Diagnosis of cancer by detecting auto-antibodies against EGF-receptor

10739346 ยท 2020-08-11

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a method for diagnosis of a cancer, comprising the steps of (i) determining the level of antibodies against epidermal growth factor receptor (EGFR) in a sample from a subject to be diagnosed, (ii) comparing the determined level in the sample to a control level derived from subjects without cancer; wherein a decreased level in the sample from the subject to be diagnosed as compared to the control level is indicative for cancer in the subject. Furthermore, the invention relates to method of predicting response and outcome of a treatment of a cancer with an inhibitor of EGFR activity.

Claims

1. A method for diagnosis and treatment of ovarian cancer, comprising the steps of: (a) measuring the level of antibodies against epidermal growth factor receptor (EGFR) (anti-EGFR antibodies) in a sample from a subject to be diagnosed, wherein the anti-EGFR antibodies bind to EGFR identified as SEQ ID NO:1; (b) comparing the measured level of anti-EGFR antibodies in the sample to a control level derived from subjects without cancer; wherein a decreased level of anti-EGFR antibodies in the sample from the subject to be diagnosed as compared to the control level is indicative for ovarian cancer in the subject; and (c) administering, to the subject diagnosed with ovarian cancer, a drug that is selected from a group consisting of panitumumab, cetuximab, zalutumumab, nimotuzumab, matuzumab, gefitinib, erlotinib, lapatinib, vandetanib, and trastuzumab.

2. The method of claim 1, wherein a level of less than 0.9 fold of the natural log (ln) of the mean value as compared to the control level from subjects without cancer is indicative of ovarian cancer.

3. The method of claim 1, wherein a level of anti-EGFR antibodies below 50 units/ml is indicative of ovarian cancer.

4. The method of claim 1, wherein the anti-EGFR antibody is detected in an immunoassay.

5. The method of claim 4, wherein the immunoassay is selected from the group consisting of immunoprecipitation, enzyme immunoassay (EIA), radioimmunoassay (MA), enzyme-linked immunosorbent assay (ELISA), fluorescent immunoassay, a chemiluminescent assay, an agglutination assay, nephelometric assay, turbidimetric assay, a Western Blot, a competitive immunoassay, a noncompetitive immunoassay, a homogeneous immunoassay, a heterogeneous immunoassay, a bioassay and a reporter assay.

6. The method of claim 1, wherein the sample is serum or plasma.

7. The method of claim 1 wherein determining the level of anti-EGFR antibodies comprises the steps of: (a) contacting the sample with epidermal growth factor receptor (EGFR) or an antigenic peptide fragment thereof under conditions allowing for the formation of a complex between anti-EGFR antibodies with EGFR or a peptide fragment thereof; and (b) detecting the complex.

8. The method of claim 7, wherein the EGFR or the peptide fragment thereof is immobilized on a surface.

9. The method of claim 7, wherein the complex is detected using a secondary antibody against the Fc portion of the anti-EGFR antibody.

10. The method of claim 9, wherein the anti-EGFR antibody is an IgG-antibody and the secondary antibody is an anti-IgG antibody.

11. The method of claim 10, wherein the secondary antibody is labeled with a detectable marker.

12. The method of claim 1, further comprising detecting a presence of one or more markers for cancer in the sample.

13. A method for diagnosis and treatment of ovarian cancer, comprising the steps of: (a) measuring the level of antibodies against epidermal growth receptor (EGFR) (anti-EGFR antibodies) in a sample from a subject to be diagnosed, wherein the anti-EGFR antibodies bind to EGFR identified as SEQ ID NO:1; (b) comparing the measured level of anti-EGFR antibodies in the sample to a control level derived from subjects without cancer; wherein a decreased level of anti-EGFR antibodies in the sample from the subject to be diagnosed as compared to the control level is indicative for ovarian cancer in the subject; and (c) administering, to the subject with a decreased level of anti-EGFR antibodies as compared to the control level derived from subjects without cancer, a drug that is selected from a group consisting of panitumumab, cetuximab, zalutumumab, nimotuzumab, matuzumab, gefitinib, erlotinib, lapatinib, vandetanib, and trastuzumab.

Description

DESCRIPTION OF DRAWINGS

(1) FIG. 1: Comparison of the mean level of anti-EGFR antibodies (ln of units/ml) in serum samples of ovarian cancer patients (OvCA; ln of mean 3.238; n=201) to the mean level of anti-EGFR antibodies in serum samples of a healthy control group (Control, ln of mean=3.749; n=131). The p-value is indicated on top. Bars indicate standard error of mean.

(2) FIG. 2: Comparison of the mean level of anti-EGFR antibodies (ln of units/ml) in serum samples of ovarian cancer patients showing no relapse (ln of mean=3.407; n=77) to the mean level of anti-EGFR antibodies in serum samples of ovarian cancer patients showing relapse of ovarian cancer after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatinum (ln of mean=3.133; n=123). The column on the left indicates the levels of anti-EGFR antibodies in healthy subjects (for details see FIG. 1). Numbers above the columns indicate p-values (0.0001 between control and relapse as well as between control and no relapse; 0.0015 between no relapse and relapse). Bars indicated standard error of mean.

(3) FIG. 3: Comparison of the mean level of anti-EGFR antibodies (ln of units/ml) in serum samples of ovarian cancer patients who survived after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatinum (alive; mean=3.355; n=71) to the mean level of anti-EGFR antibodies in serum samples of ovarian cancer patients who died after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatin (dead; mean=3.172 units/ml; n=128). The left column gives the healthy control group. P-values are indicated above (0.0001 between control and alive as well as between control and dead, and 0.0382 between alive and dead). Bars indicate standard error of mean.

(4) FIG. 4: A: on top sensitivity of the prediction of relapse of ovarian cancer after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatin is plotted against the specificity. Cutoff value (ln of units/ml=3.07) and AUC is given in the graph. Below Kaplan-Meier estimators with the proportion of patients not showing relapse after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatin is shown over the time for patients having antibody levels below the ROC-cutoff value (dotted line) and above the ROC-cutoff value (solid line). B: on top sensitivity of the prediction of survival after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatin is plotted against the specificity. Cutoff value (ln of units=3.13) and AUC is given in the graph. Below Kaplan-Meier estimators with the proportion of patients surviving after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatin is shown over the time for patients having antibody levels below the ROC-cutoff value (dotted line) and above the ROC-cutoff value (solid line). C: on the left sensitivity of the prediction of a combined endpoint (death or relapse of cancer) of ovarian cancer patients after surgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatinis plotted against the specificity. Cutoff value (ln of units/ml=3.13) and AUC is given in the graph. Below Kaplan-Meier estimators with the proportion of patients surviving or not showing relapse of cancer aftersurgical removal of the tumor and subsequent chemotherapy with cisplatin or carboplatin is shown over the time for patients having antibody levels below the ROC-cutoff value (dotted line) and above the ROC-cutoff value (solid line).

(5) FIG. 5: Prediction of survival after treatment of ovarian cancer with panitumumab (Vectibix). Samples were taken before onset of treatment. Levels of antibodies directed against EGFR were measured . The patients were categorized in relapse after panitumumab treatment or no relapse after panitumumab treatment and showed mean values for EGFR antibody levels of 95.0 units/ml (relapse free) or 40.1 units/ml (relapse), respectively. (The mean of patients with a relapse was elevated because of one patient showing relapse and having high EGFR antibody levels. Not counting this patient the mean of patients showing relapse is about 20 units/ml).

(6) FIG. 6: Standard curve of the EGF-Receptor-Auto-Antibody ELISA

DETAILED DESCRIPTION OF THE INVENTION

(7) The present invention is based on the surprising finding of the inventors that in samples of patients with cancer decreased levels of anti-EGFR antibodies can be found as compared to subjects without cancer. In other words the inventors have found that patients with ovarian cancer have little or no detectable antibodies against epidermal growth factor receptor (EGFR) in the blood (e.g determined in the serum) whereas in control groups anti-EGFR auto-antibodies can be detected at higher levels.

(8) The invention relates to a method for the diagnosis of a cancer, comprising the steps of

(9) (i) determining the level of antibodies against EGFR in a sample from a subject to be diagnosed,

(10) (ii) comparing the determined level in the sample to a control level derived from subjects without cancer;

(11) wherein a decreased level in the sample from the subject to be diagnosed as compared to the control level is indicative for cancer in the subject.

(12) As can be derived from FIG. 1, the In of the mean level of EGFR antibodies in patients suffering from ovarian cancer is 3.238 (=25.5 units) and in healthy subjects 3.749 (=42.5 units). Hence, in one embodiment a level of less than 0.9 fold as compared to the control level from subjects without cancer is indicative for the presence of cancer, preferably a level of less than 0.8 fold, more preferably of less than 0.7 fold, even more preferred of less than 0.65 fold. The cancer is preferably an EGF or EGFR driven cancer as defined herein.

(13) Particularly preferred is ovarian cancer. The skilled person will acknowledge that in case a certain cancer is to be diagnosed, the control level is preferably derived from subjects not having this particular cancer.

(14) Auto-antibodies directed against EGFR are not known until today. The inventors of the present application for the first time demonstrate the presence of such antibodies as well as the diagnostic and predictive value. It was found that a decrease in the level of antibodies directed against EGFR in samples of a subject to be diagnosed as compared samples from subjects with proven absence of cancer is indicative for the presence of cancer as well as for the prediction of response or non-response to a treatment of the cancer with a drug or surgical removal and subsequent treatment with a drug. Hence, cancer in connection with the present invention is to be understood as any diseases involving unregulated cell growth. Cancer in this regard is a disease where cells divide and grow uncontrollably resulting in the formation of malignant tumors. However, in a preferred embodiment of the present invention cancer refers to an EGFR or EGF associated cancer. EGFR and EGF associated cancers are known by the skilled person. Mutations that lead to EGFR overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer, anal cancers (Walker F, Abramowitz L, Benabderrahmane D, Duval X, Descatoire V, Hnin D, Lehy T, Aparicio T (November 2009). Growth factor receptor expression in anal squamous lesions: modifications associated with oncogenic human papillomavirus and human immunodeficiency virus. Hum. Pathol. 40 (11): 1517-27), ovarian cancer and glioblastoma multiforme. Mutations involving EGFR could lead to its constant activation, which could result in uncontrolled cell divisiona predisposition for cancer (Lynch T J, Bell D W, Sordella R, Gurubhagavatula S, Okimoto R A, Brannigan B W, Harris P L, Haserlat S M, Supko J G, Haluska F G, Louis D N, Christiani D C, Settleman J, Haber D A (May 2004). Activating mutations in the epidermal growth factor receptor underlying responsiveness of non-small-cell lung cancer to gefitinib. N. Engl. J. Med. 350 (21): 2129-39). Mutations, amplifications or misregulations of EGFR or family members are implicated in about 30% of all epithelial cancers. Hence, in a preferred embodiment of the present invention the cancer is an epithelial cancer, preferably selected from the group consisting of breast cancer, lung cancer, colon cancer, renal cancer, a glioblastoma and ovarian cancer. In a particularly preferred embodiment the cancer according to the present invention, including all embodiments, is an ovarian cancer. Ovarian cancer often derives from the epithelium of the ovary, but may also be derived from fallopian tube. However, it was found that in both cases the method of the present invention is predictive for the presence of cancer or the response to a certain treatment. Hence, in one embodiment of the present invention cancer is an ovarian cancer, the ovarian cancer being epithelial ovarian cancer or cancer derived from the fallopian tube.

(15) The skilled person knows that depending on the subject, different cancers may be diagnosed. He is aware that he also may have to consider further parameters to diagnose the subject, e.g. when diagnosing ovarian cancer, the subject has to be female. In the context of the present invention the subject to be diagnosed is a mammal, preferably a human. In a further preferred embodiment the subject is a female mammal, preferably a female human subject suspected of having ovarian cancer or a female mammal, preferably a female human subject to be screened for the presence of ovarian cancer, preferably a female human subject to be treated or being treated for ovarian cancer with a drug.

(16) The invention particularly relates to a method for diagnosis of ovarian cancer, wherein the level of antibodies against EGFR is determined in a sample from a subject to be diagnosed and wherein a level of anti-EGFR antibodies below 50 units/ml is indicative for ovarian cancer, preferably a level below 40 units/ml, even more preferred below 30 units/ml, in a further preferred embodiment a level of anti-EGFR antibodies below 25 units/ml is indicative for cancer.

(17) In the context of the present invention the terms EGFR and EGF-receptor equally relate to the epithelial growth factor receptor (also known asErbB-1 and HER1).

(18) The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer (Zhang H, Berezov A, Wang Q, Zhang G, Drebin J, Murali R, Greene M I (August 2007). ErbB receptors: from oncogenes to targeted cancer therapies. J. Clin. Invest. 117 (8): 2051-8).

(19) EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor (TGF). ErbB2 has no known direct activating ligand, and may be in an activated state constitutively or become active upon heterodimerization with other family members such as EGFR. Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer (Yosef Yarden and Joseph Schlessinger (1987). Epidermal Growth-Factor Induces Rapid, Reversible Aggregation of the Purified Epidermal Growth-Factor Receptor. Biochemistry 26 (5): 1443-1451). In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. Formation of clusters of activated EGFRs have been reported, although it remains unclear whether this clustering is important for activation itself or if it is a secondary effect occurring after activation by dimerization.

(20) EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity and autophosphorylation of tyrosine (Y) residues in the C-terminal domain of EGFR occurs, e.g. Y992, Y1045, Y1068, Y1148 and Y1173 (Downward J, Parker P, Waterfield Md. (1984). Autophosphorylation sites on the epidermal growth factor receptor. Nature 311 (5985): 483-5). Thereby downstream activation and signaling is activated by binding of other proteins to the phosphorylated tyrosines through their phosphotyrosine-binding SH2 domains. These downstream signaling proteins initiate several signal transduction cascades, principally the MAPK, Akt and JNK pathways, leading to DNA synthesis and cell proliferation (Oda K, Matsuoka Y, Funahashi A, Kitano H (2005). A comprehensive pathway map of epidermal growth factor receptor signaling. Mol. Syst. Biol. 1 (1): 2005.0010). Such proteins modulate phenotypes such as cell migration, adhesion, and proliferation. Activation of the receptor is important for the innate immune response in human skin. The kinase domain of EGFR can also cross-phosphorylate tyrosine residues of other receptors it is aggregated with, and can itself be activated in that manner.

(21) The identification of EGFR as an oncogene has led to the development of anticancer therapeutics directed against EGFR, including gefitinib (Paez J G, Janne P A, Lee J C, Tracy S, Greulich H, Gabriel S, Herman P, Kaye F J, Lindeman N, Boggon T J, Naoki K, Sasaki H, Fujii Y, Eck M J, Sellers W R, Johnson B E, Meyerson M (June 2004). EGFR mutations in lung cancer: correlation with clinical response to gefitinib therapy. Science 304 (5676): 1497-500), erlotinib, and cetuximab. Most of the therapeutic approaches target the misregulation of EGFR, i.e. inhibit EGFR activation. Cetuximab and panitumumab are examples of monoclonal antibody inhibitors used for treatment. Other monoclonal antibodies in clinical development are zalutumumab, nimotuzumab, and matuzumab. The monoclonal antibodies block the extracellular ligand binding domain. With the binding site blocked, signal molecules can no longer attach there and activate the tyrosine kinase.

(22) Another method is using small molecules to inhibit the EGFR tyrosine kinase domain at the intracellular part. Without kinase activity, EGFR is unable to activate itself, which is a prerequisite for binding of downstream adaptor proteins. Ostensibly by halting the signaling cascade in cells that rely on this pathway for growth, tumor proliferation and migration is diminished. Gefitinib, erlotinib, and lapatinib (mixed EGFR and ERBB2 inhibitor) are examples of small molecule kinase inhibitors. There are several quantitative methods available that use protein phosphorylation detection to identify EGFR family inhibitors (Olive D M (October 2004). Quantitative methods for the analysis of protein phosphorylation in drug development. Expert Rev Proteomics 1 (3): 327-41).New drugs such as gefitinib and erlotinib directly target the EGFR. Patients have been divided into EGFR-positive and EGFR-negative, based upon whether a tissue test shows a mutation. EGFR-positive patients have shown a 60% response rate, which exceeds the response rate for conventional chemotherapy. However, clear prediction of the response of a patient to a treatment is still an issue (Jackman D M, Miller V A, Cioffredi L A, Yeap B Y, Janne P A, Riely G J, Ruiz M G, Giaccone G, Sequist L V, Johnson B E (August 2009). Impact of epidermal growth factor receptor and KRAS mutations on clinical outcomes in previously untreated non-small cell lung cancer patients: results of an online tumor registry of clinical trials. Clin. Cancer Res. 15 (16): 5267-73). Many patients develop resistance increasing the risk for relapse of cancer after treatment. Two primary sources of resistance are the T790M Mutation and MET oncogenes (Jackman et al (2009)). However, as of 2010 there was no consensus of an accepted approach to combat resistance nor FDA approval of a specific combination. Preclinical results have been reported for AP26113 which targets the T790M mutation.

(23) In the context of the immunoassays of the present invention the EGF-receptor may be present in its natural cellular environment and can be used together with the material associated with the receptor in its natural state as well as in isolated form with respect to its primary, secondary and tertiary structures. The EGF-receptor is well known to those skilled in the art. The receptor is preferably used in isolated form, i.e. essentially free of other proteins, lipids, carbohydrates or other substances naturally associated with the receptor. Essentially free of means that the receptor is at least 75%, preferably at least 85%, more preferably at least 95% and especially preferably at least 99% free of other proteins, lipids, carbohydrates or other substances naturally associated with the receptor.

(24) In connection with the present invention, the naturally occurring receptor as well as all modifications, mutants or derivatives of the EGF-receptor can be used. Similarly, a EGF-receptor produced by means of recombinant techniques, which receptor includes amino acid modifications, such as inversions, deletions, insertions, additions etc. can be used according to the invention provided that this part of the essential function of the EGF-receptor is present, namely the capability of binding antibodies. The EGF-receptor being used may also comprise exceptional amino acids and/or modifications of such as alkylation, oxidation, thiol-modification, denaturation, oligomerization and the like. The receptor can also be synthesized by chemical means. According to the invention the EGF-receptor particularly can be a protein and/or peptide or a fusion protein, which in addition to other proteins, peptides or fragments thereof, includes the EGF-receptor as a whole or in part. Using conventional methods, peptides or polypeptides of the EGF-receptor which have functionally analogs, analogous properties can be determined by those skilled in the art. For example such polypeptides or peptides have 50-60%, 70% or 80%, preferably 90%, more preferably 95%, and most preferably 98% sequence homology to peptides identified as EGF-receptor, and said homology can be determined, e.g. by means of Smith-Waterman homology search algorithm, using the MPFRCH program (Oxford Molecular), for example.

(25) The term peptide or polypeptide of an EGF-receptor used in the present invention, comprises also molecules differing from the original sequence by deletion(s), insertion(s), substitution(s) and/or other modifications well known in the prior art and/or comprising a fragment of the original amino acid molecule, the EGF-receptor still exhibiting the properties mentioned above. Such a peptide has preferably at least a length of 100 amino acid residues but may also be shorter, e.g. at least 12, 15, 20 or 25 amino acid residues in length. Also included are allele variants and modifications. Methods of producing the above changes in the amino acid sequence are well known to those skilled in the art and have been described in the standard textbooks of molecular biology, e.g. Sambrook et al., supra. Those skilled in the art will also be able to determine whether an EGF-receptor, thus, modified still has the properties mentioned above. The amino acid sequence of EGF-receptor is known. Database entries exist in several well known Databases. When refereeing to the amino acid sequence of EGF-receptor any amino acid sequence known is meant, particularly those disclosed in common databases. Until today database entries for EGF-receptor are known and include NCBI (NP_005219.2, GI:29725609; updated Jan. 18, 2014), CCDS (CCDS 5514.1), GeneID (Gene ID: 1956, updated on Jan. 19, 2014) Human Gene Nomenclature Commitee (HGNC:3236), and UniProt (P00533; uptaded on Dec. 11, 2013, Version 201). A preferred sequence of EGF-receptor is given as SEQ ID NO:1. The receptor may be glycosylated in vivo. In the present specification all of the above illustrated modifications of the EGFR-receptor will be referred to as functionally analogous peptides or proteins in brief

(26) In context with the present invention different terms may be used for antibodies directed against EGFR, e.g. anti-EGFR, EGFR antibody, anti-EGFR antibody, anti-EGF-receptor antibody all relate to immunoglobulins directed and binding to EGFR. In case the antibodies are to be determined in the samples of the subjects or those in control subject, the antibody is meant to be an autoantibody, i.e. those produced by the subject itself. The antibodies to be detected or determined according to the present invention are directed against EGF-receptor. This means that the antibodies specifically bind EGF-receptor.

(27) Specific binding of an antibody normally occurs via binding of a binding site of the antigen, i.e. EGF-receptor, the epitope. The antibodies of the present invention are those specifically binding to EGF-receptor. This binding may occur via recognition of sequence or structural epitopes. The skilled person is aware of methods of how to determine specific epitopes, e.g. fragments of the antigen EGF-receptor, which are recognized and bound by the antibodies to be determined. Fragments of EGF-receptor binding to the auto antibodies are called immunogenic fragments. Methods for determining fragments of an antigen binding the antibody are described in several publications (e.g. Gershoni, J M; Roitburd-Berman, A; Siman-Tov, D D; Tarnovitski Freund, N; Weiss, Y (2007). Epitope mapping: The first step in developing epitope-based vaccines. BioDrugs 21 (3): 145-56; Westwood, M R; Hay, F C (2001). Epitope Mapping: a practical approach. Oxford, Oxfordshire: Oxford University Press. ISBN 0-19-963652-4; Flanagan et al. (2011), Mapping Epitopes with H/D-Ex Mass Spec. Genetic Engineering and Biotechnology news; 31(1); Gaseitsiwe, S.; Valentini, D.; Mandavifar, S.; Reilly, M.; Ehrnst, A.; Maeurer, M. (2009) Peptide Microarray-Based Identification of Mycobacterium tuberculosis Epitope Binding to HLA-DRB1*0101, DRB1*1501, and DRB1*0401. Clinical and Vaccine Immunology 17 (1): 168-75; Linnebacher, Michael; Lorenz, Peter; Koy, Cornelia; Jahnke, Annika; Born, Nadine; Steinbeck, Felix; Wollbold, Johannes; Latzkow, Tobias et al. (2012). Clonality characterization of natural epitope-specific antibodies against the tumor-related antigen topoisomerase Ila by peptide chip and proteome analysis: A pilot study with colorectal carcinoma patient samples Analytical and Bioanalytical Chemistry 403 (1): 227-38; Cragg, M. S. (2011). CD20 antibodies: Doing the time warp. Blood 118 (2): 219-20; Banik, Soma S. R.; Doranz, Benjamin J. (2010). Mapping Complex Antibody Epitopes. Genetic Engineering and Biotechnology News 3 (2): 25-8; and Paes, Cheryl; Ingalls, Jada; Kampani, Karan; Sulli, Chidananda; Kakkar, Esha; Murray, Meredith; Kotelnikov, Valery; Greene,

(28) Tiffani A. et al. (2009). Atomic-Level Mapping of Antibody Epitopes on a GPCR. Journal of the American Chemical Society 131 (20): 6952-4). In context with the present invention EGFR antibodies are understood as any immunoglobulin specifically recognizing/binding to EGFR, preferably the extracellular portion.

(29) In the context of the present invention the anti-EGFR antibody may particularly be selected from the group of IgA-antibody, IgG-antibody and IgM-antibody, preferably an IgG antibody, e.g. IgG1, IgG2, IgG3 and IgG4.

(30) Herein, the sample of the subject to be diagnosed in which the level of anti-EGFR antibodies is to be determined is preferably a bodily fluid such as whole blood or lymph or fractions of blood such as serum or plasma. Preferably in the context of the present invention the sample is plasma or serum.

(31) Where appropriate, the sample may need to be homogenized, or extracted with a solvent prior to use in the present invention in order to obtain a liquid sample. A liquid sample hereby may be a solution or suspension. Liquid samples may be subjected to one or more pre-treatments prior to use in the present invention. Such pre-treatments include, but are not limited to dilution, filtration, centrifugation, concentration, sedimentation, precipitation, dialysis. Pre-treatments may also include the addition of chemical or biochemical substances to the solution, such as acids, bases, buffers, salts, solvents, reactive dyes, detergents, emulsifiers, chelators.

(32) The control levels as disclosed herein refer to control levels of anti EGF-receptor antibodies. It will be readily understood by the skilled person that the control levels from subjects having the desired disease or response as defined in the methods and to which the determined levels are compared to, are not necessarily determined in parallel but may be represented by previously determined levels. Nevertheless, control levels may be determined in parallel. The skilled person with the disclosure of the present invention and his knowledge is able to determine such levels, as will be outlined herein below. Hence, the control levels of the present invention may be previously defined thresholds. Preferred thresholds are disclosed herein.

(33) As outlined herein, the levels of EGFR antibodies in samples of the patient to be diagnosed and treated or to be treated are compared with the control groups as defined herein. However, in one embodiment the levels are compared to fixed values, i.e. thresholds under or over which a certain diagnosis, or prognosis of response is given. To this end, unit-standards may be applied. The present inventors set out such standard for the EGFR using serum samples from systemic sclerosis patients. Systemic sclerosis patients are known to have high levels of autoimmune antibodies in general. Hence, the inventors took a serum sample of a systemic sclerosis patient. However, it will be acknowledged by the skilled person that also other samples may be taken to set a different standard, e.g. samples of healthy subjects, samples of cancer patients. Nevertheless the principle of generating a standard (units) is the same in any case and are exemplified herein using serum samples of systemic sclerosis patients. In the context of the present invention units/ml, unless specified otherwise, refers to the concentration of antibodies standardised as exemplified herein. Hence, in one embodiment of the present invention 100 units/ml refers to a dilution of 1:800 of a serum sample of systemic sclerosis patients. The serum sample may be derived from a single patient or of a cohort of a plurality of patients, e.g. a cohort of 200 patients suffering from systemic sclerosis. The present inventors found that the concentration of EGFR antibodies in samples of systemic sclerosis do not differ by more than about 10%, showing such standard being reproducible. In one preferred embodiment the standard for the concentrations of the autoimmune antibodies is generated in the following way: a serum sample of a systemic sclerosis patient (or a larger cohort) is diluted (a) 1:400 for standard point 200 Units/ml, (b) 1:800 for standard point 100 Units/ml, (c) 1:1600 for standard point 50 Units/ml, (d) 1:3200 for standard point 25 Units/ml, (e) 1:6400 for standard point 12.5 Units/ml and (0 1:12800 for standard point 6.25 Units/ml. These standards are then used for the immunoassay chosen, e.g. ELISA, and then correlated with the respective read-out value, e.g. for ELISA optical density at 450nm/optical density at 620 nm. A typical standard curve of an EGFR auto-antibody ELISA is shown in FIG. 6. Nevertheless, the skilled person will readily understand that it may also be possible to standardize the levels of EGFR-autoantibodies using different samples, e.g. samples of healthy subjects or cancer patients.

(34) Equal level in the context of the present invention means that the levels differ by not more than10%, preferably by not more than5%, more preferably by not more than2%. Decreased or increased level in the context of the present invention mean that the levels differ by more than 10%, preferably by more than 15%, preferably more than 20%.

(35) Plasma in the context of the present invention is the virtually cell-free supernatant of blood containing anticoagulant obtained after centrifugation. Exemplary anticoagulants include calcium ion binding compounds such as EDTA or citrate and thrombin inhibitors such as heparinates or hirudin. Cell-free plasma can be obtained by centrifugation of the anticoagulated blood (e.g. citrated, EDTA or heparinized blood) for at least 15 minutes at 2000 to 3000 g.

(36) Serum is the liquid fraction of whole blood that is collected after the blood is allowed to clot. When coagulated blood (clotted blood) is centrifuged serum can be obtained as supernatant. It does not contain fibrinogen, although some clotting factors remain.

(37) In the method of the present invention, the anti-EGFR antibody is preferably detected in an immunoassay. Suitable immunoassays may be selected from the group of immunoprecipitation, enzyme immunoassay (EIA), enzyme-linked immunosorbenassys (ELISA), radioimmunoassay (RIA), fluorescent immunoassay, a chemiluminescent assay, an agglutination assay, nephelometric assay, turbidimetric assay, a Western Blot, a competitive immunoassay, a noncompetitive immunoassay, a homogeneous immunoassay a heterogeneous immunoassay, a bioassay and a reporter assay such as a luciferase assay or Luminex Assays. Preferably herein the immunoassay is an enzyme linked immunosorbent assay (ELISA).

(38) The immunoassays can be homogenous or heterogeneous assays, competitive and non-competitive assays. In a particularly preferred embodiment, the assay is in the form of a sandwich assay, which is a non-competitive immunoassay, wherein the anti-EGFR antibody (i.e. the analyte) to be detected and/or quantified is allowed to bind to an immobilized EGFR protein or immunogenic peptide fragment thereof and to a secondary antibody. The EGFR or fragment thereof (i.e. a peptide), may e.g., be bound to a solid phase, e.g. a bead, a surface of a well or other container, a chip or a strip, and the secondary antibody is an antibody which is labeled, e.g. with a dye, with a radioisotope, or a reactive or catalytically active moiety such as a peroxidase, e.g. horseradish peroxidase. The amount of labeled antibody bound to the analyte is then measured by an appropriate method. The general composition and procedures involved with sandwich assays are well-established and known to the skilled person (The Immunoassay Handbook, Ed. David Wild, Elsevier LTD, Oxford; 3rd ed. (May 2005), ISBN-13: 978-0080445267; Hultschig C et al., Curr Opin Chem Biol. 2006 February; 10(1): 4-10. PMID: 16376134, incorporated herein by reference). Sandwich immunoassays can for example be designed as one-step assays or as two-step assays.

(39) The detectable label may for example be based on fluorescence or chemiluminescence. The labelling system comprises rare earth cryptates or rare earth chelates in combination with a fluorescence dye or chemiluminescence dye, in particular a dye of the cyanine type. In the context of the present invention, fluorescence based assays comprise the use of dyes, which may for instance be selected from the group comprising FAM (5-or 6-carboxyfluorescein), VIC, NED, Fluorescein, Fluoresceinisothiocyanate (FITC), IRD-700/800, Cyanine dyes, such as CY3, CYS, CY3.5, CY5.5, Cy7, Xanthen, 6-Carboxy-2,4,7,4,7-hexachlorofluorescein (HEX), TET, 6-Carboxy-4,5-dichloro-2,7-dimethodyfluorescein (JOE), N,N,N,N-Tetramethyl-6-carboxyrhodamine (TAMRA), 6-Carboxy-X-rhodamine (ROX), 5-Carboxyrhodamine-6G (R6G5), 6-carboxyrhodamine-6G (RG6), Rhodamine, Rhodamine Green, Rhodamine Red, Rhodamine 110, BODIPY dyes, such as BODIPY TMR, Oregon Green, Coumarines such as Umbelliferone, Benzimides, such as Hoechst 33258; Phenanthridines, such as Texas Red, Yakima Yellow, Alexa Fluor, PET, Ethidiumbromide, Acridinium dyes, Carbazol dyes, Phenoxazine dyes, Porphyrine dyes, Polymethin dyes, and the like.

(40) In the context of the present invention, chemiluminescence based assays comprise the use of dyes, based on the physical principles described for chemiluminescent materials in Kirk-Othmer, Encyclopedia of chemical technology, 4.sup.th ed., executive editor, J. I. Kroschwitz; editor, M Howe-Grant, John Wiley & Sons, 1993, vol. 15, p. 518-562, incorporated herein by reference, including citations on pages 551-562. Preferred chemiluminescent dyes are acridiniumesters.

(41) The sensitivity of an assay relates to the proportion of actual positives which are correctly identified as such, i.e. the ability to identify positive results (true positives positive results/number of positives). Hence, the lower the concentrations of the analyte that can be detected with an assay, the more sensitive the immunoassay is. The specificity of an assay relates to the proportion of negatives which are correctly identified as such, i.e. the ability to identify negative results (true negatives/negative results). For an antibody the specificity is defined as the ability of an individual antigen binding site to react with only one antigenic epitope. The binding behaviour of an antibody can also be characterized in terms of its affinity and its avidity. The affinity of an antibody is a measure for the strength of the reaction between a single antigenic epitope and a single antigen binding site. The avidity of an antibody is a measure for the overall strength of binding between an antigen with many epitopes and multivalent antibodies.

(42) An immunogenic peptide or antigenic peptide as used herein is a portion of a EGFR protein that is recognized (i.e., specifically bound) by the anti-EGFR antibody. Such immunogenic peptides generally comprise at least 5 amino acid residues, more preferably at least 10, and still more preferably at least 20 amino acid residues of EGFR. However, they may also comprise at least 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or 150 amino acid residues. As outlined in Example 1, the antigen used in context with the examples was the membrane fraction of cells overexpressing EGFR. This means, that in a preferred embodiment of the present invention, the EGFR antibodies to be detected bind to the intra-or extra-cellular part of EGFR.

(43) For the purposes of the immunoassays and diagnostic methods of the invention EGFR by expression in cells, preferably eukaryotic cells or in cell free, preferably eukaryotic cell free systems. Hence, in the assays and methods of the invention EGFR may be present in its natural cellular environment and can be used together with the material associated with the receptor in its natural state as well as in isolated form. Suitable expression systems include Chinese hamster ovary (CHO) cells overexpressing the human EGFR. Hence, cell extracts (particularly extracts from CHO cells overexpressing the human EGFR) can be used to detect anti-EGFR antibodies. Based on the weight of the whole receptor in the preparation (e.g. the extract) to be used according to the invention, the isolated receptor should account for at least 0.5%, preferably at least 5% more preferably at least 25%, and in a particular preferred embodiment at least 50%. The receptor is preferably used in isolated form, i.e. essentially free of other proteins, lipids, carbohydrates or other substances naturally associated with the receptor. Essentially free of means that the receptor is at least 75%, preferably at least 85%, more preferably at least 95% and especially preferably at least 99% free of other proteins, lipids, carbohydrates or other substances naturally associated with the receptor.

(44) In particular, the method of the present invention comprises the steps of

(45) (a) contacting the sample with EGFR or an antigenic peptide fragment under conditions allowing for the formation of a complex between anti-EGFR antibodies with EGFR or the antigenic peptide fragment thereof,

(46) (b) detecting the complex.

(47) Hence, the invention relates to an immunoassay method for detecting a anti-EGFR antibody in a sample from a subject, comprising the steps of

(48) (a) contacting the sample suspected of comprising an anti-EGFR antibody with EGFR or an antigenic peptide fragment thereof under conditions allowing for the formation of a complex between the anti-EGFR antibody with EGFR or the antigenic peptide fragment thereof,
(b) detecting the complex.

(49) The EGFR or the antigenic peptide fragment thereof may preferably be immobilized on a surface. The complex may for example be detected using a secondary antibody against the Fc portion of the anti-EGFR antibody. When the anti-EGFR antibody is an IgG-antibody, the secondary antibody may be an anti-IgG antibody. In a particular embodiment, the subject is a human and

(50) (i) the anti-EGFR antibody is a IgG1-antibody and the secondary antibody is an anti-human-IgG1 antibody; or

(51) (ii) the anti-EGFR antibody is a IgG2-antibody and the secondary antibody is an anti-human-IgG2 antibody; or

(52) (iii) the anti-EGFR antibody is a IgG3-antibody and the secondary antibody is an anti-human-IgG3 antibody; or

(53) (iv) the anti-EGFR antibody is a IgG4-antibody and the secondary antibody is an anti-human-IgG4 antibody. The secondary antibody may for example be labeled with a detectable marker, e.g. a peroxidase.

(54) Furthermore, in the methods of the present invention further parameters of the subject may considered as well. Such parameters in a multivariate model may include gender, age, histological evaluation, Figo or histopathological staging, grading of the tumor and other markers. Dependent variables for determining survival may also be time till death, time till first relapse, time till death or first relapse (shorter interval if both events occurred). A Cox-Proportional-Hazard regression predicts the dependent variable based on one or more independent variables. These predictors can either be measures (as e.g. level of a biomarker) or categorical data (as e.g. response to a previous treatment). The skilled person is aware of the fact that diagnostic markers only give a certain degree of sensitivity and specificity, as also outlined herein. He knows that different further parameters might be considered in order to increase both. For example, when detecting levels of a marker indicative for an EGF or EGFR associated cancer, inter alia ovarian cancer, the skilled person would not diagnose ovarian cancer in a male human subject. Nevertheless, the present invention provides a new and superior marker for diagnosis, prognosis of cancer, particularly for ovarian cancer. In the context of the methods of the invention and particularly the immunoassays of the invention, the presence of one or more further diagnostic markers for ovarian cancer is detected in the sample. For example, in a diagnostic method of the present invention levels of CA125, Human Epidymis Protein 4 (HE4) and/or Mesothelin are detected in addition.

(55) The invention also relates to the use of EGFR or an antigenic peptide fragment thereof for the diagnosis of cancer, preferably for the diagnosis of an EGF or EGFR associated cancer, more preferably for the diagnosis of a cancer selected from the group consisting of ovarian cancer, lung cancer, renal cancer, colon cancer, and colorectal cancer, preferably ovarian cancer.

(56) In the context of the present invention, the levels of the anti-EGFR antibodies a may be analyzed in a number of fashions well known to a person skilled in the art. For example, each assay result obtained may be compared to a normal value, or a value indicating a particular disease or outcome. A particular diagnosis/prognosis may depend upon the comparison of each assay result to such a value, which may be referred to as a diagnostic or prognostic threshold. In certain embodiments, assays for one or more diagnostic or prognostic indicators are correlated to a condition or disease by merely the presence or absence of the indicator(s) in the assay. For example, an assay can be designed so that a positive signal only occurs above a particular threshold concentration of interest, and below which concentration the assay provides no signal above background.

(57) The sensitivity and specificity of a diagnostic and/or prognostic test depends on more than just the analytical quality of the test, they also depend on the definition of what constitutes an abnormal result. In practice, Receiver Operating Characteristic curves (ROC curves), are typically calculated by plotting the value of a variable versus its relative frequency in normal (i.e. apparently healthy individuals not having ovarian cancer) and disease populations. For any particular marker, a distribution of marker levels for subjects with and without a disease will likely overlap. Under such conditions, a test does not absolutely distinguish normal from disease with 100% accuracy, and the area of overlap indicates where the test cannot distinguish normal from disease. A threshold is selected, below which the test is considered to be abnormal and above which the test is considered to be normal. The area under the ROC curve is a measure of the probability that the perceived measurement will allow correct identification of a condition. ROC curves can be used even when test results don't necessarily give an accurate number. As long as one can rank results, one can create a ROC curve. For example, results of a test on disease samples might be ranked according to degree (e.g. 1=low, 2=normal, and 3=high). This ranking can be correlated to results in the normal population, and a ROC curve created. These methods are well known in the art. See, e.g., Hanley et al. 1982. Radiology 143: 29-36. Preferably, a threshold is selected to provide a ROC curve area of greater than about 0.5, more preferably greater than about 0.7, still more preferably greater than about 0.8, even more preferably greater than about 0.85, and most preferably greater than about 0.9. The term about in this context refers to+/5% of a given measurement.

(58) The horizontal axis of the ROC curve represents (1-specificity), which increases with the rate of false positives. The vertical axis of the curve represents sensitivity, which increases with the rate of true positives. Thus, for a particular cut-off selected, the value of (1-specificity) may be determined, and a corresponding sensitivity may be obtained. The area under the ROC curve is a measure of the probability that the measured marker level will allow correct identification of a disease or condition. Thus, the area under the ROC curve can be used to determine the effectiveness of the test.

(59) In other embodiments, a positive likelihood ratio, negative likelihood ratio, odds ratio, or hazard ratio is used as a measure of a test's ability to predict risk or diagnose a disease. In the case of a positive likelihood ratio, a value of 1 indicates that a positive result is equally likely among subjects in both the diseased and control groups; a value greater than 1 indicates that a positive result is more likely in the diseased group; and a value less than 1 indicates that a positive result is more likely in the control group. In the case of a negative likelihood ratio, a value of 1 indicates that a negative result is equally likely among subjects in both the diseased and control groups; a value greater than 1 indicates that a negative result is more likely in the test group; and a value less than 1 indicates that a negative result is more likely in the control group.

(60) In the case of an odds ratio, a value of 1 indicates that a positive result is equally likely among subjects in both the diseased and control groups; a value greater than 1 indicates that a positive result is more likely in the diseased group; and a value less than 1 indicates that a positive result is more likely in the control group.

(61) In the case of a hazard ratio, a value of 1 indicates that the relative risk of an endpoint (e.g., death) is equal in both the diseased and control groups; a value greater than 1 indicates that the risk is greater in the diseased group; and a value less than 1 indicates that the risk is greater in the control group.

(62) The skilled artisan will understand that associating a diagnostic or prognostic indicator, with a diagnosis or with a prognostic risk of a future clinical outcome is a statistical analysis. For example, a marker level of lower than X may signal that a patient is more likely to suffer from an adverse outcome than patients with a level more than or equal to X, as determined by a level of statistical significance. Additionally, a change in marker concentration from baseline levels may be reflective of patient prognosis, and the degree of change in marker level may be related to the severity of adverse events. Statistical significance is often determined by comparing two or more populations, and determining a confidence interval and/or a p value. See, e.g., Dowdy and Wearden, Statistics for Research, John Wiley & Sons, New York, 1983. Preferred confidence intervals of the invention are 90%, 95%, 97.5%, 98%, 99%, 99.5%, 99.9% and 99.99%, while preferred p values are 0.1, 0.05, 0.025, 0.02, 0.01, 0.005, 0.001, and 0.0001.

(63) Suitable threshold levels for the stratification of subjects into different groups (categories) have to be determined for each particular combination of EGFR-antibodies, disease and/or medication. This can e.g. be done by grouping a reference population of patients according to their level of EGFR-antibodies into certain quantiles, e.g. quartiles, quintiles or even according to suitable percentiles. For each of the quantiles or groups above and below certain percentiles, hazard ratios can be calculated comparing the risk for an adverse outcome, i.e. an cancer or a non response, e.g. in terms of survival rate/mortality, between those patients who have received a certain medication and those who did not, or in terms of presence and absence of cancer in patients. In such a scenario, a hazard ratio (HR) above 1 indicates a higher risk for an adverse outcome for the patients who have received a treatment than for patients who did not. A HR below 1 indicates beneficial effects of a certain treatment in the group of patients. A HR around 1 (e.g.+/0.1) indicates no elevated risk but also no benefit from medication for the particular group of patients. By comparison of the HR between certain quantiles of patients with each other and with the HR of the overall population of patients, it is possible to identify those quantiles of patients who have an elevated risk and those who benefit from medication and thereby stratify subjects according to the present invention.

(64) In some cases presence of cancer, relapse and/or mortality upon treatment with an angiogenesis inhibitor will affect patients with high levels (e.g. in the fifth quintile) of EGFR-antibodies, while in other cases only patients with low levels of EGFR-antibodies will be affected (e.g. in the first quintile). However, with the above explanations, a skilled person is able to identify those groups of patients having cancer, those groups that do respond to a medication and those groups that do not respond to the medication. Exemplarily, some combinations of hormones and medications are listed for several diseases in the appended examples. In another embodiment of the invention, the diagnosis, risk for relapse of cancer and/or mortality and/or outcome for a patient are determined by relating the patient's individual level of marker peptide to certain percentiles (e.g. 97.5.sup.th percentile) of a healthy population.

(65) Kaplan-Meier estimators may be used for the assessment or prediction of the outcome or risk (e.g. diagnosis, relapse, progression or morbidity) of a patient.

(66) The invention also pertains to a research and/or diagnostic kit for the diagnosis of cancer, e.g. ovarian cancer, or for the prediction of risk stratification for relapse of cancer and/or mortality in a patient, wherein the kit comprises EGFR or an antigenic peptide fragment thereof. The kit may further comprise an antibody directed to the Fc portion of the anti-EGFRantibody to be detected, i.e. an anti-human IgG antibody.

(67) Such kits can comprise a carrier, package or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements to be used in the method. The kit of the invention will typically comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes, and package inserts with instructions for use. In addition, a label can be provided on the container to indicate that the composition is used for a specific therapeutic or non-therapeutic application, and can also indicate directions for either in vivo or in vitro use, such as those described herein. Directions and or other information can also be included on an insert which is included with the kit.

(68) The term drug in connection with the present invention is to be understood as any substance, pharmaceutical composition or the like which are intended for the treatment of cancer, preferably an EGF or EGFR associated cancer as outlined herein, particularly preferred ovarian cancer. Different drugs are known. Preferred drugs are inhibitors of EGFR activity, e.g. those blocking EGF binding to EGFR or agents inhibiting the kinase activity of the EGF-receptor. The inventors found response of patients suffering from cancer to a drug inhibiting EGFR, e.g. panitumumab, may be predicted by determining the levels of anti-EGFR antibodies in samples from a patient to be treated. Panitumumab (INN), formerly ABX-EGF, is a fully human monoclonal antibody specific to the epidermal growth factor receptor. Panitumumab is manufactured by Amgen and marketed as Vectibix. It was originally developed by Abgenix Inc. Panitumumab works by binding to the extracellular domain of the EGFR preventing its activation. This results in halting of the cascade of intracellular signals dependent on this receptor (Plunkett, Jack W. (Sep. 30, 2005). Plunkett's Biotech & Genetics Industry Almanac 2006. Plunkett Research, Ltd. ISBN 1-59392-033-4). In a preferred embodiment the drug used for the treatment of cancer are drugs directed against EGFR, e.g. antibodies binding EGFR, preferably at the extracellular part, and inhibitors of EGFR acitivity. Such inhibitors are known and include panitumumab, cetuximab, zalutumumab, nimotuzumab, matuzumab, gefitinib, erlotinib, lapatinib, vandetanib, and trastuzumab, which are preferred drugs in connection with the present invention, particularly preferred is panitumumab.

(69) The drug is preferably a drug as defined herein. In a preferred embodiment the drug used for the treatment of cancer is an inhibitor of EGFR activity. A representative member has been tested and its predictive and prognostic value has been confirmed in the examples provided herewith. Hence, the invention also relates to a method for determining whether a subject being treated or to be treated for cancer with an inhibitor of EGFR activity will respond to said treatment comprising the steps of (i) determining the level of antibodies against EGFR in a sample from said subject being treated or to be treated; and (ii) comparing the determined level in the sample to either one or both of a first and second EGFR antibody control level, a) wherein the first EGFR antibody control level is derived from subjects responding to said treatment, and b) wherein the second EGFR antibody control level is derived from subjects not responding to said treatment, wherein a decreased level in the sample from the subject being treated or to be treated as compared to the first EGFR antibody control level and/or an equal level as compared to the second EGFR antibody control level is indicative for a non-response of said subject to said treatment, and wherein an increased level in the sample from the subject being treated or to be treated as compared to the second EGFR antibody control level and/or an equal level as compared to the first EGFR antibody control level is indicative for a response of said subject to said treatment. In one embodiment of the method for determining whether a subject being treated or to be treated for cancer with an inhibitor of EGFR activity will respond to said treatment, a level of antibodies against EGFR in the sample from the subject to be treated of less than 0.9 fold as compared to the first EGFR antibody control level is indicative for a non-response of said subject to said treatment with an inhibitor of EGFR activity, preferably a level of antibodies against EGFR in the sample from the subject to be treated of less than 0.6 fold as compared to the first EGFR antibody control level is indicative for a non-response of said subject to said treatment with an inhibitor of EGFR activity, further preferred a level of antibodies against EGFR in the sample from the subject to be treated of less than 0.5 fold as compared to the first anti-EGFR control level is indicative for a non-response of said subject to said treatment with an inhibitor of

(70) EGFR activity; yet further preferred a level of antibodies against EGFR in the sample from the subject to be treated of less than 0.25 fold as compared to the first anti-EGFR control level is indicative for a non-response of said subject to said treatment with an inhibitor of EGFR activity. Likewise, ratios may be determined for the response. In such embodiment a level of antibodies against EGFR in the sample from the subject to be treated of more than 1.1 fold as compared to the second EGFR antibody control level is indicative for a response of said subject to said treatment with an inhibitor of EGFR activity, preferably a level of antibodies against EGFR in the sample from the subject to be treated of more than 1.5 fold as compared to the second EGFR antibody control level is indicative for a response of said subject to said treatment with an inhibitor of EGFR activity, further preferred a level of antibodies against EGFR in the sample from the subject to be treated of more than 2 fold as compared to the second anti-EGFR control level is indicative for a response of said subject to said treatment with an inhibitor of EGFR activity; yet further preferred a level of antibodies against EGFR in the sample from the subject to be treated of more than 4.0 or even 4.5 fold as compared to the second anti-EGFR control level is indicative for a response of said subject to said treatment with an inhibitor of EGFR activity. Preferred inhibitors of EGFR activity are disclosed herein. One particular preferred inhibitor of EGFR activity is panitumumab. Preferably, the subject is to be treated.

(71) Also encompassed by the invention is a method of treating ovarian cancer in a subject, comprising determining the level of antibodies against EGFR in a sample from the subject, wherein when the level of anti-EGFR antibodies in a sample from the subject is above10.0 units/ml, a drug as defined herein is administered to the subject; preferably above 20 units/ml, more preferred above 30 units/ml, further preferred above 40 units/ml. In a particular embodiment the patient is treated at levels of EGFR antibodies above 34 units/ml.

(72) The invention, thus, also relates a drug for use in the treatment of cancer in a subject, wherein the drug is administered to the subject when the level anti-EGFR antibodies in a sample from the subject is above10.0 units/ml, preferably above 20 units/ml, more preferred above 30 units/ml, further preferred above 40 units/ml. In a particular embodiment the the drug is administered when the level of anti-EGFR antibodies above 34 units/ml. . In a preferred embodiment the drug is for use in the treatment of an EGFR associated cancer, preferably selected from the group consisting of ovarian cancer, colorectal cancer, colon lung cancer, breast cancer, glioblastoma, and kidney (renal) renal . The drug is preferably selected from the group consisting of panitumumab, cetuximab, zalutumumab, nimotuzumab, matuzumab, gefitinib, erlotinib, lapatinib, vandetanib, and trastuzumab. In a further preferred embodiment the drug is EGFR inhibitor, preferably panitumumab. The invention, thus, also relates to panitumumab for use in the treatment of ovarian cancer in a subject, wherein panitumumab is administered to the subject when the level anti-EGFR antibodies in a sample from the subject is above10.0 units/ml, preferably above 20 units/ml, more preferred above 30 units/ml, further preferred above 40 units/ml. In a particular embodiment the the drug is administered when the level of anti-EGFR antibodies above 34 units/ml.

(73) The invention furthermore relates to a kit for diagnosing cancer as outlined above, or predicting the response of a cancer patient to the treatment for cancer, said kit comprising EGFR or an antigenic peptide thereof, and means to detect antibodies binding to said EGFR or peptide thereof. Preferably the kit is designed for a method of the present invention. It will be understood that the embodiments disclosed herein above for EGFR or an antigenic peptide thereof as set out herein above also apply to the kit. The kit is designed to detect autoimmune antibodies in samples of subject and hence comprises means to detect such antibodies, particularly antibodies binding to said EGFR or peptide thereof. Such means are outlined herein above, e.g. for immunoassays. The embodiments set out for the immunoassays apply also to the kit of the invention. The kits of the present invention are meant for the detection of autoimmune antibodies. Hence, in one embodiment they comprise means for the preparation of blood, e.g. for gaining serum thereof. Furthermore, the kit may comprise control composition and/or standards. The control composition preferably comprises a EGFR antibodies as positive control. Furthermore, the kit may comprise one or a plurality of standard compositions. A standard composition comprises EGFR antibodies at a defined concentration. As outlined herein, determination of concentration of autoimmune-antibodies may be performed using standard curves. These curves set out which concentration of antibodies in a sample or solution corresponds to what read-out value of the assay used, e.g. optical density or proportion of optical density at different wavelengths (e.g. 450 nm/620 nm). To this end the kits of the present invention may comprise one or more standard compositions having a defined concentration of EGFR antibodies, preferably of the kind to be detected in the method. A standard composition of the kits according to the present invention comprise EGFR antibodies at concentrations selected from the group consisting of 200 units/ml, 100 units/ml, 50 units/ml, 25 units/ml, 12.5 units/ml, and 6.25 units/ml. In one embodiment the kit comprises six standard compositions with the recited concentration. In another embodiment the kit comprises one standard composition with the highest concentration of the standard curve, e.g. 200 units/ml or 100 units/ml. The other concentrations may be produced at the side of the end user by further dilutions, e.g. in PBS. A dilution buffer may therefore also be comprised in the kits according to the invention.

(74) It will be readily understood that the embodiments outlined above shall apply to the invention as a whole and not be limited to a specific method, unless stated otherwise. It will for example be understood the embodiments for the type of cancer shall be applied to every method, kit or the like disclosed herein. The invention is further illustrated by the following non-limiting examples and figures.

(75) Sequences

(76) TABLE-US-00002 SEQIDNO:1: AminoacidsequenceofthehumanEGF-receptor[SEQIDNO:1]: 1 MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLS 51 LQRMENNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIP 101 LENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRF 151 SNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCW 201 GAGEENCQKLTKIICAQQCSGRCRCKSPSDCCHNQCAACCTGPRESDCLV 251 CRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV 301 VTDHGSCVRACGADSYEMEEDGVRKCKKCECPCRKVCNCTGIGEFKDSLS 351 INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE 401 ITGELLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGL 451 RSLKEISDGDVIISCNKNLCYANTINWKKLFCTSGQKTKIISNRGENSCK 501 ATGQVCHALCSPECCWOPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFV 551 ENSECIQCHPECLPQAMNITCTGRGPDNCIQCARYIDGPECVKTCPAGVM 601 GENNTLVWKYADAGEVCHLCHPNCTYGCTGPGLECCPTNOPKIPSIATGM 651 VGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPN 701 QALLRILKETEFKKIKVLGSOAFGTVYKCLWIPEGEKVKIPVAIKELREA 751 TSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLD 801 YVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQH 851 VKITDFCLAKLLGAEEKEYHAEGCKVPIKWMALESILHRIYTHQSDVWSY 901 GVTVWELMTFGSKPYDOIPASEISSILEKGERLPQPPICTIDVYMIMVKC 951 WMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRA 1001 LMDEEDMDDVVDADEYLIPQQGTESSPSTSRTPLLSSLSATSNNSTVACI 1051 DRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKR 1101 PAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNST 1151 FDSPAHWAQKCSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV 1201 APQSSEFIGA

EXAMPLES

Example 1

(77) We measured the anti-EGFR autoantibody in serum samples using a sandwich ELISA kit (CellTrend GmbH Luckenwalde, Germany). The microtiter 96-well polystyrene plates were coated with membrane extracts of a cancer cell line A431 human EGFR of SEQ ID NO:1. To maintain the conformational epitopes of the receptor, 1 mM calcium chloride was added to every buffer. Duplicate samples of a 1:100 serum dilution were incubated at 4 C. for 2 hours. After washing steps, plates were incubated for 60 minutes with a 1:20.000 dilution of horseradish-peroxidaselabeled goat anti-human IgG (Jackson, USA) used for detection. In order to obtain a standard curve, plates were incubated with test sera from an anti-EGFR autoantibody positive index patient. The ELISA was validated according to the FDA's Guidance for industry: Bioanalytical method validation.

(78) To set a standard for the concentrations of the autoimmuno antibodies, a standard curve was generated In detail, a serum sample of a systemic sclerosis patient was diluted (a) 1:400 for standard point 200 Units/ml, (b) 1:800 for standard point 100 Units/ml, (c) 1:1600 for standard point 50 Units/ml, (d) 1:3200 for standard point 25 Units/ml, (e) 1:6400 for standard point 12.5 Units/ml and (0 1:12800 for standard point 6.25 Units/ml. Then the optical density was determined using the kit and method as set out above. Each standard point was performed in duplicates. A typical standard curve of an EGFR auto-antibody ELISA is shown in FIG. 6.

Example 2:

(79) Anti-EGFR antibody levels in serum samples from 131 healthy donors (control) and 201 patients with ovarian cancer (case) were measured using the kit and method of Example 1. The levels were determined in units/mL. FIG. 1 shows the mean values of the natural logarithm of the EGFR antibody level for case and control subjects. Patient suffering from ovarian cancer had significantly lower levels (p0.0001) of anti-EGFR antibodies as compared to healthy controls.

Example 3

(80) Levels of the EGFR-antibody were compared in patients showing relapse of ovarian cancer after therapy and patients showing no relapse. Treatment was surgical removal of the tumor and subsequent chemotherapy with cis platinum or carboplatinum conducted and monitored by physicians. Samples of patients were taken before treatment. Patients were categorized as relapse or no relapse according to the reoccurrence of cancer after a period of 24 months. Levels of EGFR-antibody were determined as outlined in Example 1. EGFR-AA levels are significantly higher in patients who had no relapse, compared to patients who had a relapse (p=0.0044). The determined levels were also compared to the control group of healthy subjects. These results are shown in FIG. 2.

Example 4

(81) Serum samples of ovarian cancer patients were taken before surgical removal of the tumor and subsequent chemotherapy with cis platinum or carboplatin. The treatment was conducted and monitored by physicians. The patients were categorized into survivors (survival) and patients who died after treatment (death). The levels of anti-EGFR antibodies were determined as outlined in Example 1. The results are shown in FIG. 3. Levels of anti-EGFR antibodies were lower in patients of the death group (mean ln of unit/ml=3.172) compared to the survival group (mean ln of unit/ml=3.355), the different was significant (p=0.038).

Example 5

(82) The sensitivity and specificity for levels of anti-EGFR antibodies as predictor of relapse and/or mortality was calculated using ROC-anlayis. The results for the prediction of relapse are given in FIG. 4A, for the prediction of mortality in FIG. 4B, and for the combined endpoint prediction (relapse or death) in FIG. 4C. The results show that the levels of anti-EGFR antibodies are a good predictor for relapse or mortality after treatment of cancer patients as endpoint prediction. The specificity and sensitivity of the prediction could be further enhanced when including further factors in a multivariate model. These factors were age, Figo and histology staging. The p-value for mortality or the combined end-point (mortality or relapse) was p<0.001 and p<0.011, respectively in the Cox-proportional hazard. For relapse as the single endpoint we observed a significant value. The p-value was 0.01.

Example 6

(83) Panitumumab is a humanized monoclonal antibody that is an EGFR inhibitor. Levels of autoantibodies directed against EGFR were measured in patients suffering from ovarian cancer as outlined in Example 1 in samples taken before Panitumumab treatment. The patients were categorized into relapse yes and no, indicating whether they survived after the treatment or not. Results are given in FIG. 5. Patients of the yes group showed a significant lower level of anti EGFR antibodies in samples as compared to patients of the no group. This clearly shows that levels of anti EGFR antibodies are a good predictor for the response after treatment of cancer with an EGFR inhibitor.

SUMMARY

(84) The results of the present Examples show that anti-EGFR antibody levels are significant lower in patients with ovarian cancer compared to healthy controls. Furthermore, the levels are significantly higher in patients in which show no relapse after treatment with chemotherapeutic agents or an inhibitor of EGFR activity. Levels of anti-EGFR antibody in patients suffering from an ovarian cancer with serous histopathology are higher compared to samples from patients suffering from ovarian cancer with non-serous histopathology. Levels of anti-EGFR antibodies in samples are a well suited predictor for the response to the treatment with an angiogenesis inhibitor. Relapse of cancer or mortality of the patient as endpoints of the treatment can be predicted with a high degree of specificity and sensitivity.