba1 JN790647 Bt Bm59-2 Cry59Aa1 ACR43758 Bt kim LBIT-980 Cry60Aa1 ACU24782 Bt jegathesan Cry60Aa2 EAO57254 Bt israelensis Cry60Aa3 EEM99278 Bt IBL 4222 Cry60Ba1 GU810818 Bt malayensis Cry60Ba2 EAO57253 Bt israelensis Cry60Ba3 EEM99279 Bt IBL 4222 Cry61Aa1 HM035087 Sbt009 Cry61Aa2 HM132125 HD868 (E5) Cry61Aa3 EEM19308 BGSC 4Y1 Cry62Aa1 HM054509 ST7 Cry63Aa1 BAI44028 MO19 Cry64Aa1 BAJ05397 Bt tohokuensis Cry64Ba1 AGT29559 BT 210-8-45 Cry64Ca1 AGT29560 BT 210-8-45 Cry65Aa1 HM461868 SBt 003 Cry65Aa2 ZP_04123838 T13001 Cry66Aa1 AEB52311 SBt 021 Cry66Aa2 ZP_04099945 BGSC 4AW1 Cry67Aa1 HM485582 SBt 009 Cry67Aa2 ZP_04148882 BGSC 4Y1 Cry68Aa1 HQ113114 Bt MC28 Cry69Aa1 HQ401006 Bt MC28 Cry69Aa2 JQ821388 Bt MC28 Cry69Ab1 JN209957 Bt hs18-1 Cry70Aa1 JN646781 Bt hs18-1 Cry70Ba1 AD051070 Bt MC28 Cry70Bb1 EEL67276 Be AH603 Cry71Aa1 JX025568 Bt Hs18-1 Cry72Aa1 JX025569 Bt Hs18-1 Cry72Aa2 KX094975 Cry73Aa1 AEH76822 Sbt Sbt029 Cry74Aa LM1212 Cry75Aa1 ASY04853 Bl EG5553 Cry75Aa2 ASY04852 Bl EG5551 Cry75Aa3 ASY04851 Bl EG5552 Cry76Aa1 MH810248 Cry77Aa1 MH810249 Cry78Aa1 KY780623 Bt C9F1

[0809] In some embodiments, a PFIP can be one or more of the following Cyt proteins: Cyt1Aa1, Cyt1Aa2, Cyt1Aa3, Cyt1Aa4, Cyt1Aa5, Cyt1Aa6, Cyt1Aa7, Cyt1Aa8, Cyt1Aa-like, Cyt1Ab1, Cyt1Ba1, Cyt1Ca1, Cyt1Da1, Cyt1Da2, Cyt2Aa1, Cyt2Aa2, Cyt2Aa3, Cyt2Aa4, Cyt2Ba1, Cyt2Ba2, Cyt2Ba3, Cyt2Ba4, Cyt2Ba5, Cyt2Ba6, Cyt2Ba7, Cyt2Ba8, Cyt2Ba9, Cyt2Ba10, Cyt2Ba11, Cyt2Ba12, Cyt2Ba13, Cyt2Ba14, Cyt2Ba15, Cyt2Ba16, Cyt2Ba-like, Cyt2Bb1, Cyt2Bc1, Cyt2B-like, Cyt2Ca1, and/or Cyt3Aa1.

[0810] In some embodiments, a mixture comprising one or more PFIPs and one or more CRIPs, can have one or more of the PFIPs be a Cyt toxin as described herein, or presented in Table 8.

TABLE-US-00046 TABLE 8 Non-limiting examples of Cyt toxins, their accession numbers on NCBI, and strain. Here, if a cell is left blank, then the accession number and/or strain is not applicable. Name NCBI Accession No. Strain/Other ID Cyt1Aa1 X03182 Bt israelensis Cyt1Aa2 X04338 Bt israelensis Cyt1Aa3 Y00135 Bt morrisoni PG14 Cyt1Aa4 M35968 Bt morrisoni PG14 Cyt1Aa5 AL731825 Bt israelensis Cyt1Aa6 ABC17640 Bt LLP29 Cyt1Aa7 KF152888 Bt BRC-HQY1 Cyt1Aa8 MF893205 Cyt1Aa-like ABB01172 Bt LDC-9 Cyt1Ab1 X98793 Bt medellin Cyt1Ba1 U37196 Bt neoleoensis Cyt1Ca1 AL731825 Bt israelensis Cyt1Da1 HQ113115 Bt MC28 Cyt1Da2 JN226105 hs18-1 Cyt2Aa1 Z14147 Bt kyushuensis Cyt2Aa2 AF472606 Bt darmstadiensis73E10 Cyt2Aa3 EU835185 Bt MC28 Cyt2Aa4 AEG19547 BtWFS-97 Cyt2Ba1 U52043 Bt israelensis 4Q2 Cyt2Ba2 AF020789 Bt israelensis PG14 Cyt2Ba3 AF022884 Bt fuokukaensis Cyt2Ba4 AF022885 Bt morrisoni HD12 Cyt2Ba5 AF022886 Bt morrisoni HD518 Cyt2Ba6 AF034926 Bt tenebrionis Cyt2Ba7 AF215645 Bt T301 Cyt2Ba8 AF215646 Bt T36 Cyt2Ba9 AL731825 Bt israelensis Cyt2Ba10 ACX54358 Bti HD 567 Cyt2Ba11 ACX54359 Bti HD 522 Cyt2Ba12 ACX54360 Bti INTA H41-1 Cyt2Ba13 FJ205865 INTA 160-2 Cyt2Ba14 FJ205866 Bti IPS82 Cyt2Ba15 JF283552 Bt LLP29 Cyt2Ba16 MG181950 QL32-1 Cyt2Ba-like ABE99695 Bt LDC-9 Cyt2Bb1 U82519 Bt jegathesan Cyt2Bc1 CAC80987 Bt medellin Cyt2B-like DQ341380 Cyt2Ca1 AAK50455 Bt Cyt3Aa1 HM596591 Bt TD516

[0811] In some embodiments, a PFIP can be a protein belonging to the Vip1, Vip2, Vip3, or Vip4 family. For example, in some embodiments, a PFIP can be one or more of the following Vip proteins: Vip1Aa1, Vip1Aa2, Vip1Aa3, Vip1Ab1, Vip1Ac1, Vip1Ad1, Vip1Ba1, Vip1Ba2, Vip1Bb1, Vip1Bb2, Vip1Bb3, Vip1Bc1, Vip1Ca1, Vip1Ca2, Vip1Da1, Vip2Aa1, Vip2Aa2, Vip2Aa3, Vip2Ab1, Vip2Ac1, Vip2Ac2, Vip2Ad1, Vip2Ae1, Vip2Ae2, Vip2Ae3, Vip2Af1, Vip2Af2, Vip2Ag1, Vip2Ag2, Vip2Ba1, Vip2Ba2, Vip2Bb1, Vip2Bb2, Vip2Bb3, Vip2Bb4, Vip3Aa1, Vip3Aa2, Vip3Aa3, Vip3Aa4, Vip3Aa5, Vip3Aa6, Vip3Aa7, Vip3Aa8, Vip3Aa9, Vip3Aa10, Vip3Aa11, Vip3Aa12, Vip3Aa13, Vip3Aa14, Vip3Aa15, Vip3Aa16, Vip3Aa17, Vip3Aa18, Vip3Aa19.0, Vip3Aa19, Vip3Aa20, Vip3Aa21, Vip3Aa22, Vip3Aa23, Vip3Aa24, Vip3Aa25, Vip3Aa26, Vip3Aa27, Vip3Aa28, Vip3Aa29, Vip3Aa30, Vip3Aa31, Vip3Aa32, Vip3Aa33, Vip3Aa34, Vip3Aa35, Vip3Aa36, Vip3Aa37, Vip3Aa38, Vip3Aa39, Vip3Aa40, Vip3Aa41, Vip3Aa42, Vip3Aa43, Vip3Aa44, Vip3Aa45, Vip3Aa46, Vip3Aa47, Vip3Aa48, Vip3Aa49, Vip3Aa50, Vip3Aa51, Vip3Aa52, Vip3Aa53, Vip3Aa54, Vip3Aa55, Vip3Aa56, Vip3Aa57, Vip3Aa58, Vip3Aa59, Vip3Aa60, Vip3Aa61, Vip3Aa62, Vip3Aa63, Vip3Aa64, Vip3Aa65, Vip3Aa66, Vip3Ab1, Vip3Ab2, Vip3Ac1, Vip3Ad1, Vip3Ad2, Vip3Ad3, Vip3Ad4, Vip3Ad5, Vip3Ad6, Vip3Ae1, Vip3Af1, Vip3Af2, Vip3Af3, Vip3Af4, Vip3Ag1, Vip3Ag2, Vip3Ag3, Vip3Ag4, Vip3Ag5, Vip3Ag6, Vip3Ag7, Vip3Ag8, Vip3Ag9, Vip3Ag10, Vip3Ag11, Vip3Ag12, Vip3Ag13, Vip3Ag14, Vip3Ag15, Vip3Ah1, Vip3Ah2, Vip3Ai1, Vip3Aj1, Vip3Aj2, Vip3Ba1, Vip3Ba2, Vip3Bb1, Vip3Bb2, Vip3Bb3, Vip3Bc, Vip3Ca1, Vip3Ca2, Vip3Ca3, Vip3Ca4, and/or Vip4Aa1.

[0812] In some embodiments, a mixture comprising one or more PFIPs and one or more CRIPs, can have one or more of the PFIPs be a Vip protein as described herein, or presented in Table 9.

TABLE-US-00047 TABLE 9 Non-limiting examples of Vip proteins and their accession numbers on NCBI. Here, if a cell is left blank, then the accession number is not applicable. Name NCBI Accession No. Vip1Aa1 Vip1Aa2 AAR81088 Vip1Aa3 GU992203 Vip1Ab1 Vip1Ac1 HM439098 Vip1Ad1 AGC08395 Vip1Ba1 AAR40886 Vip1Ba2 CAI43278 Vip1Bb1 AAR40282 Vip1Bb2 HM485584 Vip1Bb3 KR065727 Vip1Bc1 HM485583 Vip1Ca1 AAO86514 Vip1Ca2 KR065725 Vip1Da1 CAI40767 Vip2Aa1 1QS1A Vip2Aa2 AAR81096 Vip2Aa3 HM439097 Vip2Ab1 Vip2Ac1 AAO86513 Vip2Ac2 KR065726 Vip2Ad1 CAI40768 Vip2Ae1 EF442245 Vip2Ae2 ACH42758 Vip2Ae3 HM439099 Vip2Af1 ACH42759 Vip2Af2 EU909204 Vip2Ag1 AGC08396 Vip2Ag2 KC951878 Vip2Ba1 AAR40887 Vip2Ba2 CAI43279 Vip2Bb1 Vip2Bb2 HM485585 Vip2Bb3 KJ868170 Vip2Bb4 KR065728 Vip3Aa1 AAC37036 Vip3Aa2 AAC37037 Vip3Aa3 Vip3Aa4 AAR81079 Vip3Aa5 AAR81080 Vip3Aa6 AAR81081 Vip3Aa7 AAK95326 Vip3Aa8 AAK97481 Vip3Aa9 CAA76665 Vip3Aa10 AAN60738 Vip3Aa11 AAR36859 Vip3Aa12 AAM22456 Vip3Aa13 AAL69542 Vip3Aa14 AAQ12340 Vip3Aa15 AAP51131 Vip3Aa16 AAW65132 Vip3Aa17 Vip3Aa18 AAX49395 Vip3Aa19.0 DQ241674 Vip3Aa19 DQ539887 Vip3Aa20 DQ539888 Vip3Aa21 ABD84410 Vip3Aa22 AAY41427 Vip3Aa23 AAY41428 Vip3Aa24 BI 880913 Vip3Aa25 EF608501 Vip3Aa26 EU294496 Vip3Aa27 EU332167 Vip3Aa28 FJ494817 Vip3Aa29 FJ626674 Vip3Aa30 FJ626675 Vip3Aa31 FJ626676 Vip3Aa32 FJ626677 Vip3Aa33 GU073128 Vip3Aa34 GU073129 Vip3Aa35 GU733921 Vip3Aa36 GU951510 Vip3Aa37 HM132041 Vip3Aa38 HM117632 Vip3Aa39 HM117631 Vip3Aa40 HM132042 Vip3Aa41 HM132043 Vip3Aa42 HQ587048 Vip3Aa43 HQ594534 Vip3Aa44 HQ650163 Vip3Aa45 JF710269 Vip3Aa46 JQ228436 Vip3Aa47 JQ228435 Vip3Aa48 JQ731616 Vip3Aa49 JQ731617 Vip3Aa50 JQ946639 Vip3Aa51 KC156649 Vip3Aa52 KF826718 Vip3Aa53 KF826723 Vip3Aa54 AHK23264 Vip3Aa55 KJ868172 Vip3Aa56 LN624748 Vip3Aa57 AJD18609 Vip3Aa58 KR259139 Vip3Aa59 KR259140 Vip3Aa60 KR340473 Vip3Aa61 KU522245 Vip3Aa62 KT792883 Vip3Aa63 KY780302 Vip3Aa64 KY883694 Vip3Aa65 MH290720 Vip3Aa66 MK252100 Vip3Ab1 AAR40284 Vip3Ab2 AAY88247 Vip3Ac1 Vip3Ad1 Vip3Ad2 CAI43276 Vip3Ad3 KF826720 Vip3Ad4 KF826727 Vip3Ad5 KR263164 Vip3Ad6 KU761577 Vip3Ae1 CAI43277 Vip3Af1 CAI43275 Vip3Af2 Vip3Af3 HM117634 Vip3Af4 KM276664 Vip3Ag1 Vip3Ag2 FJ556803 Vip3Ag3 HM117633 Vip3Ag4 HQ414237 Vip3Ag5 HQ542193 Vip3Ag6 JQ397328 Vip3Ag7 KF826713 Vip3Ag8 KF826714 Vip3Ag9 KF826715 Vip3Ag10 KF826716 Vip3Ag11 KF826719 Vip3Ag12 KF826721 Vip3Ag13 KF826722 Vip3Ag14 KF826725 Vip3Ag15 KF826726 Vip3Ah1 DQ832323 Vip3Ah2 AQY42675 Vip3Ai1 KC156693 Vip3Aj1 KF826717 Vip3Aj2 KF826724 Vip3Ba1 AAV70653 Vip3Ba2 HM117635 Vip3Bb1 Vip3Bb2 ABO30520 Vip3Bb3 ADI48120 Vip3Bc MF543028 Vip3Ca1 ADZ46178 Vip3Ca2 AEE98106 Vip3Ca3 HQ876489 Vip3Ca4 JN836992 Vip4Aa1 HM044666

[0813] In some embodiments, any of the mixtures and/or compositions comprising a PFIP and a CRIP, can have one or more of the PFIPs selected from any of the foregoing Tables 7, 8, or 9, in any combination and/or quantity.

[0814] Mixtures of the Present Invention

[0815] In some embodiments, one or more of the PFIPs, CRIPs, ICKs, and/or non-ICK peptides described herein can be combined with one or more additional chemical substances, molecules, nucleotides, polynucleotides, peptides, polypeptides, proteins, poisons, insecticides, pesticides, organic compounds, inorganic compounds, prokaryote organisms, or eukaryote organisms, and/or agents produced therefrom.

[0816] In some embodiments, one or more of the PFIPs, CRIPs, ICKs, and/or non-ICK peptides described herein can be combined with one or more additional agent, i.e., one or more chemical substances, molecules, nucleotides, polynucleotides, peptides, polypeptides, proteins, poisons, insecticides, pesticides, organic compounds, inorganic compounds, prokaryote organisms, or eukaryote organisms, and/or agents produced therefrom, wherein the additional agent is an insecticide, or agent possessing insecticidal characteristics.

[0817] For example, in some embodiments, one or more of the PFIPs, CRIPs, ICKs, and/or non-ICK peptides described herein can be combined with one or more PFIPs, CRIPs, ICKs, and/or non-ICK peptides

[0818] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein.

[0819] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the CRIP is an atracotoxin (ACTX), a ctenitoxin (CNTX), an Av2 toxin, an Av3 toxin, or an Av3-Variant Polypeptide (AVP).

[0820] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an ACTX.

[0821] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is a U-ACTX peptide, an Omega-ACTX peptides, a Kappa-ACTX peptide, or a combination thereof.

[0822] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is a U-ACTX-Hv1a, a U+2-ACTX-Hv1a, a rU-ACTX-Hv1a, a rU-ACTX-Hv1b, a r-ACTX-Hv1c, a -ACTX-Hv1a, and/or a -ACTX-Hv1a+2.

[0823] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an ACTX having an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 5-6, 24, 534-635, 650-673, 724-728, 763-773, 866-867, 874-876, 878-886, 913-925, 958-992, 1038-42, 1104-1106, 1110-1118, 1141-1157, 1159-1210, 1553-1593, or 1776-1777.

[0824] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an ACTX having an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 5, 6, 1776, or 1777.

[0825] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an ACTX having an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 5.

[0826] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is a ctenitoxin (CNTX).

[0827] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is a -CNTX-Pn1a.

[0828] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is a -CNTX-Pn1a having an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1778.

[0829] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an Av2 toxin.

[0830] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an Av2 toxin having an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1779.

[0831] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an Av3 toxin.

[0832] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an Av3 toxin has an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1780.

[0833] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is an Av3-Variant Polypeptide (AVP) has an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 1781 or 1782.

[0834] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of PFIP to CRIP is about 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000.

[0835] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Bti to ACTX is from about 1:1 to about 1:5000.

[0836] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Bti to ACTX is about 1:4000.

[0837] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btk to ACTX is from about 1:1 to about 1:10.

[0838] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btk to ACTX is about 1:9.2

[0839] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btk to Av3 is from about 1:1 to about 1:1.5.

[0840] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btk to Av3 is from about 1:1 to about 1:1.5.

[0841] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btk to AVP is about 1:1.375.

[0842] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btt to ACTX is from about 1:1 to about 1:10.

[0843] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the ratio of Btt to ACTX is about 1:8.75.

[0844] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. tenebrionis (Btt) toxin; and wherein the second type of insecticidal peptide is an ACTX peptide. In yet other embodiments, the Btt toxin is a Bacillus thuringiensis ssp. tenebrionis strain NB-176 Btt toxin; and the ACTX peptide is a U+2-ACTX-Hv1a toxin (SEQ ID NO: 5).

[0845] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. kurstaki (Btk) toxin; and wherein the second type of insecticidal peptide is an ACTX peptide. In yet other embodiments, wherein the Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin; and the ACTX peptide is a U+2-ACTX-Hv1a toxin (SEQ ID NO: 5).

[0846] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. kurstaki (Btk toxin); and wherein the second type of insecticidal peptide is a CNTX. In yet other embodiments, the Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin; and the CNTX is a -CNTX-Pn1a toxin (SEQ ID NO: 1778).

[0847] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. kurstaki (Btk) toxin; and wherein the second type of insecticidal peptide is a Av3-Variant Polypeptide (AVP). In yet other embodiments, the Btk toxin is a Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 Btk toxin; and the AVP is an Av3-Variant Polypeptide (AVP) having an amino acid sequence as set forth in SEQ ID NO: 1782.

[0848] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; wherein the first type of insecticidal peptide is a Bacillus thuringiensis ssp. israelensis (Bti) toxin; and wherein the second type of insecticidal peptide is an ACTX peptide. In yet other embodiments, the Bti toxin is a Bacillus thuringiensis ssp. israelensis Strain BMP 144 Bti toxin; and the ACTX peptide is a U+2-ACTX-Hv1a toxin (SEQ ID NO: 5).

[0849] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; and wherein the CRIP is a snake venom or toxin therefrom.

[0850] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; and wherein the CRIP is a snake venom or toxin therefrom.

[0851] In some embodiments, a mixture of the present invention comprises two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein neither the PFIP nor CRIP are part of a fusion protein; and wherein the mixture further comprises one or more snake venoms or toxins therefrom.

[0852] In some embodiments, one or more of the PFIPs, CRIPs, ICKs, and/or non-ICK peptides described herein, can be combined with one or more snake venoms or toxins therefrom.

[0853] In some embodiments, a mixture of the present invention can comprise two separate and/or distinct types of insecticidal peptides (i.e., insecticidal peptides that are fused together, e.g., as in a fusion protein), wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP).

[0854] In some embodiments, a mixture of the present invention can comprise two separate and/or distinct types of insecticidal peptides that are not a fusion protein (i.e., insecticidal peptides that are not fused together, e.g., as in a mixture or combination comprising two separate proteins), wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP).

[0855] In some embodiments, a mixture of the present invention can comprise a first insecticidal peptide that is a PFIP, and a second insecticidal peptide that is a CRIP.

[0856] In some embodiments, a mixture of the present invention can comprise a first insecticidal peptide that is a PFIP, e.g., a Bacillus thuringiensis toxin (Bt), and a second insecticidal peptide that is an atracotoxin (ACTX), a ctenitoxin (CNTX), an Av2 toxin, an Av3 toxin, or an Av3-Variant Polypeptide (AVP).

[0857] In the present disclosure, CRIPs do not include a U1-agatoxin-Ta1b polypeptide, or variants thereof (e.g., a TVP).

[0858] In some embodiments, a mixture of the present invention can comprise one or more of the following toxins: Bacillus thuringiensis var. israelensis toxin (Bti), Bacillus thuringiensis var. kurstaki toxin (Btk), Bacillus thuringiensis var. tenebrionis toxin (Btt), or a combination thereof.

[0859] In some embodiments, a mixture of the present invention can comprise a Bti toxin that is a Becker Bti, a Btt toxin that is NOVODOR FC, a Btk toxin that is a BioProtec Plus, or a combination thereof.

[0860] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the PFIP is one or more crystal (Cry) toxins, cytolytic (Cyt) toxins, vegetative insecticidal proteins (Vips), secreted insecticidal protein (Sips), Bin-like toxins, or a combination thereof.

[0861] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the PFIP is one or more Cry toxins, Cyt toxins, Vips, or a combination thereof.

[0862] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the PFIP is one or more Cry toxin and/or combinations of Cry toxins. For example, in some embodiments, the Cry toxin can be one or more of a Cry1Aa1, Cry1Aa2, Cry1Aa3, Cry1Aa4, Cry1Aa5, Cry1Aa6, Cry1Aa7, Cry1Aa8, Cry1Aa9, Cry1Aa10, Cry1Aa11, Cry1Aa12, Cry1Aa13, Cry1Aa14, Cry1Aa15, Cry1Aa16, Cry1Aa17, Cry1Aa18, Cry1Aa19, Cry1Aa20, Cry1Aa21, Cry1Aa22, Cry1Aa23, Cry1Aa24, Cry1Aa25, Cry1Ab1, Cry1Ab2, Cry1Ab3, Cry1Ab4, Cry1Ab5, Cry1Ab6, Cry1Ab7, Cry1Ab8, Cry1Ab9, Cry1Ab10, Cry1Ab11, Cry1Ab12, Cry1Ab13, Cry1Ab14, Cry1Ab15, Cry1Ab16, Cry1Ab17, Cry1Ab18, Cry1Ab19, Cry1Ab20, Cry1Ab21, Cry1Ab22, Cry1Ab23, Cry1Ab24, Cry1Ab25, Cry1Ab26, Cry1Ab27, Cry1Ab28, Cry1Ab29, Cry1Ab30, Cry1Ab31, Cry1Ab32, Cry1Ab33, Cry1Ab34, Cry1Ab35, Cry1Ab36, Cry1Ab-like, Cry1Ab-like, Cry1Ab-like, Cry1Ab-like, Cry1Ac1, Cry1Ac2, Cry1Ac3, Cry1Ac4, Cry1Ac5, Cry1Ac6, Cry1Ac7, Cry1Ac8, Cry1Ac9, Cry1Ac10, Cry1Ac11, Cry1Ac12, Cry1Ac13, Cry1Ac14, Cry1Ac15, Cry1Ac16, Cry1Ac17, Cry1Ac18, Cry1Ac19, Cry1Ac20, Cry1Ac21, Cry1Ac22, Cry1Ac23, Cry1Ac24, Cry1Ac25, Cry1Ac26, Cry1Ac27, Cry1Ac28, Cry1Ac29, Cry1Ac30, Cry1Ac31, Cry1Ac32, Cry1Ac33, Cry1Ac34, Cry1Ac35, Cry1Ac36, Cry1Ac37, Cry1Ac38, Cry1Ac39, Cry1Ad1, Cry1Ad2, Cry1Ae1, Cry1Af1, Cry1Ag1, Cry1Ah1, Cry1Ah2, Cry1Ah3, Cry1Ai1, Cry1Ai2, Cry1Aj1, Cry1A-like, Cry1Ba1, Cry1Ba2, Cry1Ba3, Cry1Ba4, Cry1Ba5, Cry1Ba6, Cry1Ba7, Cry1Ba8, Cry1Bb1, Cry1Bb2, Cry1Bb3, Cry1Bc1, Cry1Bd1, Cry1Bd2, Cry1Bd3, Cry1Be1, Cry1Be2, Cry1Be3, Cry1Be4, Cry1Be5, Cry1Bf1, Cry1Bf2, Cry1Bg1, Cry1Bh1, Cry1Bi1, Cry1Bj1, Cry1Ca1, Cry1Ca2, Cry1Ca3, Cry1Ca4, Cry1Ca5, Cry1Ca6, Cry1Ca7, Cry1Ca8, Cry1Ca9, Cry1Ca10, Cry1Ca11, Cry1Ca12, Cry1Ca13, Cry1Ca14, Cry1Ca15, Cry1Cb1, Cry1Cb2, Cry1Cb3, Cry1Cb-like, Cry1Da1, Cry1Da2, Cry1Da3, Cry1Da4, Cry1Da5, Cry1Db1, Cry1Db2, Cry1Dc1, Cry1Dd1, Cry1Ea1, Cry1Ea2, Cry1Ea3, Cry1Ea4, Cry1Ea5, Cry1Ea6, Cry1Ea7, Cry1Ea8, Cry1Ea9, Cry1Ea10, Cry1Ea11, Cry1Ea12, Cry1Eb1, Cry1Fa1, Cry1Fa2, Cry1Fa3, Cry1Fa4, Cry1Fb1, Cry1Fb2, Cry1Fb3, Cry1Fb4, Cry1Fb5, Cry1Fb6, Cry1Fb7, Cry1Ga1, Cry1Ga2, Cry1Gb1, Cry1Gb2, Cry1Gc1, Cry1Ha1, Cry1Hb1, Cry1Hb2, Cry1Hc1, Cry1H-like, Cry1Ia1, Cry1Ia2, Cry1Ia3, Cry1Ia4, Cry1Ia5, Cry1Ia6, Cry1Ia7, Cry1Ia8, Cry1Ia9, Cry1Ia10, Cry1Ia11, Cry1Ia12, Cry1Ia13, Cry1Ia14, Cry1Ia15, Cry1Ia16, Cry1Ia17, Cry1Ia18, Cry1Ia19, Cry1Ia20, Cry1Ia21, Cry1Ia22, Cry1Ia23, Cry1Ia24, Cry1Ia25, Cry1Ia26, Cry1Ia27, Cry1Ia28, Cry1Ia29, Cry1Ia30, Cry1Ia31, Cry1Ia32, Cry1Ia33, Cry1Ia34, Cry1Ia35, Cry1Ia36, Cry1Ia37, Cry1Ia38, Cry1Ia39, Cry1Ia40, Cry1Ib1, Cry1Ib2, Cry1Ib3, Cry1Ib4, Cry1Ib5, Cry1Ib6, Cry1Ib7, Cry1Ib8, Cry1Ib9, Cry1Ib10, Cry1Ib11, Cry1Ic1, Cry1Ic2, Cry1Id1, Cry1Id2, Cry1Id3, Cry1Ie1, Cry1Ie2, Cry1Ie3, Cry1Ie4, Cry1Ie5, Cry1If1, Cry1Ig1, Cry1I-like, Cry1I-like, Cry1Ja1, Cry1Ja2, Cry1Ja3, Cry1Jb1, Cry1Jc1, Cry1Jc2, Cry1Jd1, Cry1Ka1, Cry1Ka2, Cry1La1, Cry1La2, Cry1La3, Cry1Ma1, Cry1Ma2, Cry1Na1, Cry1Na2, Cry1Na3, Cry1Nb1, Cry1-like, Cry2Aa1, Cry2Aa2, Cry2Aa3, Cry2Aa4, Cry2Aa5, Cry2Aa6, Cry2Aa7, Cry2Aa8, Cry2Aa9, Cry2Aa10, Cry2Aa11, Cry2Aa12, Cry2Aa13, Cry2Aa14, Cry2Aa15, Cry2Aa16, Cry2Aa17, Cry2Aa18, Cry2Aa19, Cry2Aa20, Cry2Aa21, Cry2Aa22, Cry2Aa23, Cry2Aa23, Cry2Aa25, Cry2Ab1, Cry2Ab2, Cry2Ab3, Cry2Ab4, Cry2Ab5, Cry2Ab6, Cry2Ab7, Cry2Ab8, Cry2Ab9, Cry2Ab10, Cry2Ab11, Cry2Ab12, Cry2Ab13, Cry2Ab14, Cry2Ab15, Cry2Ab16, Cry2Ab17, Cry2Ab18, Cry2Ab19, Cry2Ab20, Cry2Ab21, Cry2Ab22, Cry2Ab23, Cry2Ab24, Cry2Ab25, Cry2Ab26, Cry2Ab27, Cry2Ab28, Cry2Ab29, Cry2Ab30, Cry2Ab31, Cry2Ab32, Cry2Ab33, Cry2Ab34, Cry2Ab35, Cry2Ab36, Cry2Ac1, Cry2Ac2, Cry2Ac3, Cry2Ac4, Cry2Ac5, Cry2Ac6, Cry2Ac7, Cry2Ac8, Cry2Ac9, Cry2Ac10, Cry2Ac11, Cry2Ac12, Cry2Ad1, Cry2Ad2, Cry2Ad3, Cry2Ad4, Cry2Ad5, Cry2Ae1, Cry2Af1, Cry2Af2, Cry2Ag1, Cry2Ah1, Cry2Ah2, Cry2Ah3, Cry2Ah4, Cry2Ah5, Cry2Ah6, Cry2Ai1, Cry2Aj1, Cry2Ak1, Cry2Al1, Cry2Ba1, Cry2Ba2, Cry3Aa1, Cry3Aa2, Cry3Aa3, Cry3Aa4, Cry3Aa5, Cry3Aa6, Cry3Aa7, Cry3Aa8, Cry3Aa9, Cry3Aa10, Cry3Aa11, Cry3Aa12, Cry3Ba1, Cry3Ba2, Cry3Ba3, Cry3Bb1, Cry3Bb2, Cry3Bb3, Cry3Ca1, Cry4Aa1, Cry4Aa2, Cry4Aa3, Cry4Aa4, Cry4A-like, Cry4Ba1, Cry4Ba2, Cry4Ba3, Cry4Ba4, Cry4Ba5, Cry4Ba-like, Cry4Ca1, Cry4Ca2, Cry4Cb1, Cry4Cb2, Cry4Cb3, Cry4Cc1, Cry5Aa1, Cry5Ab1, Cry5Ac1, Cry5Ad1, Cry5Ba1, Cry5Ba2, Cry5Ba3, Cry5Ca1, Cry5Ca2, Cry5Da1, Cry5Da2, Cry5Ea1, Cry5Ea2, Cry6Aa1, Cry6Aa2, Cry6Aa3, Cry6Ba1, Cry7Aa1, Cry7Aa2, Cry7Ab1, Cry7Ab2, Cry7Ab3, Cry7Ab4, Cry7Ab5, Cry7Ab6, Cry7Ab7, Cry7Ab8, Cry7Ab9, Cry7Ac1, Cry7Ba1, Cry7Bb1, Cry7Ca1, Cry7Cb1, Cry7Da1, Cry7Da2, Cry7Da3, Cry7Ea1, Cry7Ea2, Cry7Ea3, Cry7Fa1, Cry7Fa2, Cry7Fb1, Cry7Fb2, Cry7Fb3, Cry7Ga1, Cry7Ga2, Cry7Gb1, Cry7Gc1, Cry7Gd1, Cry7Ha1, Cry7Ia1, Cry7Ja1, Cry7Ka1, Cry7Kb1, Cry7La1, Cry8Aa1, Cry8Ab1, Cry8Ac1, Cry8Ad1, Cry8Ba1, Cry8Bb1, Cry8Bc1, Cry8Ca1, Cry8Ca2, Cry8Ca3, Cry8Ca4, Cry8Ca5, Cry8Da1, Cry8Da2, Cry8Da3, Cry8Db1, Cry8Ea1, Cry8Ea2, Cry8Ea3, Cry8Ea4, Cry8Ea5, Cry8Ea6, Cry8Fa1, Cry8Fa2, Cry8Fa3, Cry8Fa4, Cry8Ga1, Cry8Ga2, Cry8Ga3, Cry8Ha1, Cry8Hb1, Cry8Ia1, Cry8Ia2, Cry8Ia3, Cry8Ia4, Cry8Ib1, Cry8Ib2, Cry8Ib3, Cry8Ja1, Cry8Ka1, Cry8Ka2, Cry8Ka3, Cry8Kb1, Cry8Kb2, Cry8Kb3, Cry8La1, Cry8Ma1, Cry8Ma2, Cry8Ma3, Cry8Na1, Cry8Pa1, Cry8Pa2, Cry8Pa3, Cry8Qa1, Cry8Qa2, Cry8Ra1, Cry8Sa1, Cry8Ta1, Cry8-like, Cry8-like, Cry9Aa1, Cry9Aa2, Cry9Aa3, Cry9Aa4, Cry9Aa5, Cry9Aa, like, Cry9Ba1, Cry9Ba2, Cry9Bb1, Cry9Ca1, Cry9Ca2, Cry9Cb1, Cry9Da1, Cry9Da2, Cry9Da3, Cry9Da4, Cry9Db1, Cry9Dc1, Cry9Ea1, Cry9Ea2, Cry9Ea3, Cry9Ea4, Cry9Ea5, Cry9Ea6, Cry9Ea7, Cry9Ea8, Cry9Ea9, Cry9Ea10, Cry9Ea11, Cry9Eb1, Cry9Eb2, Cry9Eb3, Cry9Ec1, Cry9Ed1, Cry9Ee1, Cry9Ee2, Cry9Fa1, Cry9Ga1, Cry9-like, Cry10Aa1, Cry10Aa2, Cry10Aa3, Cry10Aa4, Cry10A-like, Cry11Aa1, Cry11Aa2, Cry11Aa3, Cry11Aa4, Cry11Aa5, Cry11Aa-like, Cry11Ba1, Cry11Bb1, Cry11Bb2, Cry12Aa1, Cry13Aa1, Cry13Aa2, Cry14Aa1, Cry14Ab1, Cry15Aa1, Cry16Aa1, Cry17Aa1, Cry18Aa1, Cry18Ba1, Cry18Ca1, Cry19Aa1, Cry19Ba1, Cry19Ca1, Cry20Aa1, Cry20Ba1, Cry20Ba2, Cry20-like, Cry21Aa1, Cry21Aa2, Cry21Aa3, Cry21Ba1, Cry21Ca1, Cry21Ca2, Cry21Da1, Cry21Ea1, Cry21Fa1, Cry21Ga1, Cry21Ha1, Cry22Aa1, Cry22Aa2, Cry22Aa3, Cry22Ab1, Cry22Ab2, Cry22Ba1, Cry22Bb1, Cry23Aa1, Cry24Aa1, Cry24Ba1, Cry24Ca1, Cry24Da1, Cry25Aa1, Cry26Aa1, Cry27Aa1, Cry28Aa1, Cry28Aa2, Cry29Aa1, Cry29Ba1, Cry30Aa1, Cry30Ba1, Cry30Ca1, Cry30Ca2, Cry30Da1, Cry30Db1, Cry30Ea1, Cry30Ea2, Cry30Ea3, Cry30Ea4, Cry30Fa1, Cry30Ga1, Cry30Ga2, Cry31Aa1, Cry31Aa2, Cry31Aa3, Cry31Aa4, Cry31Aa5, Cry31Aa6, Cry31Ab1, Cry31Ab2, Cry31Ac1, Cry31Ac2, Cry31Ad1, Cry31Ad2, Cry32Aa1, Cry32Aa2, Cry32Ab1, Cry32Ba1, Cry32Ca1, Cry32Cb1, Cry32Da1, Cry32Ea1, Cry32Ea2, Cry32Eb1, Cry32Fa1, Cry32Ga1, Cry32Ha1, Cry32Hb1, Cry32Ia1, Cry32Ja1, Cry32Ka1, Cry32La1, Cry32Ma1, Cry32Mb1, Cry32Na1, Cry32Oa1, Cry32Pa1, Cry32Qa1, Cry32Ra1, Cry32Sa1, Cry32Ta1, Cry32Ua1, Cry32Va1, Cry32Wa1, Cry32Wa2, Cry32Xa1, Cry32Ya1, Cry33Aa1, Cry34Aa1, Cry34Aa2, Cry34Aa3, Cry34Aa4, Cry34Ab1, Cry34Ac1, Cry34Ac2, Cry34Ac3, Cry34Ba1, Cry34Ba2, Cry34Ba3, Cry35Aa1, Cry35Aa2, Cry35Aa3, Cry35Aa4, Cry35Ab1, Cry35Ab2, Cry35Ab3, Cry35Ac1, Cry35Ba1, Cry35Ba2, Cry35Ba3, Cry36Aa1, Cry37Aa1, Cry38Aa1, Cry39Aa1, Cry40Aa1, Cry40Ba1, Cry40Ca1, Cry40Da1, Cry41Aa1, Cry41Ab1, Cry41Ba1, Cry41Ba2, Cry41Ca1, Cry42Aa1, Cry43Aa1, Cry43Aa2, Cry43Ba1, Cry43Ca1, Cry43Cb1, Cry43Cc1, Cry43-like, Cry44Aa1, Cry45Aa1, Cry45Ba1, Cry46Aa1, Cry46Aa2, Cry46Ab1, Cry47Aa1, Cry48Aa1, Cry48Aa2, Cry48Aa3, Cry48Ab1, Cry48Ab2, Cry49Aa1, Cry49Aa2, Cry49Aa3, Cry49Aa4, Cry49Ab1, Cry50Aa1, Cry50Ba1, Cry50Ba2, Cry51Aa1, Cry51Aa2, Cry52Aa1, Cry52Ba1, Cry52Ca1, Cry53Aa1, Cry53Ab1, Cry54Aa1, Cry54Aa2, Cry54Ab1, Cry54Ba1, Cry54Ba2, Cry55Aa1, Cry55Aa2, Cry55Aa3, Cry56Aa1, Cry56Aa2, Cry56Aa3, Cry56Aa4, Cry57Aa1, Cry57Ab1, Cry58Aa1, Cry59Ba1, Cry59Aa1, Cry60Aa1, Cry60Aa2, Cry60Aa3, Cry60Ba1, Cry60Ba2, Cry60Ba3, Cry61Aa1, Cry61Aa2, Cry61Aa3, Cry62Aa1, Cry63Aa1, Cry64Aa1, Cry64Ba1, Cry64Ca1, Cry65Aa1, Cry65Aa2, Cry66Aa1, Cry66Aa2, Cry67Aa1, Cry67Aa2, Cry68Aa1, Cry69Aa1, Cry69Aa2, Cry69Ab1, Cry70Aa1, Cry70Ba1, Cry70Bb1, Cry71Aa1, Cry72Aa1, Cry72Aa2, Cry73Aa1, Cry74Aa, Cry75Aa1, Cry75Aa2, Cry75Aa3, Cry76Aa1, Cry77Aa1, Cry78Aa1, and/or a combination thereof.

[0863] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the PFIP is one or more Cyt toxins. For example, in some embodiments, one or more Cyt toxins or combinations of Cyt toxins can be a Cyt1Aa1, Cyt1Aa2, Cyt1Aa3, Cyt1Aa4, Cyt1Aa5, Cyt1Aa6, Cyt1Aa7, Cyt1Aa8, Cyt1Aa-like, Cyt1Ab1, Cyt1Ba1, Cyt1Ca1, Cyt1Da1, Cyt1Da2, Cyt2Aa1, Cyt2Aa2, Cyt2Aa3, Cyt2Aa4, Cyt2Ba1, Cyt2Ba2, Cyt2Ba3, Cyt2Ba4, Cyt2Ba5, Cyt2Ba6, Cyt2Ba7, Cyt2Ba8, Cyt2Ba9, Cyt2Ba10, Cyt2Ba11, Cyt2Ba12, Cyt2Ba13, Cyt2Ba14, Cyt2Ba15, Cyt2Ba16, Cyt2Ba-like, Cyt2Bb1, Cyt2Bc1, Cyt2B-like, Cyt2Ca1, Cyt3Aa1 and/or a combination thereof.

[0864] In some embodiments, a mixture of the present invention can comprise a PFIP that is one or more Cry toxins and/or one or more Cyt toxins. For example, in some embodiments, the one or more Cry toxins and/or one or more Cyt toxins having an amino acid sequence according to SEQ ID NOs: 1366-1446.

[0865] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the PFIP is one or more Vips, or a combination of Vips. For example, in some embodiments, the one or more Vips can be a Vip1Aa1, Vip1Aa2, Vip1Aa3, Vip1Ab1, Vip1Ac1, Vip1Ad1, Vip1Ba1, Vip1Ba2, Vip1Bb1, Vip1Bb2, Vip1Bb3, Vip1Bc1, Vip1Ca1, Vip1Ca2, Vip1Da1, Vip2Aa1, Vip2Aa2, Vip2Aa3, Vip2Ab1, Vip2Ac1, Vip2Ac2, Vip2Ad1, Vip2Ae1, Vip2Ae2, Vip2Ae3, Vip2Af1, Vip2Af2, Vip2Ag1, Vip2Ag2, Vip2Ba1, Vip2Ba2, Vip2Bb1, Vip2Bb2, Vip2Bb3, Vip2Bb4, Vip3Aa1, Vip3Aa2, Vip3Aa3, Vip3Aa4, Vip3Aa5, Vip3Aa6, Vip3Aa7, Vip3Aa8, Vip3Aa9, Vip3Aa10, Vip3Aa1, Vip3Aa12, Vip3Aa13, Vip3Aa14, Vip3Aa15, Vip3Aa16, Vip3Aa17, Vip3Aa18, Vip3Aa19.0, Vip3Aa19, Vip3Aa20, Vip3Aa21, Vip3Aa22, Vip3Aa23, Vip3Aa24, Vip3Aa25, Vip3Aa26, Vip3Aa27, Vip3Aa28, Vip3Aa29, Vip3Aa30, Vip3Aa31, Vip3Aa32, Vip3Aa33, Vip3Aa34, Vip3Aa35, Vip3Aa36, Vip3Aa37, Vip3Aa38, Vip3Aa39, Vip3Aa40, Vip3Aa41, Vip3Aa42, Vip3Aa43, Vip3Aa44, Vip3Aa45, Vip3Aa46, Vip3Aa47, Vip3Aa48, Vip3Aa49, Vip3Aa50, Vip3Aa51, Vip3Aa52, Vip3Aa53, Vip3Aa54, Vip3Aa55, Vip3Aa56, Vip3Aa57, Vip3Aa58, Vip3Aa59, Vip3Aa60, Vip3Aa61, Vip3Aa62, Vip3Aa63, Vip3Aa64, Vip3Aa65, Vip3Aa66, Vip3Ab1, Vip3Ab2, Vip3Ac1, Vip3Ad1, Vip3Ad2, Vip3Ad3, Vip3Ad4, Vip3Ad5, Vip3Ad6, Vip3Ae1, Vip3Af1, Vip3Af2, Vip3Af3, Vip3Af4, Vip3Ag1, Vip3Ag2, Vip3Ag3, Vip3Ag4, Vip3Ag5, Vip3Ag6, Vip3Ag7, Vip3Ag8, Vip3Ag9, Vip3Ag10, Vip3Ag11, Vip3Ag12, Vip3Ag13, Vip3Ag14, Vip3Ag15, Vip3Ah1, Vip3Ah2, Vip3Ai1, Vip3Aj1, Vip3Aj2, Vip3Ba1, Vip3Ba2, Vip3Bb1, Vip3Bb2, Vip3Bb3, Vip3Bc, Vip3Ca1, Vip3Ca2, Vip3Ca3, Vip3Ca4, Vip4Aa1, and/or a combination thereof.

[0866] In some embodiments, a mixture of the present invention can comprise a PFIP that is a Vip, or a combination of Vips, e.g., a Vip toxin that has an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1447-1552.

[0867] In some embodiments, a mixture of the present invention can comprise one or more CRIPs that are one or more peptides derived from a spider, a scorpion, a cone shell and/or a sea anemone.

[0868] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from an arachnid.

[0869] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Agelenopsis aperta, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 636-641, 761, 1121-25, 1138-40.

[0870] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Agelena orientalis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 739-759, 805-806, 928-929, 995, and 1070.

[0871] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Allagelena opulenta, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1046, and 1071.

[0872] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Ancylometes sp., e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1096.

[0873] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Androctonus australis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 644-646, 692, 1271, 1337, and 1767.

[0874] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Androctonus mauretanicus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1272, 1295, 1306, and 1333.

[0875] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Anuroctonus phaiodactylus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1312, and 1338.

[0876] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Aphonopelma sp, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 777, 792, 957, and 1214-16.

[0877] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Apomastus schleringi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 851, 1075, 1084, 1762, and 1768.

[0878] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Atrax formidabilis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 629-631.

[0879] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Atrax sp. Illawarra, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1156-57.

[0880] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Atrax infensus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 632-633.

[0881] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Atrax robustus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 534, 536, 542, 550, 551, 560, 561, 592-603, 624-627, 650-652, 670-671, 724-728, 874-876, 958, 960, 967, 970, 975, 984-985, 1104, 1141-55, 1568-69, and 1589-90.

[0882] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Bothus martensii Karsch, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 681-684, and 695.

[0883] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Bothus occitanus tunetanus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 676, 701, and 1340-41.

[0884] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Brachypelma albiceps, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 844, 848, and 1217-18.

[0885] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Brachypelma smithi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 845, 850, 868, 877, 1219-20, and 1774.

[0886] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthacus arenicola, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 699, 1339.

[0887] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthotus judaicus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 649, 691, and 698.

[0888] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthus eupeus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs1322, 1324-26, and 1334.

[0889] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthus martensii, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1342-46.

[0890] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthus occitanus mardochei, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 679-680, 1347-48.

[0891] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthus occitanus tunetanus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1301, 1327, 1329, and 1329.

[0892] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Buthus sindicus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1300, 1323.

[0893] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Calisoga sp., e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1048-50, 1766.

[0894] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides elegans, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1290-94, 1316.

[0895] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides exilicauda, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1320.

[0896] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides gracilis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1317.

[0897] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides limbatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1277, 1279, 1287-88.

[0898] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides limpidus limpidus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1285, 1289, and 1319.

[0899] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides margaritatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1284.

[0900] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides noxius, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 687-688, 1264, 1281, 1283, 1286, and 1321.

[0901] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides sculpturatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1318.

[0902] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Centruroides suffusus suffuses, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 689-690.

[0903] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Ceratogyrus marshalli, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 776, 791, and 798.

[0904] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Chilobrachys jingzhao, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 732-736, 934-955.

[0905] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Coremiocnemis valida, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 857, 1056.

[0906] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Ctenus ornatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 731.

[0907] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Cupiennius salei, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1047, 1072-73.

[0908] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Eucratoscelus constrictus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 930, 993-994, 1119-20.

[0909] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Grammostola rosea, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 729-730, 737-738, 778, 829-830, 858-861, 956.

[0910] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hadronyche formidabilis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 765, 1110, and 1158.

[0911] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hadronyche infensa, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 555, 556, 567, 763, 766, 768, 866-867, 913-925, 981-982, and 1159-68.

[0912] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hadronyche venenata, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs:878-883.

[0913] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hadronyche versuta, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 24, 535, 537-541, 543-549, 553, 554, 557-559, 562-566, 568-591, 604-623, 628, 634-635, 653-669, 672-673, 764, 767, 769-773, 884-886, 959, 961-966, 968-969, 971-974, 976-980, 983, 986-992, 1038-42, 1105-06, 1111-18, 1169-1210, 1553-67, 1570-88, and 1591-93.

[0914] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hadrurus gertschi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1314.

[0915] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Haplopelma hainanum, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 825-828.

[0916] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Haplopelma huwenum, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 814-824, 835, 862-863, 865, 869-872, 887-912, 931-933, 1057-69, 1083, 1136, 1221.

[0917] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hemiscorpius lepturus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1335.

[0918] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Heriaeus melloteei, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 926-927.

[0919] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Heterometrus spinifer, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1311, 1313.

[0920] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Heteropoda venatoria, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 803-804, 831-834, 856.

[0921] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Heteroscodra maculate, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 779, 793.

[0922] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hololena curta, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 642-643, 1126-29.

[0923] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hottentotta judaica, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 677, 1349-51, 1769.

[0924] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Hysterocrates gigas, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 802.

[0925] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Illawara wisharti, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1107, 1211.

[0926] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Lasiodora sp, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 864.

[0927] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Latrodectus tredecimguttatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 807, 873.

[0928] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Leiurus quinquestriatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 648, 674-675, 678, 685-686, 693-694, 696-697, 700, 702, 1278, 1282, 1296-98, 1305, 1328, 1332, 1336, 1352-62, 1770-73.

[0929] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Macrothele gigas, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 836-843, 854, 1088, 1108-09, 1132-35.

[0930] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Macrothele raveni, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 855, 1089.

[0931] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Mesobuthus eupeus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 723.

[0932] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Mesobuthus martensii, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1275.

[0933] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Mesobuthus tamulus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1274, 1276, 1307-08, 1763.

[0934] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Missulena bradleyi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 762, 1091, and 1137.

[0935] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Odonthobuthus doriae, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1363.

[0936] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Orthochirus scrobiculosus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1299.

[0937] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Oxyopes lineatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1212.

[0938] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Pandinus imperator, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1263, 1309, and 1315.

[0939] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Parabuthus granulatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1267.

[0940] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Parabuthus transvaalicus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1280.

[0941] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Parabuthus villosus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1265-66.

[0942] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Paraphysa scrofa, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 799, 846, and 849.

[0943] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Phoneutria keyserlingi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 784, 796, and 1087.

[0944] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Phoneutria nigriventer, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 760, 774, 785, 787-788, 790, 797, 808, 1043-45, 1074, 1086, 1090, 1097-1102.

[0945] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Phoneutria reidyi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 775, 786, 789, and 1103.

[0946] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Pireneitega luctuosa, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1092-95.

[0947] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Plectreurys tristis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1051-55, 1085, 1213, and 1775.

[0948] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Plesiophrictus guangxiensis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 811-813.

[0949] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Psalmopoeus cambridgei, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 780, 794, 800, 809-810, 847.

[0950] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Scorpio maurus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 647, 722, 1310, and 1330.

[0951] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Segestria florentina, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1076-82.

[0952] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Stromatopelma calceatum, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 781-782.

[0953] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Theraphosa blondi, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 783, 795, and 801.

[0954] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Thrixopelma pruriens, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 852-853.

[0955] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Tityus cambridgei, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1304.

[0956] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Tityus costatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1270.

[0957] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Tityus discrepans, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1273, 1303.

[0958] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Tityus serrulatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 703, 1268, 1302, and 1364.

[0959] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Tityus trivittatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1269.

[0960] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Tityus zulianus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 704, 1365.

[0961] In some embodiments, a mixture of the present invention can comprise one or more sea anemone peptides.

[0962] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Actinia equine, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1250.

[0963] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Anemonia erythraea, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1222.

[0964] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Anemonia sulcata, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1225-26, 1231, 1237, and 1245.

[0965] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Anthopleura elegantissima, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1223-24, 1229-30, 1235-36, and 1249.

[0966] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Anthopleura fuscoviridis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1232, 1238.

[0967] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Anthopleura xanthogrammica, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1247-48, 1256-60.

[0968] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Bunodosoma caissarum, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1252-53.

[0969] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Bunodosoma cangicum, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1254, 1261-62.

[0970] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Bunodosoma granulifera, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1227-28, 1251.

[0971] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Heteractis crispa, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1233, 1239, 1242, 1244, and 1246.

[0972] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Parasicyonis actinostoloides, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1241.

[0973] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Radianthus paumotensis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1240, 1243.

[0974] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Stoichactis helianthus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1234, 1255.

[0975] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from a cone shell, e.g., a conotoxin.

[0976] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus amadis, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 996.

[0977] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus catus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 997.

[0978] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus ermineus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 998-999.

[0979] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus geographus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1000-08.

[0980] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus gloriamaris, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1009.

[0981] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus kinoshitai, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1010.

[0982] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus magus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1011-15.

[0983] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus marmoreus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1016-19.

[0984] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus purpurascens, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1020-25.

[0985] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus stercusmuscarum, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1026.

[0986] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus striatus, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1027-29.

[0987] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus textile, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1030-31.

[0988] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Conus tulipa, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NOs: 1032-33.

[0989] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more peptides derived from Striated cone, e.g., a peptide having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1034.

[0990] In some embodiments, a mixture of the present invention can comprise one or more ACTX peptides having an amino acid sequence of SEQ ID NOs: 5-6, 24, 534-635, 650-673, 724-728, 763-773, 866-867, 874-876, 878-886, 913-925, 958-992, 1038-42, 1104-1106, 1110-1118, 1141-1157, 1159-1210, and 1553-1593.

[0991] For example, in some embodiments, a mixture of the present invention can comprise a spider toxin having an amino acid sequence according to SEQ ID NOs: 1043-1221.

[0992] In some embodiments, a mixture of the present invention can comprise a scorpion toxin having an amino acid sequence according to SEQ ID NOs: 1263-1365.

[0993] In some embodiments, a mixture of the present invention can comprise one or more U-ACTX peptides, Omega-ACTX peptides, Kappa-ACTX peptides, or a combination thereof.

[0994] In some embodiments, a mixture of the present invention can comprise one or more of a U-ACTX-Hv1a, U+2-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, r-ACTX-Hv1c, -ACTX-Hv1a, and/or -ACTX-Hv1a+2, or a combination thereof.

[0995] In some embodiments, a mixture of the present invention can comprise one or more Kappa-AcTx-Hv1c toxins. In some embodiments, the mixture of the present invention can comprise one or more Kappa-AcTx-Hv1c toxins having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1594.

[0996] In some embodiments, a mixture of the present invention can comprise one or more Omega-HXTX-Ar1d toxins. In some embodiments, the mixture of the present invention can comprise one or more Omega-HXTX-Ar1d toxins having an amino acid sequence according to the amino acid sequence set forth in SEQ ID NO: 1595.

[0997] In some embodiments, a mixture of the present invention can comprise a combination of one or more PFIPs, and one or more co/x-HXTX-Hv1a peptides, one or more U+2-ACTX-Hv1a peptides, or a combination thereof.

[0998] In some embodiments, the mixture of the present invention provides for a CRIP having the amino acid sequence that is

TABLE-US-00048 (SEQIDNO:5) GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA.

[0999] In some embodiments, a mixture of the present invention can comprise a combination of one or more PFIPs, and one or more ctenitoxins (CNTXs).

[1000] For example, in some embodiments, a mixture of the present invention can comprise one or more -CNTX-Pn1a peptides.

[1001] In some embodiments, a mixture of the present invention can comprise a -CNTX-Pn1a having an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1778.

[1002] In some embodiments, a mixture of the present invention can comprise a -CNTX-Pn1a having an amino acid sequence of

TABLE-US-00049 (SEQIDNO:1778) GSCADINGACKSDCDCCGDSVTCDCYWSDSCKCRESNFKIGMAIRKKFC.

[1003] In some embodiments, a mixture of the present invention can comprise one or more PFIPs and one or more sea anemone toxins, e.g., an Av2 toxin, an Av3 toxin, and/or an Av3-Variant Polypeptide (AVP).

[1004] In some embodiments, a mixture of the present invention can comprise one or more Av2 toxins having an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1779.

[1005] In some embodiments, a mixture of the present invention can comprise one or more Av3 toxins having an amino acid sequence according the amino acid sequence set forth in SEQ ID NO: 1780.

[1006] In some embodiments, a mixture of the present invention can comprise one or more Av3-Variant Polypeptides (AVPs) having an amino acid sequence according the amino acid sequence set forth in SEQ ID NOs: 1781 and 1782.

[1007] In some embodiments, a mixture of the present invention can comprise two types of insecticidal peptides, wherein the first type of insecticidal peptide is a Pore Forming Insecticidal Protein (PFIP), and the second type of insecticidal peptide is a Cysteine Rich Insecticidal Peptide (CRIP), wherein the PFIP is a Becker Bti, a NOVODOR FC Btt, or a BioProtec Plus Btk; and wherein the CRIP is an atracotoxin (ACTX), ctenitoxin (CNTX), or Av3-Variant Polypeptide (AVP).

[1008] In some embodiments, a mixture of the present invention can comprise one or more of any of the PFIPs as described herein, and one or more of any of the CRIPS as described herein.

[1009] Illustrative Mixtures, Compositions, and Combinations

[1010] Any of the aforementioned PFIPs or CRIPs described herein and/or methods described herein, can be used to produce one or more polypeptides compositions, formulations, and/or compositions comprising one or more PFIPs and one or more CRIPS as described herein.

[1011] In some embodiments, a PFIP and a CRIP can have an amino acid sequence as set forth in sequence listing or herein, including all of the polynucleotides and/or coding genes as described in the references provided above and herein-when applicable. Specific examples of PFIPs and CRIPs, disclosed for purposes of providing examples and not intended to be limiting in any way, are the abovementioned PFIPs and CRIPs (and their homologies where applicable), and in particular peptides and nucleotides including CRIPs, i.e., the atracotoxin (ACTX), the ctenitoxin (CNTX), and the Av3-Variant Polypeptide (AVP).

[1012] Described and incorporated by reference to the CRIP polypeptides identified herein are homologous variants of sequences mentioned, having homology to such sequences or referred to herein, which are also identified and claimed as suitable for making special according to the processes described herein, including all homologous sequences having at least any of the following percent identities to any of the sequences disclosed here or to any sequence incorporated by reference: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or greater identity or 100% identity to any and all sequences identified in the sequences noted above, and to any other sequence identified herein, including each and every sequence in the sequence listing of this application. When the term homologous or homology is used herein with a number such as 50% or greater, then what is meant is percent identity or percent similarity between the two peptides. When homologous or homology is used without a numeric percent then it refers to two peptide sequences that are closely related in the evolutionary or developmental aspect in that they share common physical and functional aspects, like topical toxicity and similar size (i.e., the homolog being within 100% greater length or 50% shorter length of the peptide specifically mentioned herein or identified by reference herein as above).

[1013] Sprayable Compositions

[1014] Examples of spray products of the present invention can include field sprayable formulations for agricultural usage and indoor sprays for use in interior spaces in a residential or commercial space. In some embodiments, residual sprays or space sprays comprising a composition comprising one or more PFIPs and one or more CRIPs can be used to reduce or eliminate insect pests in an interior space. Surface spraying indoors (SSI) is the technique of applying a variable volume sprayable volume of an insecticide onto indoor surfaces where vectors rest, such as on walls, windows, floors and ceilings. The primary goal of variable volume sprayable volume is to reduce the lifespan of the insect pest, (for example, a fly, a flea, a tick, or a mosquito vector) and thereby reduce or interrupt disease transmission. The secondary impact is to reduce the density of insect pests within the treatment area. SSI can be used as a method for the control of insect pest vector diseases, such as Lyme disease, Salmonella, Chikungunya virus, Zika virus, and malaria, and can also be used in the management of parasites carried by insect vectors, such as Leishmaniasis and Chagas disease. Many mosquito vectors that harbor Zika virus, Chikungunya virus, and malaria include endophilic mosquito vectors, resting inside houses after taking a blood meal. These mosquitoes are particularly susceptible to control through surface spraying indoors (SSI) with a sprayable composition comprising a composition comprising one or more PFIPs and one or more CRIPs. As its name implies, SSI involves applying the composition onto the walls and other surfaces of a house with a residual insecticide. In one embodiment, the composition containing a composition comprising one or more PFIPs and one or more CRIPs and one or more non-CRIP peptides, polypeptides and proteins will knock down insect pests that come in contact with these surfaces. SSI does not directly prevent people from being bitten by mosquitoes. Rather, it usually controls insect pests after they have blood fed, if they come to rest on the sprayed surface. SSI thus prevents transmission of infection to other persons. To be effective, SSI must be applied to a very high proportion of households in an area (usually greater than 40-80 percent). Therefore, sprays in accordance with the invention having good residual efficacy and acceptable odor are particularly suited as a component of integrated insect pest vector management or control solutions.

[1015] In contrast to SSI, which requires that the active composition comprising one or more PFIPs and one or more CRIPs is bound to surfaces of dwellings, such as walls or ceilings, as with a paint, for example, space spray products of the invention rely on the production of a large number of small insecticidal droplets intended to be distributed through a volume of air over a given period of time. When these droplets impact on a target insect pest, they deliver a knockdown effective dose of the composition comprising one or more PFIPs and one or more CRIPs effective to control the insect pest. The traditional methods for generating a space-spray include thermal fogging (whereby a dense cloud of a composition comprising one or more PFIPs and one or more CRIPs composition comprising droplets is produced giving the appearance of a thick fog) and Ultra Low Volume (ULV), whereby droplets are produced by a cold, mechanical aerosol-generating machine. Ready-to-use aerosols such as aerosol cans may also be used.

[1016] Because large areas can be treated at any one time, the foregoing method is a very effective way to rapidly reduce the population of flying insect pests in a specific area. And, because there is very limited residual activity from the application, it must be repeated at intervals of 5-7 days in order to be fully effective. This method can be particularly effective in epidemic situations where rapid reduction in insect pest numbers is required. As such, it can be used in urban dengue control campaigns.

[1017] Effective space-spraying is generally dependent upon the following specific principles. Target insects are usually flying through the spray cloud (or are sometimes impacted whilst resting on exposed surfaces). The efficiency of contact between the spray droplets and target insects is therefore crucial. This is achieved by ensuring that spray droplets remain airborne for the optimum period of time and that they contain the right dose of insecticide. These two issues are largely addressed through optimizing the droplet size. If droplets are too big they drop to the ground too quickly and don't penetrate vegetation or other obstacles encountered during application (limiting the effective area of application). If one of these big droplets impacts an individual insect then it is also overkill, because a high dose will be delivered per individual insect. If droplets are too small then they may either not deposit on a target insect (no impaction) due to aerodynamics or they can be carried upwards into the atmosphere by convection currents. The optimum size of droplets for space-spray application are droplets with a Volume Median Diameter (VMD) of 10-25 microns.

[1018] The active compositions of the present invention comprising at least one composition comprising one or more PFIPs and one or more CRIPs may be made available in a spray product as an aerosol-based application, including aerosolized foam applications. Pressurized cans are the typical vehicle for the formation of aerosols. An aerosol propellant that is compatible with the composition comprising one or more PFIPs and one or more CRIPs is used. Preferably, a liquefied-gas type propellant is used.

[1019] Suitable propellants include compressed air, carbon dioxide, butane and nitrogen. The concentration of the propellant in the active compound composition is from about 5 percent to about 40 percent by weight of the pyridine composition, preferably from about 15 percent to about 30 percent by weight of the composition comprising one or more PFIPs and one or more CRIPs containing composition.

[1020] In one embodiment, the composition comprising one or more PFIPs and one or more CRIPs containing formulations of the invention can also include one or more foaming agents. Foaming agents that can be used include sodium laureth sulfate, cocamide DEA, and cocamidopropyl betaine. Preferably, the sodium laureth sulfate, cocamide DEA and cocamidopropyl are used in combination. The concentration of the foaming agent(s) in the active compound composition is from about 10 percent to about 25 percent by weight, more preferably 15 percent to 20 percent by weight of the composition.

[1021] When such formulations are used in an aerosol application not containing foaming agents, the active compositions of the present invention can be used without the need for mixing directly prior to use. However, aerosol formulations containing the foaming agents do require mixing (i.e., shaking) immediately prior to use. In addition, if the formulations containing foaming agents are used for an extended time, they may require additional mixing at periodic intervals during use.

[1022] In some embodiments, a dwelling area may also be treated with an active composition comprising one or more PFIPs and one or more CRIPs composition of the present invention by using a burning formulation, such as a candle, a smoke coil or a piece of incense containing the composition. For example, composition may be comprised in household products such as heated air fresheners in which insecticidal compositions are released upon heating, for example, electrically, or by burning. The active compound compositions of the present invention containing a composition comprising one or more PFIPs and one or more CRIPs may be made available in a spray product as an aerosol, a mosquito coil, and/or a vaporizer or fogger.

[1023] In some embodiments, fabrics and garments may be made containing a pesticidal effective composition comprising a composition comprising one or more PFIPs and one or more CRIPs of the present disclosure. In some embodiments, the concentration of the composition comprising one or more PFIPs and one or more CRIPs in the polymeric material, fiber, yarn, weave, net, or substrate described herein, can be varied within a relatively wide concentration range from, for example 0.05 to 15 percent by weight, preferably 0.2 to 10 percent by weight, more preferably 0.4 to 8 percent by weight, especially 0.5 to 5, such as 1 to 3, percent by weight.

[1024] Similarly, the concentration of the composition comprising one or more PFIPs and one or more CRIPs in the composition of the invention (whether for treating surfaces or for coating a fiber, yarn, net, weave) can be varied within a relatively wide concentration range from, for example 0.1 to 70 percent by weight, such as 0.5 to 50 percent by weight, preferably 1 to 40 percent by weight, more preferably 5 to 30 percent by weight, especially 10 to 20 percent by weight.

[1025] The concentration of the composition comprising one or more PFIPs and one or more CRIPs may be chosen according to the field of application such that the requirements concerning knockdown efficacy, durability and toxicity are met. Adapting the properties of the material can also be accomplished and so custom-tailored textile fabrics are obtainable in this way.

[1026] Accordingly an effective amount of a composition comprising one or more PFIPs and one or more CRIPs can depend on the specific use pattern, the insect pest against which control is most desired and the environment in which composition comprising one or more PFIPs and one or more CRIPs will be used. Therefore, an effective amount of a composition comprising one or more PFIPs and one or more CRIPs is sufficient that control of an insect pest is achieved.

[1027] In some embodiments, the present disclosure provides compositions or formulations for coating walls, floors and ceilings inside of buildings and for coating a substrate or non-living material, which comprise a composition comprising one or more PFIPs and one or more CRIPs. The inventive compositions can be prepared using known techniques for the purpose in mind, which could contain a binder to facilitate the binding of the compound to the surface or other substrate. Agents useful for binding are known in the art and tend to be polymeric in form. The type of binder suitable for a compositions to be applied to a wall surface having particular porosities and/or binding characteristics would be different compared to a fiber, yarn, weave or netthus, a skilled person, based on known teachings, would select a suitable binder based on the desired surface and/or substrate.

[1028] Typical binders are poly vinyl alcohol, modified starch, poly vinyl acrylate, polyacrylic, polyvinyl acetate co polymer, polyurethane, and modified vegetable oils. Suitable binders can include latex dispersions derived from a wide variety of polymers and co-polymers and combinations thereof. Suitable latexes for use as binders in the inventive compositions comprise polymers and copolymers of styrene, alkyl styrenes, isoprene, butadiene, acrylonitrile lower alkyl acrylates, vinyl chloride, vinylidene chloride, vinyl esters of lower carboxylic acids and alpha, beta-ethylenically unsaturated carboxylic acids, including polymers containing three or more different monomer species copolymerized therein, as well as post-dispersed suspensions of silicones or polyurethanes. Also suitable may be a polytetrafluoroethylene (PTFE) polymer for binding the active ingredient to other surfaces.

[1029] In some exemplary embodiments, an insecticidal formulation according to the present disclosure may comprises at least one CRIP, or insecticidal protein comprising one or more CRIP, (optionally with a secondary invertebrate pest control agent described herein) and a an excipient, diluent or carrier, such as water, and optionally a polymeric binder and optionally further components such as a dispersing agent, a polymerizing agent, an emulsifying agent, a thickener, an alcohol, a fragrance or any other inert excipients used in the preparation of sprayable insecticides known in the art.

[1030] The polymeric binder binds the pyridine compounds to the surface of the non-living material and ensures a long-term effect. Using the binder reduces the elimination of the pyridine pesticide out of the non-living material due to environmental effects such as rain or due to human impact on the non-living material such as washing and/or cleaning it. Further, additional components can include an additional insecticide compound, and/or a UV stabilizer.

[1031] The inventive compositions can be in a number of different forms or formulation types, such as suspensions, capsules suspensions, and a person skilled in the art can prepare the relevant composition based on the properties of the particular CRIP or insecticidal protein comprising one or more CRIPs, its uses and also application type. For example, the composition comprising one or more PFIPs and one or more CRIPs used in the methods, embodiments and other aspects of the present disclosure may be encapsulated in the formulation. An encapsulated composition comprising one or more PFIPs and one or more CRIPs can provide improved wash-fastness and also longer period of activity. The formulation can be organic based or aqueous based, preferably aqueous based.

[1032] Microencapsulated composition comprising one or more PFIPs and one or more CRIPs suitable for use in the compositions and methods according to the present disclosure may be prepared with any suitable technique known in the art. For example, various processes for microencapsulating material have been previously developed. These processes can be divided into three categories: physical methods, phase separation, and interfacial reaction. In the physical methods category, microcapsule wall material and core particles are physically brought together and the wall material flows around the core particle to form the microcapsule. In the phase separation category, microcapsules are formed by emulsifying or dispersing the core material in an immiscible continuous phase in which the wall material is dissolved and caused to physically separate from the continuous phase, such as by coacervation, and deposit around the core particles. In the interfacial reaction category, microcapsules are formed by emulsifying or dispersing the core material in an immiscible continuous phase and then an interfacial polymerization reaction is caused to take place at the surface of the core particles. The concentration of the composition comprising one or more PFIPs and one or more CRIPs present in the microcapsules can vary from 0.1 to 60% by weight of the microcapsule.

[1033] The formulation used in the composition comprising one or more PFIPs and one or more CRIPs containing compositions, methods, embodiments and other aspects according to the present disclosure may be formed by mixing all ingredients together with water optionally using suitable mixing and/or dispersing aggregates. In general, such a formulation is formed at a temperature of from 10 to 70 C., preferably 15 to 50 C., more preferably 20 to 40 C. Generally, a formulation comprising one or more of (A), (B), (C), and/or (D) is possible, wherein it is possible to use: a composition comprising one or more PFIPs and one or more CRIPs (as pesticide) (A); solid polymer (B); optional additional additives (D); and to disperse them in the aqueous component (C). If a binder is present in a composition of the present invention, it is preferred to use dispersions of the polymeric binder (B) in water as well as aqueous formulations of the composition comprising one or more PFIPs and one or more CRIPs (A) in water which have been separately prepared before. Such separate formulations may contain additional additives for stabilizing (A) and/or (B) in the respective formulations and are commercially available. In a second process step, such raw formulations and optionally additional water (component (C)) are added. Also, combinations of the abovementioned ingredients based on the foregoing scheme are likewise possible, e.g., using a pre-formed dispersion of (A) and/or (B) and mixing it with solid (A) and/or (B). A dispersion of the polymeric binder (B) may be a pre-manufactured dispersion already made by a chemicals manufacturer.

[1034] Moreover, it is also within the scope of the present invention to use hand-made dispersions, i.e., dispersions made in small-scale by an end-user. Such dispersions may be made by providing a mixture of about 20 percent of the binder (B) in water, heating the mixture to temperature of 90 C. to 100 C. and intensively stirring the mixture for several hours. It is possible to manufacture the formulation as a final product so that it can be readily used by the end-user for the process according to the present invention. And, it is of course similarly possible to manufacture a concentrate, which may be diluted by the end-user with additional water (C) to the desired concentration for use.

[1035] In an embodiment, a composition suitable for SSI application or a coating formulation containing a composition comprising one or more PFIPs and one or more CRIPs contains the active ingredient and a carrier, such as water, and may also one or more co-formulants selected from a dispersant, a wetter, an anti-freeze, a thickener, a preservative, an emulsifier and a binder or sticker.

[1036] In some embodiments, an exemplary solid formulation of a composition comprising one or more PFIPs and one or more CRIPs, is generally milled to a desired particle size, such as the particle size distribution d(0.5) is generally from 3 to 20, preferably 5 to 15, especially 7 to 12, m.

[1037] Furthermore, it may be possible to ship the formulation to the end-user as a kit comprising at least a first component comprising a composition comprising one or more PFIPs and one or more CRIPs (A); and a second component comprising at least one polymeric binder (B). Further additives (D) may be a third separate component of the kit, or may be already mixed with components (A) and/or (B). The end-user may prepare the formulation for use by just adding water (C) to the components of the kit and mixing. The components of the kit may also be formulations in water. Of course it is possible to combine an aqueous formulation of one of the components with a dry formulation of the other component(s). As an example, the kit can comprise one formulation of a composition comprising one or more PFIPs and one or more CRIPs (A) and optionally water (C); and a second, separate formulation of at least one polymeric binder (B), water as component (C) and optionally components (D).

[1038] The concentrations of the components (A), (B), (C) and optionally (D) will be selected by the skilled artisan depending of the technique to be used for coating/treating. In general, the amount of a composition comprising one or more PFIPs and one or more CRIPs (A) may be up to 50, preferably 1 to 50, such as 10 to 40, especially 15 to 30, percent by weight, based on weight of the composition. The amount of polymeric binder (B) may be in the range of 0.01 to 30, preferably 0.5 to 15, more preferably 1 to 10, especially 1 to 5, percent by weight, based on weight of the composition. If present, in general the amount of additional components (D) is from 0.1 to 20, preferably 0.5 to 15, percent by weight, based on weight of the composition. If present, suitable amounts of pigments and/or dyestuffs and/or fragrances are in general 0.01 to 5, preferably 0.1 to 3, more preferably 0.2 to 2, percent by weight, based on weight of the composition. A typical formulation ready for use comprises 0.1 to 40, preferably 1 to 30, percent of components (A), (B), and optionally (D), the residual amount being water (C). A typical concentration of a concentrate to be diluted by the end-user may comprise 5 to 70, preferably 10 to 60, percent of components (A), (B), and optionally (D), the residual amount being water (C).

[1039] In some embodiments, a mixture of the present invention can have a ratio of PFIP to CRIP that is about 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000.

[1040] In some embodiments, a mixture of the present invention can have a ratio of Bti to ACTX that is from about 1:1 to about 1:5000.

[1041] In some embodiments, a mixture of the present invention can have ratio of Bti to ACTX that is about 1:4000.

[1042] In some embodiments, a mixture of the present invention can have a ratio of Btk to ACTX that is from about 1:1 to about 1:10.

[1043] In some embodiments, a mixture of the present invention can have a ratio of Btk to ACTX that is about 1:9.2

[1044] In some embodiments, a mixture of the present invention can have a ratio of Btk to Av3 that is from about 1:1 to about 1:1.5.

[1045] In some embodiments, a mixture of the present invention can have a ratio of Btk to AVP that is about 1:1.375.

[1046] In some embodiments, a mixture of the present invention can have a ratio of Btt to ACTX that is from about 1:1 to about 1:10.

[1047] In some embodiments, a mixture of the present invention can have a ratio of Btt to ACTX is about 1:8.75.

[1048] Method of Using

[1049] In some embodiments, the present disclosure comprises a method for controlling an invertebrate pest in agronomic and/or nonagronomic applications, comprising contacting the invertebrate pest or its environment, a solid surface, including a plant surface or part thereof, with a biologically effective amount of the composition of the present invention. Examples of suitable compositions comprising one or more PFIPs and one or more CRIPS as described herein, include a liquid solution, an emulsion, a powder, a granule, a nanoparticle, a microparticle, or a combination of the above formulated into a compositions.

[1050] In some embodiments, the method provides for providing a composition of at least two types of agents, wherein the first type of agent is a PFIP, and the second type of agent is a CRIP, wherein the PFIP is selected from one or any combination of the PFIPs as described herein, and wherein the CRIP is selected from the one or any combination of the CRIP described herein, and then applying said composition to the locus of an insect.

[1051] In some embodiments, the method provides for using a composition comprising one or more PFIPs and one or more CRIPs to control insecticidal-resistant insects.

[1052] In some embodiments, the method of the present invention provides for protecting a plant from insects comprising, providing a plant which expresses one or more polypeptides, or polynucleotides encoding the same, wherein one type of the polypeptide, or polynucleotide encoding the same, is a PFIP, and the other type of polypeptide, or polynucleotide encoding the same, is a CRIP.

[1053] In some embodiments, the method of the present invention provides for protecting a plant from insecticidal-resistant insects comprising, providing a plant which expresses one or more polypeptides, or polynucleotides encoding the same, wherein one type of the polypeptide, or polynucleotide encoding the same, is a PFIP, and the other type of polypeptide, or polynucleotide encoding the same, is a CRIP.

[1054] In some embodiments, the method of the present invention provides a method for controlling insects comprising, providing to said insect a transgenic plant that comprises in its genome a stably incorporated polynucleotide construct, wherein said polynucleotide construct comprises a first expression cassette operable to encode a PFIP, and a second expression cassette operable to encode a CRIP.

[1055] In some embodiments, the method of the present invention provides a method of combating, controlling, or inhibiting a pest comprising, applying a pesticidally effective amount of a composition comprising one or more of the PFIPs described herein and one or more CRIPS described herein, to the locus of the pest, or to a plant or animal susceptible to an attack by the pest.

[1056] In some embodiments, to achieve contact with a compound or composition of the invention to protect a field crop from invertebrate pests, the compound or composition is typically applied to the seed of the crop before planting, to the foliage (e.g., leaves, stems, flowers, fruits) of crop plants, or to the soil or other growth medium before or after the crop is planted.

[1057] One embodiment of a method of contact is by spraying. Alternatively, a granular composition comprising a one or more PFIPs and one or more CRIPs of the invention can be applied to the plant foliage or the soil. Compounds of this invention can also be effectively delivered through plant uptake by contacting the plant with a composition comprising a compound of this invention applied as a soil drench of a liquid formulation, a granular formulation to the soil, a nursery box treatment or a dip of transplants. Of note is a composition of the present disclosure in the form of a soil drench liquid formulation. Also of note is a method for controlling an invertebrate pest comprising contacting the invertebrate pest or its environment with a biologically effective amount of a one or more PFIPs and one or more CRIPs of the invention of the present disclosure, or with a composition comprising a biologically effective amount of a one or more PFIPs and one or more CRIPs of the invention of the present disclosure. Of further note, in some illustrative embodiments, the illustrative method includes wherein the environment is soil and the composition is applied to the soil as a soil drench formulation. Of further note is that a one or more PFIPs and one or more CRIPs of the invention are also effective by localized application to the locus of infestation. Other methods of contact include application of a compound or a composition of the invention by direct and residual sprays, aerial sprays, gels, seed coatings, microencapsulations, systemic uptake, baits, ear tags, boluses, foggers, fumigants, aerosols, dusts and many others. One embodiment of a method of contact is a dimensionally stable fertilizer granule, stick or tablet comprising a compound or composition of the invention. The compounds of this invention can also be impregnated into materials for fabricating invertebrate control devices (e.g., insect netting, application onto clothing, application into candle formulations and the like).

[1058] In some embodiments, a composition comprising one or more PFIPs and one or more CRIPs of the invention are also useful in seed treatments for protecting seeds from invertebrate pests. In the context of the present disclosure and claims, treating a seed means contacting the seed with a biologically effective amount of a composition comprising one or more PFIPs and one or more CRIPs of the invention of this invention, which is typically formulated as a composition of the invention. This seed treatment protects the seed from invertebrate soil pests and generally can also protect roots and other plant parts in contact with the soil of the seedling developing from the germinating seed. The seed treatment may also provide protection of foliage by translocation of the composition comprising one or more PFIPs and one or more CRIPs of the invention within the developing plant. Seed treatments can be applied to all types of seeds, including those from which plants genetically transformed to express specialized traits will germinate. In addition, a composition comprising one or more PFIPs and one or more CRIPs of the invention can be transformed into a plant or part thereof, for example a plant cell, or plant seed, that is already transformed with proteins toxic to invertebrate pests, such as Bacillus thuringiensis toxins or protein crystals or those expressing herbicide resistance such as glyphosate acetyltransferase, which provides resistance to glyphosate. Representative examples include those expressing proteins toxic to invertebrate pests, such as Bacillus thuringiensis toxins and/or protein crystals, or those expressing herbicide resistance such as glyphosate acetyltransferase, which provides resistance to glyphosate.

[1059] One method of seed treatment is by spraying or dusting the seed with a composition comprising one or more PFIPs and one or more CRIPs of the invention (i.e. as a formulated composition) before sowing the seeds. Compositions formulated for seed treatment generally comprise a film former or adhesive agent. Therefore, typically, a seed coating composition of the present disclosure comprises a biologically effective amount of a composition comprising one or more PFIPs and one or more CRIPs of the invention, and a film former or adhesive agent. Seed can be coated by spraying a flowable suspension concentrate directly into a tumbling bed of seeds and then drying the seeds. Alternatively, other formulation types such as wetted powders, solutions, suspoemulsions, emulsifiable concentrates and emulsions in water can be sprayed on the seed. This process is particularly useful for applying film coatings on seeds. Various coating machines and processes are available to one skilled in the art. Suitable processes include those listed in P. Kosters et al., Seed Treatment: Progress and Prospects, 1994 BCPC Monograph No. 57, and references listed therein.

[1060] The treated seed typically comprises a composition comprising one or more PFIPs and one or more CRIPs of the invention in an amount ranging from about 0.01 g to 1 kg per 100 kg of seed (i.e. from about 0.00001 to 1% by weight of the seed before treatment). A flowable suspension formulated for seed treatment typically comprises from about 0.5 to about 70% of the active ingredient, from about 0.5 to about 30% of a film-forming adhesive, from about 0.5 to about 20% of a dispersing agent, from 0 to about 5% of a thickener, from 0 to about 5% of a pigment and/or dye, from 0 to about 2% of an antifoaming agent, from 0 to about 1% of a preservative, and from 0 to about 75% of a volatile liquid diluent.

[1061] In some embodiments, the present invention provides a method to control insects, said method comprising, providing a mixture of at least two types of peptides, wherein the first type of peptide is a PFIP, and the second type of peptide is a CRIP, wherein the PFIP is selected from one or any combination of the PFIPs described herein); and wherein the CRIP is selected from the one or any combination of the CRIPs described herein (e.g., an atracotoxin (ACTX), a ctenitoxin (CNTX), an Av2 toxin, an Av3 toxin, an Av3-Variant Polypeptide (AVP), or a combination thereof); wherein the PFIP is not fused to the CRIP; and then applying said mixture to the locus of an insect.

[1062] In some embodiments, the present invention provides a method to control insects, wherein the insects are selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydia pomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1063] In some embodiments, the present invention provides a method to control Bacillus thuringiensis-toxin-resistant insects, said method comprising, providing a mixture of at least two types of peptides, wherein the first type of peptide is a PFIP, and the second type of peptide is a CRIP, wherein the PFIP is selected from one or any combination of the PFIPs described herein; and wherein the CRIP is selected from the one or any combination of the CRIPs described herein (e.g., an atracotoxin (ACTX), a ctenitoxin (CNTX), an Av2 toxin, an Av3 toxin, an Av3-Variant Polypeptide (AVP), or a combination thereof); wherein the PFIP is not fused to the CRIP; and then applying said mixture to the locus of an insect.

[1064] In some embodiments, the present invention provides a method to control Bacillus thuringiensis-toxin-resistant insects, wherein the Bacillus thuringiensis-toxin-resistant insects are selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1065] In some embodiments, the present invention provides a method of protecting a plant from insects comprising, providing a plant which expresses two or more polypeptides, wherein one type of polypeptide is a PFIP, or a polynucleotide encoding the same; and the other type of polypeptide is a CRIP, or polynucleotide encoding the same; and wherein the PFIP is not fused to the CRIP.

[1066] In some embodiments, the present invention provides a method of protecting a plant from insects, wherein the insects are selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydia pomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1067] In some embodiments, the present invention provides a method of protecting a plant from a Bacillus thuringiensis-toxin-resistant insect comprising, providing a plant which expresses two or more polypeptides, wherein one type of polypeptide is a PFIP, or a polynucleotide encoding the same; and the other type of polypeptide is a CRIP, or polynucleotide encoding the same; and wherein the PFIP is not fused to the CRIP.

[1068] In some embodiments, the present invention provides a method of protecting a plant from a Bacillus thuringiensis-toxin-resistant insect, wherein the plant expresses a mixture consisting of a PFIP, or a polynucleotide encoding the same; and a CRIP or a polynucleotide encoding the same.

[1069] In some embodiments, the present invention provides a method of protecting a plant from a Bacillus thuringiensis-toxin-resistant insect, wherein the Bacillus thuringiensis-toxin-resistant insects are selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1070] In some embodiments, the present invention provides a method for controlling insects comprising, providing to said insect a transgenic plant that comprises in its genome a stably incorporated nucleic acid construct, wherein said stably incorporated nucleic acid construct comprises a first polynucleotide operable to encode a PFIP, and a second polynucleotide operable to encode a CRIP, and wherein the PFIP when combined with the CRIP produces a insecticidal effect.

[1071] In some embodiments, the present invention provides a method of combating, controlling, or inhibiting a pest comprising, applying a pesticidally effective amount of any one of the mixtures described herein (e.g., a mixture comprising one or more PFIPs and one or more CRIPs) to the locus of the pest, or to a plant or animal susceptible to an attack by the pest.

[1072] In some embodiments, the present invention provides a method of combating, controlling, or inhibiting a pest, wherein the pest is selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydia pomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1073] In some embodiments, the present invention provides a method of combating, controlling, or inhibiting a pest, wherein the pest is selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens, Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1074] In some embodiments, the present invention provides a method of combating, controlling, or inhibiting a pest comprising, applying a pesticidally effective amount of the mixture of the present invention to the locus of the pest, or to a plant or animal susceptible to an attack by the pest; wherein the mixture of each insecticidal peptide results in an insecticidal effect.

[1075] In some embodiments, the present invention provides a method of combating, controlling, or inhibiting a pest, wherein the pest is selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydiapomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1076] In some embodiments, the present invention provides a method of combating, controlling, or inhibiting a pest, wherein the pest is selected from the group consisting of: Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens, Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

[1077] Mixtures and Products Utilizing the Composition

[1078] Any of the mixtures, products, polypeptides and/or plants utilizing the composition of the present invention, i.e., one or more PFIPs and one or more CRIPs, and described herein, can be used to control pests, their growth, and/or the damage caused by their actions, especially their damage to plants and animals (e.g., chickens). Compositions comprising one or more PFIPs and one or more CRIPs, for example, agrochemical compositions, can include, but is not limited to, aerosols and/or aerosolized products, for example, sprays, fumigants, powders, dusts, and/or gases; seed dressings; oral preparations (e.g., insect food, etc.); transgenic organisms expressing and/or one or more PFIPs and one or more CRIPs (either transiently and/or stably), for example, a plant or an animal.

[1079] In some embodiments, compositions comprising a one or more PFIPs and one or more CRIPs and one or more non-CRIP or non-PFIP peptides, polypeptides, proteins, or agents can be used concomitantly, or sequentially with other insecticides proteins, and/or pesticides, e.g., AaIT1, permethrin, and other known insecticides.

[1080] In some embodiments, the active ingredients of the present disclosure can be applied in the form of compositions and can be applied to the crop area or plant to be treated, simultaneously or in succession, with other compounds. These compounds can be fertilizers, weed killers, cryoprotectants, surfactants, detergents, pesticidal soaps, dormant oils, polymers, and/or time-release or biodegradable carrier formulations that permit long-term dosing of a target area following a single application of the formulation. They can also be selective herbicides, chemical insecticides, virucides, microbicides, amoebicides, pesticides, fungicides, bacteriocides, nematocides, molluscicides or mixtures of several of these preparations, if desired, together with further agriculturally acceptable carriers, surfactants or application-promoting adjuvants customarily employed in the art of formulation. Suitable carriers and adjuvants can be solid or liquid and correspond to the substances ordinarily employed in formulation technology, e.g. natural or regenerated mineral substances, solvents, dispersants, wetting agents, tackifiers, binders or fertilizers. Likewise, the formulations may be prepared into edible baits or fashioned into pest traps to permit feeding or ingestion by a target pest of the pesticidal formulation.

[1081] Methods of applying an active ingredient of the present disclosure or an agrochemical composition of the present disclosure that contains at least one of the PFIPs and at least one of the CRIPs produced by the methods described herein of the present disclosure include leaf application, seed coating and soil application. In some embodiments, the number of applications and the rate of application depend on the intensity of infestation by the corresponding pest.

[1082] The composition may be formulated as a powder, dust, pellet, granule, spray, emulsion, colloid, solution, or such like, and may be prepared by such conventional means as desiccation, lyophilization, homogenization, extraction, filtration, centrifugation, sedimentation, or concentration of a culture of cells comprising the polypeptide. In all such compositions that contain at least one such pesticidal polypeptide, the polypeptide may be present in a concentration of from about 1% to about 99% by weight.

[1083] In some embodiments, compositions containing one or more PFIPs and one or more CRIPs may be prophylactically applied to an environmental area to prevent infestation by a susceptible pest, for example, a lepidopteran and/or coleopteran pest, which may be killed or reduced in numbers in a given area by the methods of the invention. In some embodiments, the pest ingests, or comes into contact with, a pesticidally-effective amount of the polypeptide.

[1084] In some embodiments, the pesticide compositions described herein may be made by formulating either the bacterial, yeast, or other cell, crystal and/or spore suspension, or isolated protein component with the desired agriculturally-acceptable carrier. The compositions may be formulated prior to administration in an appropriate means such as lyophilized, freeze-dried, desiccated, or in an aqueous carrier, medium or suitable diluent, such as saline and/or other buffer. In some embodiments, the formulated compositions may be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), or water or oil/water emulsions, or as a wettable powder, or in combination with any other carrier material suitable for agricultural application. Suitable agricultural carriers can be solid or liquid and are well known in the art. In some embodiments, the formulations may be mixed with one or more solid or liquid adjuvants and prepared by various means, e.g., by homogeneously mixing, blending and/or grinding the pesticidal composition with suitable adjuvants using conventional formulation techniques. Suitable formulations and application methods are described in U.S. Pat. No. 6,468,523, herein incorporated by reference in its entirety.

[1085] Ratios, Mixtures, Compositions, and Additional Products

[1086] In some embodiments, a composition comprising one or more PFIPs and one or more CRIPs may also comprise additional ingredients, for example, herbicides, chemical insecticides, virucides, microbicides, amoebicides, pesticides, fungicides, bacteriocides, nematocides, molluscicides, polypeptides, and/or one or more of the foregoing mixtures thereof.

[1087] Novel formulations comprising a mixture of the present invention can be used to control, kill and/or inhibit pests such as insects. In some embodiments, the method of controlling an insect comprises: applying a PFIP, e.g., a Bt (Bacillus thuringiensis) protein, to an insect; and applying a CRIP to said insect. The foregoing application can be applied concomitantly and/or sequentially, and either in the same or separate mixtures.

[1088] In some embodiments, the Bt protein and the CRIP may be applied to Bt-resistant insects. The ratio of PFIP to CRIP, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. In some embodiments, the total concentration of PFIP and CRIP in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1089] In some embodiments, a mixture of the present invention can be included in a formulation, for example, a formulation composed of a polar aprotic solvent, and or water, and or where the polar aprotic solvent is present in an amount of 1-99 wt %, the polar protic solvent is present in an amount of 1-99 wt %, and the water is present in an amount of 0-98 wt %. The polar aprotic solvent formulations are especially effective when they contain MSO. MSO is a methylated seed oil and surfactant blend that uses methyl esters of soya oil in amounts of between about 80 and 85 percent petroleum oil with 15 to 20 percent surfactant.

[1090] In some embodiments, the formulations include a PFIP, a CRIP, and another insecticidal polypeptide.

[1091] In some embodiments, the insecticidal polypeptide can be obtained from a commercially available product comprising an insecticidal peptide. For example in some embodiments, the commercially available product can be DIPEL available from VALENT BIOSCIENCES.

[1092] In some embodiments, a mixture can comprise one or more PFIPs and one or more CRIPs, wherein the PFIP is a Bt, and wherein the one or more CRIPs is one or more of an atracotoxin (ACTX), a ctenitoxin (CNTX), an Av2 toxin, an Av3 toxin, an Av3-Variant Polypeptide (AVP), or a combination thereof. The mixture can be in the ratio of PFIP to CRIP, on a dry weight basis, from about any or all of the following ratios: 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 50:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95 and 1:99, or any combination of any two of these values. In some embodiments, the mixture can have a ratio of PFIP to CRIP, on a on a dry weight basis, selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[1093] In some embodiments, the mixture of the present invention can be combined with permethrin. Permethrin is an insecticide that is commercially available (e.g., NIX) and known to those having ordinary skill in the art. In some embodiments, the method of controlling an insect comprises: applying permethrin to an insect; and applying a mixture comprising one or more PFIPs and one or more CRIPS to said insect. The foregoing application can be applied concomitantly and/or sequentially, and either in the same or separate mixtures. In some embodiments, permethrin and the mixture comprising one or more PFIPs and one or more CRIPS may be applied to (permethrin)-resistant insects. In some embodiments, permethrin and the mixture comprising one or more PFIPs and one or more CRIPS may be applied to (Bt toxin)-resistant insects. The ratio of permethrin to a mixture comprising one or more PFIPs and one or more CRIPS, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. The total concentration of permethrin and a mixture comprising one or more PFIPs and one or more CRIPS in the combination is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1094] In some embodiments, the mixture comprises both a permethrin and a mixture comprising one or more PFIPs and one or more CRIPS. The mixture can be in the ratio of permethrin to a mixture comprising one or more PFIPs and one or more CRIPS, on a dry weight basis, from about any or all of the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. In some embodiments, the mixture can have a ratio of permethrin to a mixture comprising one or more PFIPs and one or more CRIPS, on a on a dry weight basis, selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[1095] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the CRIP is one or more polypeptides derived from a sea anemone. For example, in some embodiments, the sea anemone can be Actinia equina; Anemonia erythraea; Anemonia sulcata; Anemonia viridis; Anthopleura elegantissima; Anthopleura fuscoviridis; Anthopleura xanthogrammica; Bunodosoma caissarum; Bunodosoma cangicum; Bunodosoma granulifera; Heteractis crispa; Parasicyonis actinostoloides; Radianthus paumotensis; or Stoichactis helianthus. In yet other embodiments, the sea anemone toxin can be Av2; an Av3; or a variant thereof.

[1096] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more polypeptides derived from the sea anemone, Anemonia viridis, which possesses a variety of toxins that it uses to defend itself. One of the toxins derived from Anemonia viridis is the neurotoxin Av3. Av3 is a type III sea anemone toxin that inhibits the inactivation of voltage-gated sodium (Na.sup.+) channels at receptor site 3, resulting in contractile paralysis. The binding of an Av3 toxin to site 3 results in the inactivated state of the sodium channel to become destabilized, which in turn causes the channel to remain in the open position (see Blumenthal et al., Voltage-gated sodium channel toxins: poisons, probes, and future promise. Cell Biochem Biophys. 2003; 38(2):215-38). Av3 shows high selectivity for crustacean and insect sodium channels, and low selectivity for mammalian sodium channels (see Moran et al., Sea anemone toxins affecting voltage-gated sodium channelsmolecular and evolutionary features, Toxicon. 2009 Dec. 15; 54(8): 1089-1101). An exemplary Av3 polypeptide from Anemonia viridis is provided having the amino acid sequence of SEQ ID NO: 1780. The ratio of AVP to PFIP, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. The total concentration of AVP and PFIP in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1097] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more polypeptides derived from the sea anemone Av3, for example, one or more of the Av3 variant polypeptides (AVPs) can have the following amino acid variation from SEQ ID NO: 1780: an N-terminal amino acid substitution of R1K relative to SEQ ID NO: 1780, changing the polypeptide sequence from the wild-type RSCCPCYWGGCPWGQNCYPEGCSGPKV to KSCCPCYWGGCPWGQNCYPEGCSGPKV (SEQ ID NO: 1781); and/or an N-terminal mutation and a C-terminal mutation, wherein the N-terminal amino acid can have a substitution of R1K relative to SEQ ID NO: 1780 and the C-terminal amino acid can be deleted relative to SEQ ID NO: 1780 changing the polypeptide sequence from the wild-type RSCCPCYWGGCPWGQNCYPEGCSGPKV to KSCCPCYWGGCPWGQNCYPEGCSGPK (SEQ ID NO: 1782). The ratio of AVP to PFIP, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. The total concentration of AVP and PFIP in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1098] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more polypeptides derived and/or originating from Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, or Atrax infensus, including toxins known as ACTX peptides.

[1099] In some embodiments, a mixture of the present invention comprises one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more of the following ACTX peptides: U-ACTX-Hv1a, U+2-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, r-ACTX-Hv1c, -ACTX-Hv1a, and/or -ACTX-Hv1a+2.

[1100] For example, in some embodiments, the mixture comprises one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more U-ACTX peptides, Omega-ACTX peptides, and/or Kappa-ACTX peptides. The ratio of ACTX peptides to PFIP, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. The total concentration of ACTX and PFIP in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1101] For example, in some embodiments, the mixture comprises one or more PFIPs and one or more CRIPs, wherein the one or more CRIPs is one or more -CNTX-Pn1a toxins. The -CNTX-Pn1a peptide is an insecticidal neurotoxin derived from the Brazilian armed spider, Phoneutria nigriventer. -CNTX-Pn1a targets the N-methyl-D-aspartate (NMDA)-subtype of ionotropic glutamate receptor (GRIN), and sodium channels. An exemplary -CNTX-Pn1a peptide has an amino acid sequence of

TABLE-US-00050 (SEQIDNO:1778) GSCADINGACKSDCDCCGDSVTCDCYWSDSCKCRESNFKIGMAIRKKFC.

[1102] In some embodiments, the method of controlling an insect comprises: applying -CNTX-Pn1a to an insect; and applying one or more PFIPs and one or more CRIPS to said insect. The foregoing application can be applied concomitantly and/or sequentially, and either in the same or separate mixtures. In some embodiments, -CNTX-Pn1a and the one or more PFIPs and one or more CRIPs may be applied to (-CNTX-Pn1a)-resistant insects. In some embodiments, -CNTX-Pn1a and the one or more PFIPs and one or more CRIPs may be applied to (Bt toxin)-resistant insects. The ratio of -CNTX-Pn1a to one or more PFIPs, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. The total concentration of -CNTX-Pn1a and PFIP in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1103] In some embodiments, the mixture comprises both one or more -CNTX-Pn1a peptides and one or more PFIPs. The mixture can be in the ratio of -CNTX-Pn1a to one or more PFIPs, on a dry weight basis, from about any or all of the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. In some embodiments, the mixture can have a ratio of -CNTX-Pn1a to one or more PFIPs, on a on a dry weight basis, selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[1104] In some embodiments, one or more PFIPs and one or more CRIPs can be combined, wherein the one or more CRIPs is one or more toxins isolated from a scorpion. For example, in some embodiments, the toxin can be an imperatoxin. Imperatoxins are peptide toxins derived from the venom of the African scorpion (Pandinus imperator).

[1105] In some embodiments, a one or more PFIPs and one or more CRIPs can be combined, wherein the one or more CRIPs is one or more Imperatoxins.

[1106] In some embodiments, a mixture comprises one or more PFIPs and one or more Imperatoxins, wherein the Imperatoxin A (IpTx-a), or a variant thereof. In some embodiments, the IpTx-a has an amino acid sequence of

TABLE-US-00051 (SEQIDNO:1827) GSGDCLPHLKRCKADNDCCGKKCKRRGTNAEKRCR.

[1107] In some embodiments, the method of controlling an insect comprises: applying IpTx-a to an insect; and applying one or more PFIPs to said insect. The foregoing application can be applied concomitantly and/or sequentially, and either in the same or separate mixtures. In some embodiments, IpTx-a and the one or more PFIPs may be applied to (IpTx-a)-resistant insects. In some embodiments, IpTx-a and the one or more PFIPs may be applied to (Bt toxin)-resistant insects. The ratio of IpTx-a to one or more PFIPs, on a dry weight basis, can be selected from at least about the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. The total concentration of IpTx-a and one or more PFIPs in the mixture is selected from the following percent concentrations: 0, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 99 or 100%, or any range between any two of these values, and the remaining percentage of the mixture is comprised of excipients.

[1108] In some embodiments, the mixture comprises both an IpTx-a and one or more PFIPs. The mixture can be in the ratio of IpTx-a to one or more PFIPs, on a dry weight basis, from about any or all of the following ratios: 10,000:1, 5,000:1, 1,000:1, 500:1, 250:1, 200:1, 100:1, 99:1, 95:5, 90:10, 85:15, 80:20, 75:25, 70:30, 65:35, 60:40, 55:45, 1:1, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 1:100, 1:200, 1:250, 1:500, 1:1,000, 1:5,000, or 1:10,000, or any combination of any two of these values. In some embodiments, the mixture can have a ratio of IpTx-a to one or more PFIPs, on a on a dry weight basis, selected from about the following ratios: 0:50, 45:55, 40:60, 35:65, 30:70, 25:75, 20:80, 15:85, 10:90, 5:95, 1:99, 0.5:99.5, 0.1:99.9 and 0.01:99.99 or any combination of any two of these values.

[1109] Conotoxins are toxins isolated from cone shells; these toxins act by interfering with neuronal communication. Examples of conotoxins include the -, -, -, -, and -conotoxins. Briefly, the -conotoxins (and A-&-conotoxins) target nicotinic ligand gated channels; -conotoxins target voltage-gated calcium channels; -conotoxins target the voltage-gated sodium channels; -conotoxins target the voltage-gated sodium channel; and -conotoxins target the voltage-gated potassium channel.

[1110] In some embodiments, a mixture comprises one or more PFIPs and one or more peptides isolated from organisms belonging to the Conus genus.

[1111] In some embodiments, a mixture comprises one or more PFIPs and one or more peptides isolated from organisms belonging to the Conus genus, wherein the peptide is a conotoxin.

[1112] In some embodiments, a mixture comprises one or more PFIPs and one or more peptides isolated from Conus amadis; Conus catus; Conus ermineus; Conus geographus; Conus gloriamaris; Conus kinoshitai; Conus magus; Conus marmoreus; Conus purpurascens; Conus stercusmuscarum; Conus striatus; Conus textile; or Conus tulipa.

[1113] In some embodiments, a mixture comprises one or more PFIPs and one or more -conotoxin, A-conotoxin, -conotoxins, -conotoxin, -conotoxin, -conotoxin, or -conotoxin.

[1114] Any of the foregoing mixtures, combinations, and/or compositions can be created, formulated, or otherwise made, using any of the PFIPs described herein (e.g., a Bt toxin), and any of the CRIPs described herein. For example, any of the foregoing mixtures, combinations, and/or compositions can be created, formulated, or otherwise made, using one or more CRIPs described herein such as an ACTX peptide, a U-ACTX peptide, an Omega-ACTX peptides, a Kappa-ACTX peptide, a U-ACTX-Hv1a, a U+2-ACTX-Hv1a, a rU-ACTX-Hv1a, a rU-ACTX-Hv1b, a r-ACTX-Hv1c, a -ACTX-Hv1a, a -ACTX-Hv1a+2, a ctenitoxin (CNTX), a -CNTX-Pn1a, an Av2 toxin, an Av3 toxin, an AVP, or another CRIP described herein, or combinations thereof.

[1115] Crops and Pests

[1116] Specific crop pests and insects that may be controlled by these methods include the following: Dictyoptera (cockroaches); Isoptera (termites); Orthoptera (locusts, grasshoppers and crickets); Diptera (house flies, mosquito, tsetse fly, crane-flies and fruit flies); Hymenoptera (ants, wasps, bees, saw-flies, ichneumon flies and gall-wasps); Anoplura (biting and sucking lice); Siphonaptera (fleas); and Hemiptera (bugs and aphids), as well as arachnids such as Acari (ticks and mites), and the parasites that each of these organisms harbor.

[1117] Pest includes, but is not limited to: insects, fungi, bacteria, nematodes, mites, ticks, and the like.

[1118] Insect pests include, but are not limited to, insects selected from the orders Coleoptera, Diptera, Hymenoptera, Lepidoptera, Mallophaga, Homoptera, Hemiptera, Orthroptera, Thysanoptera, Dermaptera, Isoptera, Anoplura, Siphonaptera, Trichoptera, and the like. More particularly, insect pests include Coleoptera, Lepidoptera, and Diptera.

[1119] Insects of suitable agricultural, household and/or medical/veterinary importance for treatment with the insecticidal polypeptides include, but are not limited to, members of the following classes and orders:

[1120] The order Coleoptera includes the suborders Adephaga and Polyphaga. Suborder Adephaga includes the superfamilies Caraboidea and Gyrinoidea. Suborder Polyphaga includes the superfamilies Hydrophiloidea, Staphylinoidea, Cantharoidea, Cleroidea, Elateroidea, Dascilloidea, Dryopoidea, Byrrhoidea, Cucujoidea, Meloidea, Mordelloidea, Tenebrionoidea, Bostrichoidea, Scarabaeoidea, Cerambycoidea, Chrysomeloidea, and Curculionoidea. Superfamily Caraboidea includes the families Cicindelidae, Carabidae, and Dytiscidae. Superfamily Gyrinoidea includes the family Gyrinidae. Superfamily Hydrophiloidea includes the family Hydrophilidae. Superfamily Staphylinoidea includes the families Silphidae and Staphylinidae. Superfamily Cantharoidea includes the families Cantharidae and Lampyridae. Superfamily Cleroidea includes the families Cleridae and Dermestidae. Superfamily Elateroidea includes the families Elateridae and Buprestidae. Superfamily Cucujoidea includes the family Coccinellidae. Superfamily Meloidea includes the family Meloidae. Superfamily Tenebrionoidea includes the family Tenebrionidae. Superfamily Scarabaeoidea includes the families Passalidae and Scarabaeidae. Superfamily Cerambycoidea includes the family Cerambycidae. Superfamily Chrysomeloidea includes the family Chrysomelidae. Superfamily Curculionoidea includes the families Curculionidae and Scolytidae.

[1121] Examples of Coleoptera include, but are not limited to: the American bean weevil Acanthoscelides obtectus, the leaf beetle Agelastica alni, click beetles (Agriotes lineatus, Agriotes obscurus, Agriotes bicolor), the grain beetle Ahasverus advena, the summer schafer Amphimallon solstitialis, the furniture beetle Anobium punctatum, Anthonomus spp. (weevils), the Pygmy mangold beetle Atomaria linearis, carpet beetles (Anthrenus spp., Attagenus spp.), the cowpea weevil Callosobruchus maculates, the fried fruit beetle Carpophilus hemipterus, the cabbage seedpod weevil Ceutorhynchus assimilis, the rape winter stem weevil Ceutorhynchus picitarsis, the wireworms Conoderus vespertinus and Conoderus falli, the banana weevil Cosmopolites sordidus, the New Zealand grass grub Costelytra zealandica, the June beetle Cotinis nitida, the sunflower stem weevil Cylindrocopturus adspersus, the larder beetle Dermestes lardarius, the corn rootworms Diabrotica virgifera, Diabrotica virgifera virgifera, and Diabrotica barberi, the Mexican bean beetle Epilachna varivestis, the old house borer Hylotropes bajulus, the lucerne weevil Hypera postica, the shiny spider beetle Gibbium psylloides, the cigarette beetle Lasioderma serricorne, the Colorado potato beetle Leptinotarsa decemlineata, Lyctus beetles (Lyctus spp.), the pollen beetle Meligethes aeneus, the common cockshafer Melolontha melolontha, the American spider beetle Mezium americanum, the golden spider beetle Niptus hololeucus, the grain beetles Oryzaephilus surinamensis and Oryzaephilus mercator, the black vine weevil Otiorhynchus sulcatus, the mustard beetle Phaedon cochleariae, the crucifer flea beetle Phyllotreta cruciferae, the striped flea beetle Phyllotreta striolata, the cabbage steam flea beetle Psylliodes chrysocephala, Ptinus spp. (spider beetles), the lesser grain borer Rhizopertha dominica, the pea and been weevil Sitona lineatus, the rice and granary beetles Sitophilus oryzae and Sitophilus granaries, the red sunflower seed weevil Smicronyx fulvus, the drugstore beetle Stegobium paniceum, the yellow mealworm beetle Tenebrio molitor, the flour beetles Tribolium castaneum and Tribolium confusum, warehouse and cabinet beetles (Trogoderma spp.), and the sunflower beetle Zygogramma exclamationis.

[1122] Examples of Dermaptera (earwigs) include, but are not limited to: the European earwig Forficula auricularia, and the striped earwig Labidura riparia.

[1123] Examples of Dictvontera include, but are not limited to: the oriental cockroach Blatta orientalis, the German cockroach Blatella germanica, the Madeira cockroach Leucophaea maderae, the American cockroach Periplaneta americana, and the smokybrown cockroach Periplaneta fuliginosa.

[1124] Examples of Diplonoda include, but are not limited to: the spotted snake millipede Blaniulus guttulatus, the flat-back millipede Brachydesmus superus, and the greenhouse millipede Oxidus gracilis.

[1125] The order Diptera includes the Suborders Nematocera, Brachycera, and Cyclorrhapha. Suborder Nematocera includes the families Tipulidae, Psychodidae, Culicidae, Ceratopogonidae, Chironomidae, Simuliidae, Bibionidae, and Cecidomyiidae. Suborder Brachycera includes the families Stratiomyidae, Tabanidae, Therevidae, Asilidae, Mydidae, Bombyliidae, and Dolichopodidae. Suborder Cyclorrhapha includes the Divisions Aschiza and Aschiza. Division Aschiza includes the families Phoridae, Syrphidae, and Conopidae. Division Aschiza includes the Sections Acalyptratae and Calyptratae. Section Acalyptratae includes the families Otitidae, Tephritidae, Agromyzidae, and Drosophilidae. Section Calyptratae includes the families Hippoboscidae, Oestridae, Tachinidae, Anthomyiidae, Muscidae, Calliphoridae, and Sarcophagidae.

[1126] Examples of Diptera include, but are not limited to: the house fly (Musca domestica), the African tumbu fly (Cordylobia anthropophaga), biting midges (Culicoides spp.), bee louse (Braula spp.), the beet fly Pegomyia betae, blackflies (Cnephia spp., Eusimulium spp., Simulium spp.), bot flies (Cuterebra spp., Gastrophilus spp., Oestrus spp.), craneflies (Tipula spp.), eye gnats (Hippelates spp.), filth-breeding flies (Calliphora spp., Fannia spp., Hermetia spp., Lucilia spp., Musca spp., Muscina spp., Phaenicia spp., Phormia spp.), flesh flies (Sarcophaga spp., Wohlfahrtia spp.); the flit fly Oscinella frit, fruitflies (Dacus spp., Drosophila spp.), head and canon flies (Hydrotea spp.), the hessian fly Mayetiola destructor, horn and buffalo flies (Haematobia spp.), horse and deer flies (Chrysops spp., Haematopota spp., Tabanus spp.), louse flies (Lipoptena spp., Lynchia spp., and Pseudolynchia spp.), medflies (Ceratitus spp.), mosquitoes (Aedes spp., Anopheles spp., Culex spp., Psorophora spp.), sandflies (Phlebotomus spp., Lutzomyia-spp.), screw-worm flies (Chtysomya bezziana and Cochliomyia hominivorax), sheep keds (Melophagus spp.); stable flies (Stomoxys spp.), tsetse flies (Glossina spp.), and warble flies (Hypoderma spp.).

[1127] Examples of Isontera (termites) include, but are not limited to: species from the familes Hodotennitidae, Kalotermitidae, Mastotermitidae, Rhinotennitidae, Serritermitidae, Termitidae, Termopsidae.

[1128] Examples of Heteroptera include, but are not limited to: the bed bug Cimex lectularius, the cotton stainer Dysdercus intermedius, the Sunn pest Eurygaster integriceps, the tarnished plant bug Lygus lineolaris, the green stink bug Nezara antennata, the southern green stink bug Nezara viridula, and the triatomid bugs Panstrogylus megistus, Rhodnius ecuadoriensis, Rhodnius pallescans, Rhodnius prolixus, Rhodnius robustus, Triatoma dimidiata, Triatoma infestans, and Triatoma sordida.

[1129] Examples of Homoptera include, but are not limited to: the California red scale Aonidiella aurantii, the black bean aphid Aphis fabae, the cotton or melon aphid Aphis gossypii, the green apple aphid Aphis pomi, the citrus spiny whitefly Aleurocanthus spiniferus, the oleander scale Aspidiotus hederae, the sweet potato whitefly Bemesia tabaci, the cabbage aphid Brevicoryne brassicae, the pear psylla Cacopsylla pyricola, the currant aphid Cryptomyzus ribis, the grape phylloxera Daktulosphaira vitifoliae, the citrus psylla Diaphorina citri, the potato leafhopper Empoasca fabae, the bean leafhopper Empoasca solana, the vine leafhopper Empoasca vitis, the woolly aphid Eriosoma lanigerum, the European fruit scale Eulecanium corni, the mealy plum aphid Hyalopterus arundinis, the small brown planthopper Laodelphax striatellus, the potato aphid Macrosiphum euphorbiae, the green peach aphid Myzus persicae, the green rice leafhopper Nephotettix cinticeps, the brown planthopper Nilaparvata lugens, gall-forming aphids (Pemphigus spp.), the hop aphid Phorodon humuli, the bird-cherry aphid Rhopalosiphum padi, the black scale Saissetia oleae, the greenbug Schizaphis graminum, the grain aphid Sitobion avenae, and the greenhouse whitefly Trialeurodes vaporariorum.

[1130] Examples of Isopoda include, but are not limited to: the common pillbug Armadillidium vulgare and the common woodlouse Oniscus asellus.

[1131] The order Lepidoptera includes the families Papilionidae, Pieridae, Lycaenidae, Nymphalidae, Danaidae, Satyridae, Hesperiidae, Sphingidae, Satumiidae, Geometridae, Arctiidae, Noctuidae, Lymantriidae, Sesiidae, and Tineidae.

[1132] Examples of Lepidoptera include, but are not limited to: Adoxophyes orana (summer fruit Tortrix moth), Agrotis ipsolon (black cutworm), Archips podana (fruit tree Tortrix moth), Bucculatrix pyrivorella (pear leafminer), Bucculatrix thurberiella (cotton leaf perforator), Bupalus piniarius (pine looper), Carpocapsa pomonella (codling moth), Chilo suppressalis (striped rice borer), Choristoneura fumiferana (eastern spruce budworm), Cochylis hospes (banded sunflower moth), Diatraea grandiosella (southwestern corn borer), Earls insulana (Egyptian bollworm), Euphestia kuehniella (Mediterranean flour moth), Eupoecilia ambiguella (European grape berry moth), Euproctis chrysorrhoea (brown-tail moth), Euproctis subflava (oriental tussock moth), Galleria mellonella (greater wax moth), Helicoverpa armigera (cotton bollworm), Helicoverpa zea (cotton bollworm), Heliothis virescens (tobacco budworm), Hofmannophila pseudopretella (brown house moth), Homeosoma electellum (sunflower moth), Homona magnanima (oriental tea tree Tortrix moth), Lithocolletis blancardella (spotted tentiform leafminer), Lymantria dispar (gypsy moth), Malacosoma neustria (tent caterpillar), Mamestra brassicae (cabbage armyworm), Mamestra configurata (Bertha armyworm), the hornworms Manduca sexta and Manuduca quinquemaculata, Operophtera brumata (winter moth), Ostrinia nubilalis (European corn borer), Panolis flammea (pine beauty moth), Pectinophora gossypiella (pink bollworm), Phyllocnistis citrella (citrus leafminer), Pieris brassicae (cabbage white butterfly), Plutella xylostella (diamondback moth), Rachiplusia ni (soybean looper), Spilosoma virginica (yellow bear moth), Spodoptera exigua (beet armyworm), Spodoptera frugiperda (fall armyworm), Spodoptera littoralis (cotton leafworm), Spodoptera litura (common cutworm), Spodoptera praefica (yellowstriped armyworm), Sylepta derogata (cotton leaf roller), Tineola bisselliella (webbing clothes moth), Tineola pellionella (case-making clothes moth), Tortrix viridana (European oak leafroller), Trichoplusia ni (cabbage looper), and Yponomeuta padella (small ermine moth).

[1133] Examples of Orthoptera include, but are not limited to: the common cricket Acheta domesticus, tree locusts (Anacridium spp.), the migratory locust Locusta migratoria, the twostriped grasshopper Melanoplus bivittatus, the differential grasshopper Melanoplus dfferentialis, the redlegged grasshopper Melanoplus femurrubrum, the migratory grasshopper Melanoplus sanguinipes, the northern mole cricket Neocurtilla hexadectyla, the red locust Nomadacris septemfasciata, the shortwinged mole cricket Scapteriscus abbreviatus, the southern mole cricket Scapteriscus borellii, the tawny mole cricket Scapteriscus vicinus, and the desert locust Schistocerca gregaria.

[1134] Examples of Phthiraptera include, but are not limited to: the cattle biting louse Bovicola bovis, biting lice (Damalinia spp.), the cat louse Felicola subrostrata, the shortnosed cattle louse Haematopinus eloysternus, the tail-switch louse Haematopinus quadriperiussus, the hog louse Haematopinus suis, the face louse Linognathus ovillus, the foot louse Linognathus pedalis, the dog sucking louse Linognathus setosus, the long-nosed cattle louse Linognathus vituli, the chicken body louse Menacanthus stramineus, the poultry shaft louse Menopon gallinae, the human body louse Pediculus humanus, the pubic louse Phthirus pubis, the little blue cattle louse Solenopotes capillatus, and the dog biting louse Trichodectes canis.

[1135] Examples of Psocoptera include, but are not limited to: the booklice Liposcelis bostrychophila, Liposcelis decolor, Liposcelis entomophila, and Trogium pulsatorium. Examples of Siphonaptera include, but are not limited to: the bird flea Ceratophyllus gallinae, the dog flea Ctenocephalides canis, the cat flea Ctenocephalides fells, the human flea Pulex irritans, and the oriental rat flea Xenopsylla cheopis.

[1136] Examples of Symphyla include, but are not limited to: the garden symphylan Scutigerella immaculate.

[1137] Examples of Thysanura include, but are not limited to: the gray silverfish Ctenolepisma longicaudata, the four-lined silverfish Ctenolepisma quadriseriata, the common silverfish Lepisma saccharina, and the firebrat Thennobia domestica;

[1138] Examples of Thysanoptera include, but are not limited to: the tobacco Thrips Frankliniella fusca, the flower Thrips Frankliniella intonsa, the western flower Thrips Frankliniella occidentalis, the cotton bud Thrips Frankliniella schultzei, the banded greenhouse Thrips Hercinothrips femoralis, the soybean Thrips Neohydatothrips variabilis, Kelly's citrus Thrips Pezothrips kellyanus, the avocado Thrips Scirtothrips perseae, the melon Thrips Thrips palmi, and the onion Thrips Thrips tabaci.

[1139] Examples of Nematodes include, but are not limited to: parasitic nematodes such as root-knot, cyst, and lesion nematodes, including Heterodera spp., Meloidogyne spp., and Globodera spp.; particularly members of the cyst nematodes, including, but not limited to: Heterodera glycines (soybean cyst nematode); Heterodera schachtii (beet cyst nematode); Heterodera avenae (cereal cyst nematode); and Globodera rostochiensis and Globodera pailida (potato cyst nematodes). Lesion nematodes include, but are not limited to: Pratylenchus spp.

[1140] Other insect species susseptible to a CRIP and/or PFIP of the present disclosure includes: athropod pests which cause public and animal health concerns, for example, mosquitos for example, mosquitoes from the genera Aedes, Anopheles and Culex, from ticks, flea, and flies etc.

[1141] In one embodiment, the insecticidal mixtures comprising the polypeptides, polynucleotides, cells, vectors, etc., can be employed to treat ectoparasites. Ectoparasites include, but are not limited to: fleas, ticks, mange, mites, mosquitoes, nuisance and biting flies, lice, and combinations comprising one or more of the foregoing ectoparasites. The term fleas includes the usual or accidental species of parasitic flea of the order Siphonaptera, and in particular the species Ctenocephalides, in particular C. fells and C. cams, rat fleas (Xenopsylla cheopis) and human fleas (Pulex irritans).

[1142] Insect pests of the invention for the major crops include, but are not limited to: Maize: Ostrinia nubilalis, European corn borer; Agrotis ipsilon, black cutworm; Helicoverpa zea, corn earworm; Spodoptera frugiperda, fall armyworm; Diatraea grandiosella, southwestern corn borer; Elasmopalpus lignosellus, lesser cornstalk borer; Diatraea saccharalis, surgarcane borer; Diabrotica virgifera, western corn rootworm; Diabrotica longicornis barberi, northern corn rootworm; Diabrotica undecimpunctata howardi, southern corn rootworm; Melanotus spp., wireworms; Cyclocephala borealis, northern masked chafer (white grub); Cyclocephala immaculata, southern masked chafer (white grub); Popillia japonica, Japanese beetle; Chaetocnema pulicaria, corn flea beetle; Sphenophorus maidis, maize billbug; Rhopalosiphum maidis, corn leaf aphid; Anuraphis maidiradicis, corn root aphid; Blissus leucopterus leucopterus, chinch bug; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus sanguinipes, migratory grasshopper; Hylemya platura, seedcorn maggot; Agromyza parvicornis, corn blot leafminer; Anaphothrips obscrurus, grass Thrips; Solenopsis milesta, thief ant; Tetranychus urticae, twospotted spider mite; Sorghum: Chilo partellus, sorghum borer; Spodoptera frugiperda, fall armyworm; Helicoverpa zea, corn earworm; Elasmopalpus lignosellus, lesser cornstalk borer; Feltia subterranea, granulate cutworm; Phyllophaga crinita, white grub; Eleodes, Conoderus, and Aeolus spp., wireworms; Oulema melanopus, cereal leaf beetle; Chaetocnema pulicaria, corn flea beetle; Sphenophorus maidis, maize billbug; Rhopalosiphum maidis, corn leaf aphid; Sipha flava, yellow sugarcane aphid; Blissus leucopterus leucopterus, chinch bug; Contarinia sorghicola, sorghum midge; Tetranychus cinnabarinus, carmine spider mite; Tetranychus urticae, twospotted spider mite; Wheat: Pseudaletia unipunctata, army worm; Spodoptera frugiperda, fall armyworm; Elasmopalpus lignosellus, lesser cornstalk borer; Agrotis orthogonia, western cutworm; Elasmopalpus lignosellus, lesser cornstalk borer; Oulema melanopus, cereal leaf beetle; Hypera punctata, clover leaf weevil; Diabrotica undecimpunctata howardi, southern corn rootworm; Russian wheat aphid; Schizaphis graminum, greenbug; Macrosiphum avenae, English grain aphid; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus differentialis, differential grasshopper; Melanoplus sanguinipes, migratory grasshopper; Mayetiola destructor, Hessian fly; Sitodiplosis mosellana, wheat midge; Meromyza americana, wheat stem maggot; Hylemya coarctata, wheat bulb fly; Frankliniella fusca, tobacco Thrips; Cephus cinctus, wheat stem sawfly; Aceria tulipae, wheat curl mite; Sunflower: Suleima helianthana, sunflower bud moth; Homoeosoma electellum, sunflower moth; Zygogramma exclamationis, sunflower beetle; Bothyrus gibbosus, carrot beetle; Neolasioptera murtfeldtiana, sunflower seed midge; Cotton: Heliothis virescens, cotton budworm; Helicoverpa zea, cotton bollworm; Spodoptera exigua, beet armyworm; Pectinophora gossypiella, pink bollworm; Anthonomus grandis, boll weevil; Aphis gossypii, cotton aphid; Pseudatomoscelis seriatus, cotton fleahopper; Trialeurodes abutilonea, banded winged whitefly; Lygus lineolaris, tarnished plant bug; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus differentialis, differential grasshopper; Thrips tabaci, onion Thrips; Franklinkiella fusca, tobacco Thrips; Tetranychus cinnabarinus, carmine spider mite; Tetranychus urticae, twospotted spider mite; Rice: Diatraea saccharalis, sugarcane borer; Spodoptera frugiperda, fall armyworm; Helicoverpa zea, corn earworm; Colaspis brunnea, grape colaspis; Lissorhoptrus oryzophilus, rice water weevil; Sitophilus oryzae, rice weevil; Nephotettix nigropictus, rice leafhopper; Blissus leucopterus, chinch bug; Acrosternum hilare, green stink bug; Soybean: Pseudoplusia includens, soybean looper; Anticarsia gemmatalis, velvet bean caterpillar; Plathypena scabra, green clover worm; Ostrinia nubilalis, European corn borer; Agrotis ipsilon, black cutworm; Spodoptera exigua, beet armyworm; Heliothis virescens, cotton budworm; Helicoverpa zea, cotton bollworm; Epilachna varivestis, Mexican bean beetle; Myzus persicae, green peach aphid; Empoasca fabae, potato leafhopper; Acrosternum hilare, green stink bug; Melanoplus femurrubrum, redlegged grasshopper; Melanoplus differentialis, differential grasshopper; Hylemya platura, seedcorn maggot; Sericothrips variabilis, soybean Thrips; Thrips tabaci, onion Thrips; Tetranychus turkestani, strawberry spider mite; Tetranychus urticae, twospotted spider mite; Barley: Ostrinia nubilalis, European corn borer; Agrotis ipsilon, black cutworm; Schizaphis graminum, greenbug; Blissus leucopterus leucopterus, chinch bug; Acrosternum hilare, green stink bug; Euschistus servus, brown stink bug; Delia platura, seedcorn maggot; Mayetiola destructor, Hessian fly; Petrobia latens, brown wheat mite; Oil Seed Rape: Brevicoryne brassicae, cabbage aphid; Phyllotreta cruciferae, Flea beetle; Mamestra configurata, Bertha armyworm; Plutella xylostella, Diamond-back moth; Delia ssp., Root maggots.

[1143] In some embodiments, the insecticidal mixtures can be employed to treat combinations comprising one or more of the foregoing insects.

[1144] The insects that are susceptible to the peptides of this invention include but are not limited to the following: Cyt toxins affected families such as: Blattaria, Coleoptera, Collembola, Diptera, Echinostomida, Hemiptera, Hymenoptera, Isoptera, Lepidoptera, Neuroptera, Orthoptera, Rhabditida, Siphonoptera, Thysanoptera. Genus-Species are indicated as follows: Actebia-fennica, Agrotis-ipsilon, A.-segetum, Anticarsia-gemmatalis, Argyrotaenia-citrana, Artogeia-rapae, Bombyx mori, Busseola-fusca, Cacyreus-marshall, Chilo-suppressalis, Christoneura-fumiferana, C.-occidentalis, C.-pinus pinus, C.-rosacena, Cnaphalocrocis-medinalis, Conopomorpha-cramerella, Ctenopsuestis-obliquana, Cydia-pomonella, Danaus-plexippus, Diatraea-saccharallis, D.-grandiosella, Earias-vittella, Elasmolpalpus-lignoselius, Eldana-saccharina, Ephestia-kuehniella, Epinotia-aporema, Epiphyas-postvittana, Galleria-mellonella, Genus Species, Helicoverpa-zea, H.-punctigera, H.-armigera, Heliothis-virescens, Hyphantria-cunea, Lambdina-fiscellaria, Leguminivora-glycinivorella, Lobesia-botrana, Lymantria-dispar, Malacosoma-disstria, Mamestra-brassicae, M. configurata, Manduca-sexta, Marasmia-patnalis, Maruca-vitrata, Orgyia-leucostigma, Ostrinia-nubilalis, O.-furnacalis, Pandemis-pyrusana, Pectinophora-gossypiella, Perileucoptera-coffeella, Phthorimaea-opercullela, Pianotortrix-octo, Piatynota-stultana, Pieris-brassicae, Plodia-interpunctala, Plutella-xylostella, Pseudoplusia-includens, Rachiplusia-nu, Sciropophaga-incertulas, Sesamia-calamistis, Spilosoma-virginica, Spodoptera-exigua, S.-frugiperda, S.-littoralis, S.-exempta, S.-litura, Tecia-solanivora, Thaumetopoea-pityocampa, Trichoplusia-ni, Wiseana-cervinata, Wiseana-copularis, Wiseana-jocosa, Blattaria-Blattella, Collembola-Xenylla, C.-Folsomia, Echinostomida-Fasciola, Hemiptera-Oncopeltrus, He.-Bemisia, He.-Macrosiphum, He.-Rhopalosiphum, He.-Myzus, Hymenoptera-Diprion, Hy.-Apis, Hy.-Macrocentrus, Hy.-Meteorus, Hy.-Nasonia, Hy.-Solenopsis, Isopoda-Porcellio, Isoptera-Reticulitermes, Orthoptera-Achta, Prostigmata-Tetranychus, Rhabitida-Acrobeloides, R.-Caenorhabditis, R.-Distolabrellus, R.-Panagrellus, R.-Pristionchus, R.-Pratylenchus, R.-Ancylostoma, R.-Nippostrongylus, R.-Panagrellus, R.-Haemonchus, R.-Meloidogyne, and Siphonaptera-Ctenocephalides.

[1145] The present disclosure provides methods for plant transformation, which may be used for transformation of any plant species, including, but not limited to, monocots and dicots. Crops for which a transgenic approach or plaint incorporated protectants (PIP) would be an especially useful approach include, but are not limited to: alfalfa, cotton, tomato, maize, wheat, corn, sweet corn, lucerne, soybean, sorghum, field pea, linseed, safflower, rapeseed, oil seed rape, rice, soybean, barley, sunflower, trees (including coniferous and deciduous), flowers (including those grown commercially and in greenhouses), field lupins, switchgrass, sugarcane, potatoes, tomatoes, tobacco, crucifers, peppers, sugarbeet, barley, and oilseed rape, Brassica sp., rye, millet, peanuts, sweet potato, cassaya, coffee, coconut, pineapple, citrus trees, cocoa, tea, banana, avocado, fig, guava, mango, olive, papaya, cashew, macadamia, almond, oats, vegetables, ornamentals, and conifers.

[1146] Insecticide-Resistant Pests

[1147] Resistance to insecticides occurs when there is a heritable change in the sensitivity of a pest population to insecticides; this change in sensitivity can be observed in the failure of an insecticide to achieve the desired result and/or expected degree of control when used as intended. Cross-resistance describes a pest's resistance to one insecticide that in turn confers resistance to another different insecticide-even in cases where said pest has not been confronted with the other insecticide. Information about insecticide resistance can be found on the Insecticide Resistance Action Committee (IRAC) website (https://www.irac-online.org/). Reports of insecticide resistance in insects and other pests, and the insecticides appertaining thereunto, can be found at the Arthropod Pesticide Resistance Database (APRD) (https://www.pesticideresistance.org/).

[1148] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to one or more insecticides. For example, in some embodiments, an insect and/or pest may be resistant or at least partially resistant to one or more of the following insecticides: Acetylcholinesterase (AchE) inhibitors (e.g., carbamates such as alanycarb, aldicarb, bendiocarb, benfuracarb, butocarboxim, butoxycarboxim, carbaryl, carbofuran, carbosulfan, ethiofencarb, fenobucarb, formetanate, furathiocarb, isoprocarb, methiocarb, methomyl, metolcarb, oxamyl, pirimicarb, propoxur, thiodicarb, thiofanox, triazamate, trimethacarb, xmc, and xylylcarb; and organophosphates such as acephate, azamethiphos, azinphos-ethyl, azinphos-methyl, cadusafos, chlorethoxyfos, chlorfenvinphos, chlormephos, chlorpyrifos, chlorpyrifos-methyl, coumaphos, cyanophos, demeton-s-methyl, diazinon, dichlorvos/ddvp, dicrotophos, dimethoate, dimethylvinphos, disulfoton, epn, ethion, ethoprophos, famphur, fenamiphos, fenitrothion, fenthion, fosthiazate, heptenophos, isofenphos, isoxathion, malathion, mecarbam, methamidophos, methidathion, mevinphos, monocrotophos, naled, omethoate, oxydemeton-methyl, parathion, parathion-methyl, phenthoate, phosalone, phorate, phosmet, phosphamidon, phoxim, profenofos, propetamphos, prothiofos, pyraclofos, pyridaphenthion, quinalphos, sulfotep, tebupirimfos, temephos, terbufos, tetrachlorvinphos, thiometon, triazophos, trichlorfon, vamidothion, pirimiphos-methyl, imicyafos, and isopropyl o-(methoxyaminothio-phosphoryl) salicylate); Gaba-gated chloride channel blockers (e.g., cyclodiene organochlorines such as chlordane, and endosulfan; and phenylpyrazoles (fiproles) such as ethiprole, and fipronil); Sodium channel modulators (e.g., pyrethroids and pyrethrins such as acrinathrin, allethrin, d-cis-trans allethrin, d-trans allethrin, bifenthrin, bioallethrin, bioallethrin s-cyclopentenyl, bioresmethrin, cycloprothrin, cyfluthrin, beta-cyfluthrin, cyhalothrin, lambda-cyhalothrin, gamma-cyhalothrin, cypermethrin, alpha-cypermethrin, beta-cypermethrin, theta-cypermethrin, zeta-cypermethrin, cyphenothrin [(1r)-trans-isomers], deltamethrin, empenthrin [(ez)-(1r)-isomers], esfenvalerate, etofenprox, fenpropathrin, fenvalerate, flucythrinate, flumethrin, tau-fluvalinate, kadathrin, pyrethrins (pyrethrum), halfenprox, phenothrin [(1r)-trans-isomer], prallethrin, resmethrin, silafluofen, tefluthrin, tetramethrin, tetramethrin [(1r)-isomers], tralomethrin, transfluthrin, permethrin; ddt and methoxychlor); Nicotinic acetvlcholine receptor (nAchR) competitive modulators (e.g., neonicotinoids such as acetamiprid, clothianidin, dinotefuran, imidacloprid, nitenpyram, thiacloprid, thiamethoxam; nicotine; sulfoximines such as sulfoxaflor; butenolides such as flupyradifurone; and mesoionics such as triflumezopyrim); Nicotinic acetvlcholine receptor (nAchR) allosteric modulatorssite I (e.g., spinosyns such as spinetoram and spinosad); Glutamate-gated chloride channel (GluCl) allosteric modulators (e.g., avermectins and milbemycins such as abamectin, emamectin benzoate, lepimectin, and milbemectin); Juvenile hormone mimics (e.g., juvenile hormone analogues such as hydroprene, kinoprene, and methoprene; fenoxycarb; and pyriproxyfen); Miscellaneous non-specific (multi-site) inhibitors (e.g., alkyl halides such as methyl bromide and other alkyl halides; chloropicrin; fluorides such as cryolite and sulfuryl fluoride; borates such as borax, boric acid, disodium octaborate, sodium borate, and sodium metaborate; tartar emetic; and methyl isothiocyanate generators such as dazomet and metam); Chordotonal organ TRPV channel modulators (e.g., pyridine azomethine derivatives such as pymetrozine, pyrifluquinazon; and pyropenes such as afidopyropen); Mite growth inhibitors (e.g., clofentezine and diflovidazin, hexythiazox such as clofentezine, diflovidazin, and hexythiazox; and etoxazole); Inhibitors of mitochondrial ATP synthase (e.g., diafenthiuron; organotin miticides such as azocyclotin, cyhexatin, and fenbutatin oxide; propargite; and tetradifon); Uncouplers of oxidative phosphorylation via disruption of the proton gradient (e.g., pyrroles, dinitrophenols, and sulfluramid, e.g., chlorfenapyr, dnoc, and sulfluramid); Nicotinic acetylcholine receptor (nAchR) channel blockers (e.g., nereistoxin analogues such as bensultap, cartap hydrochloride, thiocyclam, thiosultap-sodium); Inhibitors of chitin biosynthesis, type 0 (e.g., benzoylureas such as bistrifluron, chlorfluazuron, diflubenzuron, flucycloxuron, flufenoxuron, hexaflumuron, lufenuron, novaluron, noviflumuron, teflubenzuron, and triflumuron); Ecdysone receptor agonists (e.g., diacylhydrazines such as chromafenozide, halofenozide, methoxyfenozide, and tebufenozide); Octopamine receptor agonists (e.g., amitraz); Mitochondrial complex III electron transport inhibitors (e.g., hydramethylnon; acequinocyl; fluacrypyrim; and bifenazate); Mitochondrial complex I electron transport inhibitors (e.g., meti acaricides and insecticides such as fenazaquin, fenpyroximate, pyrimidifen, pyridaben, tebufenpyrad, and tolfenpyrad; and rotenone); Voltage-dependent sodium channel blockers (e.g., oxadiazines such as indoxacarb; and semicarbazones such as metaflumizone); Inhibitors of acetyl co-enzyme A carboxylase (e.g., tetronic and tetramic acid derivatives such as spirodiclofen, spiromesifen, spiropidion, and spirotetramat); Mitochondrial complex IV electron transport inhibitors (e.g., phosphides such as aluminum phosphide, calcium phosphide, phosphine, and zinc phosphide; and cyanides such as calcium cyanide, potassium cyanide, and sodium cyanide); Mitochondrial complex II electron transport inhibitors (e.g., beta-ketonitrile derivatives such as cyenopyrafen and cyflumetofen; and carboxanilides such as pyflubumide); Ryanodine receptor modulators (e.g., diamides such as chlorantraniliprole, cyantraniliprole, cyclaniliprole, flubendiamide, and tetraniliprole); Chordotonal organ modulatorsundefined target site (e.g., flonicamid); GABA-gated chloride channel allosteric modulators (e.g., meta-diamides and isoxazolines such as broflanilide, fluxametamide); and/or Compounds of unknown or uncertain MoA (e.g., azadirachtin; benzoximate; bromopropylate; chinomethionat; dicofol; lime sulfur; pyridalyl; and sulfur).

[1149] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to any one or more of the insecticides described herein.

[1150] In some embodiments, the compositions, mixtures, and/or methods of the present invention can be applied to the locus of an insect and/or pest that is resistant or at least partially resistant to one or more insecticides, said insect and/or pest selected from the group consisting of the following commonly known insects and/or pests: yellow fever mosquito; Corn stalk borer; Asiatic rice borer; house mosquito; southern house mosquito; western corn rootworm; sugarcane borer; cotton bollworm; corn earworm; tobacco budworm; Colorado potato beetle; Asian corn borer; European corn borer; pink bollworm; Indian meal moth; diamond-back moth; soybean looper; beet army worm, lesser army worm; fall armyworm; Egyptian cotton leafworm, army worm; or cabbage looper.

[1151] In some embodiments, the compositions, mixtures, and/or methods of the present invention can be applied to the locus of an insect and/or pest that is resistant or at least partially resistant to one or more insecticides, wherein said insect and/or pest selected is a blackfly or nuisance fly (e.g., Psychoda spp. And Chironomus spp.).

[1152] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to one or more insecticides can be a lepidopteran, e.g., a diamondback moth.

[1153] In some embodiments, the compositions, mixtures, and/or methods of the present invention can be applied to the locus of an insect and/or pest that is resistant or at least partially resistant to one or more insecticides, said insect and/or pest selected from the group consisting of: Loopers; Omnivorous Leafroller; Hornworms; Imported Cabbageworm; Diamondback Moth; Green Cloverworm; Webworm; Saltmarsh Caterpillar; Armyworms; Cutworms; Cross-Striped Cabbageworm; Podworms; Velvetbean Caterpillar; Soybean Looper; Tomato Fruitworm; Variegated Cutworm; Melonworms; Rindworm complex; Fruittree Leafroller; Citrus Cutworm; Heliothis; Orangedog; Citrus Cutworm; Redhumped Caterpillar; Tent Caterpillars; Fall Webworm; Walnut Caterpillar; Cankerworms; Gypsy Moth; Variegated Leafroller; Redbanded Leafroller; Tufted Apple Budmoth; Oriental Fruit Moth; Filbert Leafroller; Obliquebanded Leafroller; Codling Moth; Twig Borer; Grapeleaf Skeletonizer; Grape Leafroller; Achema Sphinx Moth (Hornworm); Orange Tortrix; Tobacco Budworm; Grape Berry Moth; Spanworm; Alfalfa Caterpillar; Cotton Bollworm; Head Moth; Amorbia Moth; Omnivorous Looper; Ello Moth (Hornworm); io Moth; Oleander Moth; Azalea Caterpillar; Hornworm; Leafrollers; Banana Skipper; Batrachedra comosae (Hodges); Thecla Moth; Artichoke Plume Moth; Thistle Butterfly; Bagworm; Spring & Fall Cankerworm; Elm Spanworm; California Oakworm; Pine Butterfly; Spruce Budworms; Saddle Prominent Caterpillar; Douglas Fir Tussock Moth; Western Tussock Moth; Blackheaded Budworm; Mimosa Webworm; Jack Pine Budworm; Saddleback Caterpillar; Greenstriped Mapleworm; or Hemlock Looper.

[1154] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to one or more insecticides can be a Colorado potato beetle or an Elm Leaf Beetle.

[1155] In some embodiments, the compositions, mixtures, and/or methods of the present invention can be applied to the locus of an insect and/or pest that is resistant or at least partially resistant to one or more insecticides, said insect and/or pest selected from the group consisting of: Achema Sphinx Moth (Hornworm) (Eumorpha achemon); Alfalfa Caterpillar (Colias eurytheme); Almond Moth (Caudra cautella); Amorbia Moth (Amorbia humerosana); Armyworm (Spodoptera spp., e.g. exigua, frugiperda, littoralis, Pseudaletia unipuncta); Artichoke Plume Moth (Platyptilia carduidactyla); Azalea Caterpillar (Datana major); Bagworm (Thyridopteryx); ephemeraeformis); Banana Moth (Hypercompe scribonia); Banana Skipper (Erionota thrax); Blackheaded Budworm (Acleris gloverana); California Oakworm (Phryganidia californica); Spring Cankerworm (Paleacrita merriccata); Cherry Fruitworm (Grapholita packardi); China Mark Moth (Nymphula stagnata); Citrus Cutworm (Xylomyges curialis); Codling Moth (Cydiapomonella); Cranberry Fruitworm (Acrobasis vaccinii); Cross-striped Cabbageworm (Evergestis rimosalis); Cutworm (Noctuid species, Agrotis ipsilon); Douglas Fir Tussock Moth (Orgyia pseudotsugata); Ello Moth (Hornworm) (Erinnyis ello); Elm Spanworm (Ennomos subsignaria); European Grapevine Moth (Lobesia botrana); European Skipper (Thymelicus lineola (Essex Skipper); Fall Webworm (Melissopus latiferreanus; Filbert Leafroller (Archips rosanus; Fruittree Leafroller (Archips argyrospilia; Grape Berry Moth (Paralobesia viteana; Grape Leafroller (Platynota stultana; Grapeleaf Skeletonizer (Harrisina americana (ground only); Green Cloverworm (Plathypena scabra; Greenstriped Mapleworm (Dryocampa rubicunda; Gummosos-Batrachedra; Comosae (Hodges); Gypsy Moth (Lymantria dispar); Hemlock Looper (Lambdina fiscellaria); Hornworm (Manduca spp.); Imported Cabbageworm (Pieris rapae); io Moth (Automeris io); Jack Pine Budworm (Choristoneura pinus); Light Brown Apple Moth (Epiphyas postvittana); Melonworm (Diaphania hyalinata); Mimosa Webworm (Homadaula anisocentra); Obliquebanded Leafroller (Choristoneura rosaceana); Oleander Moth (Syntomeida epilais); Omnivorous Leafroller (Playnota stultana); Omnivorous Looper (Sabulodes aegrotata); Orangedog (Papilio cresphontes); Orange Tortrix (Argyrotaenia citrana); Oriental Fruit Moth (Grapholita molesta); Peach Twig Borer (Anarsia lineatella); Pine Butterfly (Neophasia menapia); Podworm (Heliocoverpa zea); Redbanded Leafroller (Argyrotaenia velutinana); Redhumped Caterpillar (Schizura concinna); Rindworm Complex (Various Leps.); Saddleback Caterpillar (Sibine stimulea); Saddle Prominent Caterpillar Heterocampa guttivitta); Saltmarsh Caterpillar (Estigmene acrea); Sod Webworm (Crambus spp.); Spanworm (Ennomos subsignaria); Fall Cankerworm (Alsophila pometaria); Spruce Budworm (Choristoneura fumiferana); Tent Caterpillar (Various Lasiocampidae); Thecla-Thecla basilides (Geyr) Thecla basilides); Tobacco Hornworm (Manduca sexta); Tobacco Moth (Ephestia elutella); Tufted Apple Budmoth (Platynota idaeusalis); Twig Borer (Anarsia lineatella); Variegated Cutworm (Peridroma saucia); Variegated Leafroller (Platynota flavedana); Velvetbean Caterpillar (Anticarsia gemmatalis); Walnut Caterpillar (Datana integerrima); Webworm (Hyphantria cunea); Western Tussock Moth (Orgyia vetusta); Southern Cornstalk Borer (Diatraea crambidoides); Corn Earworm; Sweet potato weevil; Pepper weevil; Citrus root weevil; Strawberry root weevil; Pecan weevil; Filbert weevil; Ricewater weevil; Alfalfa weevil; Clover weevil; Tea shot-hole borer; Root weevil; Sugarcane beetle; Coffee berry borer; Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); Billbug (Curculionoidea); Aedes aegypti; Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; or Xanthogaleruca luteola.

[1156] In some embodiments, the compositions, mixtures, and/or methods of the present invention can be applied to the locus of an insect and/or pest that is resistant or at least partially resistant to one or more insecticides, wherein said insect and/or pest is an adult beetle selected from the group consisting of: Asiatic garden beetle (Maladera castanea); Gold spotted oak borer (Agrilus coxalis auroguttatus); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Oriental beetle (Anomala orientalis); and Soap berry-borer (Agrilus prionurus).

[1157] In some embodiments, the compositions, mixtures, and/or methods of the present invention can be applied to the locus of an insect and/or pest that is resistant or at least partially resistant to one or more insecticides, wherein said insect and/or pest is a larvae (annual white grub) selected from the group consisting of: Annual blue grass weevil (Listronotus maculicollis); Asiatic garden beetle (Maladera castanea); European chafer (Rhizotroqus majalis); Green June beetle (Cotinis nitida); Japanese beetle (Popillia japonica); May or June beetle (Phyllophaga sp.); Northern masked chafer (Cyclocephala borealis); Oriental beetle (Anomala orientalis); Southern masked chafer (Cyclocephala lurida); and Billbug (Curculionoidea).

[1158] Bt-Toxin-Resistant Pests

[1159] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to one or more insecticides, for example, one or more Bt toxins. An exemplary description of Bt toxins is disclosed in Adang et al., (2014) Diversity of Bacillus thuringiensis crystal toxins and mechanism of action. In: Dhadialla, Tarlochan and Gill, Sarjeet (eds.) Insect Midgut and Insecticidal Proteins. Advances in Insect Physiology, 47. Academic Press, pp. 39-87; and PCT Application No. WO2009076475, the disclosures of which are incorporated herein by reference in their entirety.

[1160] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to one or more Bt toxins as described herein.

[1161] In some embodiments, an insect and/or pest may be resistant or at least partially resistant to a Bt toxin. For example, in some embodiments, an insect and/or pest may be resistant or at least partially resistant to a Bacillus thuringiensis toxin; Bacillus thuringiensis Cry11Aa protein; Bacillus thuringiensis Cry11Ba protein; Bacillus thuringiensis Cry1Ac protein; Bacillus thuringiensis Cry1A.105 protein; Bacillus thuringiensis Cry1Aa protein; Bacillus thuringiensis Cry1Ab protein; Bacillus thuringiensis Cry1Da protein; Bacillus thuringiensis Cry1F protein; Bacillus thuringiensis Cry2A protein; Bacillus thuringiensis Cry2Ab protein; Bacillus thuringiensis Cry2Ab2 protein; Bacillus thuringiensis Cry2Ae protein; Bacillus thuringiensis Cry4Aa protein; Bacillus thuringiensis Cry4B protein; Bacillus thuringiensis CryIAa protein; Bacillus thuringiensis crystal CryIC protein; Bacillus thuringiensis CryIJa protein; Bacillus thuringiensis HD73 spore/crystal protein; Bacillus thuringiensis var. kurstaki HD-1 protein; Bacillus thuringiensis var. tenebrionenis protein; Bacillus thuringiensis var. aizawai protein; Bacillus thuringiensis var. aizawai ATTC SD-1372 protein; Bacillus thuringiensis var. israelensis protein; Bacillus thuringiensis var. kurstaki protein; Bacillus thuringiensis var. kurstaki (Dipel) protein; Bacillus thuringiensis var. kurstaki (Javelin) protein; Bacillus thuringiensis Vip3A protein; Cry1A. 105 protein; Cry1Ah protein; Cry1Ba protein; Cry1C protein; Cry1Ca protein; Cry1Ie protein; Cry2Aa protein; Cry3Bb1 protein; Cry4Ba protein; or CryIIB protein.

[1162] In some embodiments, an insect and/or pest that may be resistant or at least partially resistant to a Bt toxin can be selected from the following orders: Culicidae diptera; Chrysomelidae coleoptera; Pyralidae lepidoptera; Gelechiidae lepidoptera; Pyralidae lepidoptera; Plutellidae lepidoptera; or Noctuidae lepidoptera.

[1163] In some embodiments, an insect and/or pest that may be resistant or at least partially resistant to a Bt toxin can be selected from the following species: Aedes aegypti, Busseola fusca; Chilo suppressalis; Culex pipiens; Culex quinquefasciatus; Diabrotica virgifera; Diatraea saccharalis; Helicoverpa armigera; Helicoverpa zea; Heliothis virescens; Leptinotarsa decemlineata; Ostrinia furnacalis; Ostrinia nubilalis; Pectinophora gossypiella; Plodia interpunctella; Plutella xylostella; Pseudoplusia includens; Spodoptera exigua; Spodoptera frugiperda; Spodoptera littoralis; Trichoplusia ni; and Xanthogaleruca luteola.

EXAMPLES

Example 1

[1164] Combinations of Bti Toxin and U+2-ACTX-Hv1a

[1165] To test the effect of combining Bacillus thuringiensis var. israelensis toxins (Bti toxin) with U+2-ACTX-Hv1a, the following experiments were performed: first, an arena was established that consisted of a 59 mL cup that contained 30 mL of water. In each cup, third instar mosquito larvae (N=10) were added. No food was provided. Next, the given treatment solution was added to cup, and the cup was sealed with a lid. The cups were then placed on a tray under fluorescent grow lights. Three replicates were provided for each treatment.

[1166] The treatments comprised (1) U+2-ACTX-Hv1a with Bti toxin; (2) Bti toxin alone; (3) U+2-ACTX-Hv1a alone; and (4) water (as an untreated control).

[1167] To evaluate Bti toxin, AQUABAC XT from Becker Microbial Products, Inc. was used. AQUABAC XT consists of the following ingredients: 6-10% (8%) Bacillus thuringiensis ssp. israelensis Strain BMP 144 solids, spores & insecticidal toxins, wherein said insecticidal toxins are -endotoxins, and equivalent to 1,200 International Toxic Units (ITU/mg) (4.84 Billion ITU/gallon or 1.2 Billion ITU/Liter); and 92% other/inactive ingredients.

[1168] AQUABAC XT consisting of Bacillus thuringiensis ssp. israelensis Strain BMP 144 solids, spores and insecticidal toxins, is commercially available from Becker Microbial Products, Inc., 11146 N.W. 69th Place, Parkland, Fla. 33076, U.S.A.; website: https://beckermicrobialproductsinc.com/; product code: 27376; EPA Reg. No. 62637-1.

[1169] U+2-ACTX-Hv1a having an amino acid sequence of GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA (SEQ ID NO: 5) was obtained according to the methods described herein.

[1170] Each treatment was tested nine times (N=9). Here, the amount of Bti toxin used 0.25 g/mL or 0.25 ppm. The amount of U+2-ACTX-Hv1a used in this example was 1 mg/mL.

[1171] After 24 hours, the combination of U+2-ACTX-Hv1a with Bti toxin resulted in a surprising effect corresponding to 95% mortality. Alternatively, Bti toxin alone only resulted in 57% mortality, and U+2-ACTX-Hv1a alone only resulted in 4% mortality. Accordingly, the combination of U+2-ACTX-Hv1a with Bti toxin resulted in an insecticidal effect. FIG. 23.

Example 2

[1172] Foliar Spray Bioassay: Combination of Btk Toxin with -CNTX-Pn1a

[1173] The effect of combining Bacillus thuringiensis var. kurstaki toxin (Btk toxin) with -CNTX-Pn1a was tested against the lepidopteran species, beet armyworm (Spodoptera exigua). Mortality of the beet armyworm was assessed when confronting the insect with either (1) -CNTX-Pn1a alone; (2) Btk toxin alone; (3) a combination of -CNTX-Pn1a and Btk toxin; or (4) a control (0.125% Vintre, a surfactant).

[1174] To evaluate Btk toxin, BioProtec Plus from AEF Global Inc. was used. BioProtec Plus consists of 14.49% Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 fermentation solids, spores, and insecticidal toxins with a potency of 17,500 Cabbage Looper Units (CLU) per mg of product (equivalent to 76 billion CLU per gallon of product); and 85.51% other/inactive ingredients.

[1175] BioProtec Plus consisting of 14.49% Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 fermentation solids, spores, and insecticidal toxins, is commercially available from AEF Global Inc., 925 des calfats, US-QC, Levis, G6Y9E8, Canada; website: http://www.aefglobal.com/en/; CAS number: 68038-71-1; lot number: 31G18.

[1176] -CNTX-Pn1a having an amino acid sequence of GSCADINGACKSDCDCCGDSVTCDCYWSDSCKCRESNFKIGMAIRKKFC (SEQ ID NO: 1778) was obtained using ion exchange chromatography, and according to the methods described herein.

[1177] To test the effect of the combinations, romaine lettuce was cut into 30 mm diameter disks, and then sterilized using a 140 ppm bleach solution; the disks were then triple rinsed. The romaine lettuce disks were then pinned to a Styrofoam board and sprayed with a given treatment; the disks were flipped, sprayed again, allowed to dry, and placed in the arena.

[1178] The arena was 32-well rearing tray containing 5 mL of 1% agar per well. One romaine lettuce disk was placed in each well, with a single second instar beet armyworm per leaf disk. The trays were then placed in a 28 C. incubator. Each treatment was tested on 12 disks, with three replicates (N=36).

[1179] First, a sublethal dose (i.e., a dose resulting in approximately 20% of the population being killed, or LD.sub.20) of Btk toxin was determined, to allow the observation of insecticidal peptides when combined with Btk toxin, and subsequently allow the observation of insecticidal activity between the two products.

[1180] Here, the sublethal does of Btk toxin was 736 ppm (0.736 mg/mL), which resulted in the death of 25% of the population. FIG. 24. Once the sublethal dose of Btk toxin was identified, the dose of -CNTX-Pn1a was increased until the LD.sub.50 amount was reached for the -CNTX-Pn1a+Btk toxin combination.

[1181] As shown in FIG. 24, the use of 1.6 mg/mL of -CNTX-Pn1a resulted in 6% mortality; however, when combined with 0.736 mg/mL of Btk toxin, the mortality jumped to 28%. Likewise, 6.75 mg/mL of -CNTX-Pn1a caused a mortality rate of 3%; but, when combined with 0.736 mg/mL of Btk toxin, the mortality rate was 50%. This example demonstrates that a combination of Btk toxin and -CNTX-Pn1a results in an insecticidal effect.

Example 3

[1182] Foliar Spray Bioassay: Combination of Btk Toxin with AVPs

[1183] The effect of combining Btk toxin with Av3b-Variant Polypeptides (AVPs) was tested against the lepidopteran species, beet armyworm (Spodoptera exigua). Mortality of the beet armyworm was assessed when confronting the insect with either (1) AVP alone; (2) Btk toxin alone; (3) a combination of both AVP and Btk toxin; or (4) a control (0.125% Vintre, a surfactant).

[1184] To evaluate Btk toxin, BioProtec Plus from AEF Global Inc. was used. BioProtec Plus consists of 14.49% Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 fermentation solids, spores, and insecticidal toxins with a potency of 17,500 Cabbage Looper Units (CLU) per mg of product (equivalent to 76 billion CLU per gallon of product); and 85.51% other/inactive ingredients.

[1185] BioProtec Plus consisting of 14.49% Bacillus thuringiensis ssp. kurstaki strain EVB-113-19 fermentation solids, spores, and insecticidal toxins, is commercially available from AEF Global Inc., 925 des calfats, US-QC, Levis, G6Y9E8, Canada; website: http://www.aefglobal.com/en/; CAS number: 68038-71-1; lot number: 31G18.

[1186] The Av3-variant polypeptide (AVPs) evaluated has an amino acid sequence of KSCCPCYWGGCPWGQNCYPEGCSGPK (SEQ ID NO: 1782), and was obtained using the methods described herein. Briefly, the AVP was obtained by first generating an AVP peptide expression vector was generated based on the pKLAC1 yeast expression vector (available from NEW ENGLAND BIOLABS): AVPs were expressed as a secretion peptide with acetamidase gene expression as the selection marker. The expression vector of pLB102 was linearized by the digestion with the restriction enzyme SacII; the linear pLB102 plasmid was then transformed into K. lactis cell by electroporation; 96 of resulting positive transformation colonies were cultured. Seed culture of the production strain for inoculation of the 2 L fermentation was preceded for 24 hours in the seed medium containing 3% solulys 095K+3% glucose and 50 g/mL Kanamycin. Then 30 mL seed culture was used to inoculate 2 L fermentation tank with 1 L batch medium containing 1 L basal salt media (BMS (g/L): Solulys 095K 40, suppressor 3519 0.1 mL, 85% phosphoric acid 13 mL, CaSO.sub.4 0.5, K.sub.2SO.sub.4 9.1, MgSO.sub.4.7H.sub.2O 7.5, KOH 2.1, (NH.sub.4).sub.2SO.sub.4 5, Dextrose 10) with 1.2% Pichia Trace metals (PTM (g/L): CuSO.sub.4.5H.sub.2O 6, NaI 0.08, MgSO.sub.4.H.sub.2O 3, NaMoO.sub.4.2H.sub.2O 0.2, H.sub.3BO.sub.3 0.02, CoCl.sub.2.6H.sub.2O 0.5, ZnCl.sub.2 20, FeSO.sub.4.6H.sub.2O 65, H.sub.2SO.sub.4 5 mL) and 2 mL 5% suppressor 7153. Batch phase of fermentation continued for 6 hours with controlled temperature at 27 C., pH 4.80 and dissolved oxygen at 15%. After 6 hour batch fermentation, temperature was dropped to 23.5 C. and feeding of sugar alcohol started and continued for 120 hours with temperature control at 23.5 C. for the rest of fermentation process. Feed media was fed at a gradually increased rates: 3.4 mL/hr. for 24 hours, 4.4 mL/hr. for 30 hours, 7.2 mL/hr. for 24 hours, 8.8 mL/hr. for 12 hours and 11 mL/hr. until feed medium was totally consumed. Reverse-phase HPLC was used to purify AVP from the fermentation beer (i.e., spent medium) via monolithic C18 columns using water with 0.1% Trifloroacetic acid, and acetonitrile as the mobile phase. An elution protocol using 20-40% acetonitrile was used for AVP purification, in which AVP was eluted between a range of 34-36% acetonitrile.

[1187] An exemplary method of obtaining AVPs is disclosed in PCT Application No. PCT/US2019/051093, the disclosure of which is incorporated herein by reference in its entirety.

[1188] To test the effect of the combinations, romaine lettuce was cut into 30 mm diameter disks, and then sterilized using a 140 ppm bleach solution; the disks were then triple rinsed. The romaine lettuce disks were then pinned to a Styrofoam board and sprayed with a given treatment; the disks were flipped, sprayed again, allowed to dry, and placed in the arena.

[1189] The arena was 32-well rearing tray containing 5 mL of 1% agar per well. One romaine lettuce disk was placed in each well, with a single second instar beet armyworm per leaf disk. The trays were then placed in a 28 C. incubator. Each treatment was tested on 12 disks, with three replicates (N=36).

[1190] First, a sublethal dose (i.e., a dose resulting in approximately 20% of the population being killed, or LD.sub.20) of Btk toxin was determined, to allow the observation of insecticidal peptides when combined with Btk toxin, and subsequently allow the observation of insecticidal activity between the two products.

[1191] Here, the sublethal does of Btk toxin was 800 ppm (0.8 mg/mL), which resulted in the death of 31% of the population. FIG. 25. Once the sublethal dose of Btk toxin was identified for these experiments, the dose of AVP was increased until the LD.sub.50 amount was reached for the AVP+Btk toxin combination.

[1192] As shown in FIG. 25, the use of 1.1 mg/mL of AVP resulted in 5% mortality; however, when combined with 0.8 mg/mL of Btk toxin, the mortality rate increased to 50%. Similarly, when using AVP alone at a dose of 3 mg/mL, the mortality rate was 11%; however, when combined with 0.8 mg/mL of Btk toxin, the mortality rate increased to 67%. Finally, using a dose of 9 mg/mL of AVP alone resulted in a 10% mortality rate, but, when combined with Btk toxin, the mortality rate was 88%. This example demonstrates that a combination of Btk toxin and AVP results in an insecticidal effect.

Example 4

[1193] Diet Incorporation Assay: Combination of Btt Toxin with U+2-ACTX-Hv1a

[1194] The darkling beetle, Alphitobius diaperinus (of the order Coleoptera: family Tenebrionidae), also known as the lesser mealworm in its larval stages, is a serious pest in poultry houses. The larvae of the beetle eat chicken food, manure, and carcasses on the floor. Additionally, larvae are a vector of diseases when eaten by the chickens. And, the larvae burrow into Styrofoam insulation, reducing thermal efficiency of buildings.

[1195] The effect of the dietary incorporation of a combination of Bacillus thuringiensis var. tenebrionis toxins (Btt toxin) with U+2-ACTX-Hv1a was tested against the Coleopteran species, darkling deetle (Alphitobius diaperinus). Mortality of darkling beetles were assessed after the incorporation of one of the following treatments into the insect's diet: (1) U+2-ACTX-Hv1a alone; (2) Btt toxin alone; (3) a combination of both U+2-ACTX-Hv1a and Btt toxin; or (4) an untreated control (water).

[1196] To evaluate Btt toxin, NOVODOR FC from VALENT U.S.A. LLC Agricultural Products was used. NOVODOR FC (or flowable concentrate) consists of 10% Bacillus thuringiensis ssp. tenebrionis strain NB-176 fermentation solids and solubles, with a potency of 15,000 Leptinotarsa Units (LTU) per gram of product (equivalent to 16.3 Million LTU's per quart of product); and 90% other/inactive ingredients.

[1197] NOVODOR FC consisting of Bacillus thuringiensis ssp. tenebrionis strain NB-176 fermentation solids and solubles, is commercially available from VALENT U.S.A. LLC Agricultural Products, 1333 N California Blvd, Suite 600, US-CA, Walnut Creek, 94596-8025, U.S.A., website: https://www.valent.com/; product code number: 96017; list number: 60220; lot number: 235-222-3L-00.

[1198] U+2-ACTX-Hv1a having an amino acid sequence of GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA (SEQ ID NO: 5) was obtained according to the methods described herein.

[1199] To test the effect of the combinations, an arena was created comprising a 128 well bioassay tray, into which two (N=2), first-instar lesser mealworms were added (i.e., 2 mealworms per well). The mealworms were then provided a meal consisting of Southern Corn Rootworm (SCR) diet (Frontier Scientific, Newark, Del. 19713, product No. F9800B) mixed with one of the treatments. The meal consisted of 1 mL of agar-based SCR diet, mixed with one of the treatments. Stock meal mixtures were made by combining 15 mL of SCR diet held at 65 C. with 10 mL of 2.5 treatment solution. The wells were then secured with vented lid, and the tray was placed in an incubator with the following environmental conditions: 32 C.; 50-70% relative humidity; and no lights. Four replicates for each treatment condition were completed (N=4).

[1200] Next, a sublethal dose (i.e., a dose resulting in approximately 20% of the population being killed, or LD.sub.20) of Btt toxin was determined, to allow the observation of insecticidal peptides when combined with Btt toxin, and subsequently allow the observation of insecticidal activity between the two products.

[1201] Here, the sublethal does of Btt toxin was 400 ppm (0.4 mg/mL), which resulted in the death of 18% of the population. FIG. 26. Once the sublethal dose of Btt toxin was identified for these experiments, the dose of U+2-ACTX-Hv1a was increased until the LD.sub.50 amount was reached for the U+2-ACTX-Hv1a+Btt toxin combination.

[1202] As shown in FIG. 26, the use of 1 mg/mL of U+2-ACTX-Hv1a alone resulted in 20% mortality; however, when combined with 0.4 mg/mL of Btt toxin, the mortality rate increased to 50%. Likewise, when using U+2-ACTX-Hv1a alone at a dose of 3 mg/mL, the mortality rate was 44%; however, when combined with 0.4 mg/mL of Btt toxin, the mortality rate increased to 91%. Finally, using a dose of 8 mg/mL of U+2-ACTX-Hv1a alone resulted in a 74% mortality rate. However, when 8.0 mg/mL of U+2-ACTX-Hv1a was combined with 0.4 mg/mL of Btt toxin, the mortality rate increased to 95%. This example demonstrates that a combination of Btt toxin and U+2-ACTX-Hv1a results in an insecticidal effect.

Example 5

[1203] Spray Assay: Combination of Btt Toxin with U+2-ACTX-Hv1a

[1204] A spray assay was performed in order to determine the effect of using a spray containing Btt toxin with U+2-ACTX-Hv1a on Colorado potato beetle (Leptinotarsa decemlineata) mortality.

[1205] Approximately 16 first-instar Colorado potato beetles were placed on filter paper (Whatman #3, 90 mm diameter), contained in an inverted petri dish (25100 mm). Next a mini-spray bottle (Qosmedix) was used to spray the Colorado potato beetles with 2 mL of treatment solution containing the following: water; 10 ppT (0.01 mg/mL of U+2-ACTX-Hv1a; and 20 ppT (0.02 mg/mL) of Btt toxin. The petri dish was then sealed with parafilm, and stored in the incubator (28 C.; 50% relative humidity; lights on) for 4 hours. Beetles were sprayed with (1) U+2-ACTX-Hv1a alone; (2) Btt toxin alone; (3) a combination of both U+2-ACTX-Hv1a and Btt toxin; or (4) an untreated control (water).

[1206] To evaluate Btt toxin, NOVODOR FC from VALENT U.S.A. LLC Agricultural Products was used. NOVODOR FC (or flowable concentrate) consists of 10% Bacillus thuringiensis ssp. tenebrionis strain NB-176 fermentation solids and solubles, with a potency of 15,000 Leptinotarsa Units (LTU) per gram of product (equivalent to 16.3 Million LTU's per quart of product); and 90% other/inactive ingredients.

[1207] NOVODOR FC consisting of Bacillus thuringiensis ssp. tenebrionis strain NB-176 fermentation solids and solubles, is commercially available from VALENT U.S.A. LLC Agricultural Products, 1333 N California Blvd, Suite 600, US-CA, Walnut Creek, 94596-8025, U.S.A., website: https://www.valent.com/; product code number: 96017; list number: 60220; lot number: 235-222-3L-00.

[1208] U+2-ACTX-Hv1a having an amino acid sequence of GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA (SEQ ID NO: 5) was obtained according to the methods described herein.

[1209] Following the spray treatment, individual beetles were transferred to the wells of a rearing tray, where they were provided 1 mL per well of an artificial Colorado potato beetle diet (Frontier Scientific, Newark, Del. 19713, product No. F9380B) with formaldehyde. Mortality rates were measured every 24 hours for the next 4 days.

[1210] As shown in FIG. 27, after 24 hours (1 day) beetles treated with U+2-ACTX-Hv1a alone had a 4% mortality rate. Beetles treated with Btt toxin alone possessed a 2% mortality rate. In stark contrast to the mortality rates of either U+2-ACTX-Hv1a or Btt toxin alone, combining U+2-ACTX-Hv1a with Btt toxin resulted in a 79% mortality rate after 24 hours. This pattern of insecticidal activity continued at subsequent time points. At 48 hours (2 days), beetles treated with U+2-ACTX-Hv1a alone possessed a 9% mortality rate. Beetles treated with Btt toxin alone possessed a 6% mortality rate. By combining U+2-ACTX-Hv1a with Btt toxin, the mortality rate increased to 81% at 48 hours. At 72 hours (3 days), beetles treated with U+2-ACTX-Hv1a alone possessed a 7% mortality rate. Beetles treated with Btt toxin alone possessed a 23% mortality rate. By combining U+2-ACTX-Hv1a with Btt toxin, the mortality rate increased to 94% at 72 hours. Finally, at 96 hours (4 days), beetles treated with U+2-ACTX-Hv1a alone possessed a 19% mortality rate. Beetles treated with Btt toxin alone possessed a 68% mortality rate. By combining U+2-ACTX-Hv1a with Btt toxin, the mortality rate increased to 91% at 96 hours.