ANTI-MESOTHELIN POLYPEPTIDES AND PROTEINS
20200247901 ยท 2020-08-06
Assignee
Inventors
- Ira H. Pastan (Chevy Chase, MD, US)
- Masanori Onda (Germantown, MD, US)
- Tapan Bera (Frederick, MD, US)
- Mitchell Ho (Urbana, MD)
Cpc classification
A61K39/395
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
A61K47/6829
HUMAN NECESSITIES
C12N15/63
CHEMISTRY; METALLURGY
International classification
A61P35/00
HUMAN NECESSITIES
Abstract
Polypeptides and proteins that specifically bind to and immunologically recognize human mesothelin582-598 (IP-NGYLVLDLSMQEALS) (SEQ ID NO: 1) are disclosed. Anti-mesothelin binding moieties, nucleic acids, recombinant expression vectors, host cells, populations of cells, pharmaceutical compositions, and conjugates relating to the polypeptides and proteins are disclosed. Methods of reducing mesothelin shed from cell membranes, methods of reducing the activity of TNF converting enzyme, methods of detecting the presence of cancer, and methods of treating or preventing cancer are also disclosed.
Claims
1. A polypeptide or protein which specifically recognizes and binds to human mesothelin.sub.582-598(IPNGYLVLDLSMQEALS) (SEQ ID NO: 1).
2. The polypeptide of claim 1 comprising (i) SEQ ID NOs: 2-7, (ii) SEQ ID NOs: 8-13, or (iii) SEQ ID NOs: 14-19.
3. The polypeptide of claim 1 comprising (i) SEQ ID NOs: 20 and 21, (ii) SEQ ID NOs: 22 and 23, or (iii) SEQ ID NOs: 24 and 25.
4. A protein comprising: (a) a first polypeptide chain comprising SEQ ID NOs: 2-4 and a second polypeptide chain comprising SEQ ID NOs: 5-7; (b) a first polypeptide chain comprising SEQ ID NOs: 8-10 and a second polypeptide chain comprising SEQ ID NOs: 11-13; or (c) a first polypeptide chain comprising SEQ ID NOs: 14-16 and a second polypeptide chain comprising SEQ ID NOs: 17-19.
5. The protein of claim 4 comprising (a) a first polypeptide chain comprising SEQ ID NO: 20 and a second polypeptide chain comprising SEQ ID NO: 21; (b) a first polypeptide chain comprising SEQ ID NO: 22 and a second polypeptide chain comprising SEQ ID NO: 23; or (c) a first polypeptide chain comprising SEQ ID NO: 24 and a second polypeptide chain comprising SEQ ID NO: 25.
6. An anti-mesothelin binding moiety comprising the polypeptide of claim 1, wherein the anti-mesothelin binding moiety is an antibody, Fab fragment (Fab), F(ab)2 fragment, diabody, triabody, tetrabody, bispecific antibody, single-chain variable region fragment (scFv), or disulfide-stabilized variable region fragment (dsFv).
7. A conjugate comprising (a) the polypeptide of claim 1 conjugated or fused to (b) an effector molecule, wherein the effector molecule is a drug, toxin, label, small molecule, or an antibody.
8. The conjugate according to claim 7, wherein the effector molecule is Pseudomonas exotoxin A (PE) or a variant thereof.
9. A nucleic acid comprising a nucleotide sequence encoding the polypeptide of claim 1.
10. The nucleic acid according to claim 9, comprising a nucleotide sequence comprising (i) SEQ ID NOs: 26 and 27, (ii) SEQ ID NOs: 28 and 29, or (iii) SEQ ID NOs: 30 and 31.
11. A recombinant expression vector comprising the nucleic acid of claim 9.
12. An isolated host cell comprising the recombinant expression vector of claim 11.
13. A population of cells comprising at least one host cell of claim 12.
14. A pharmaceutical composition comprising the polypeptide of claim 1 and a pharmaceutically acceptable carrier.
15. A kit for treating or preventing cancer, the kit comprising the polypeptide of claim 1.
16. A method of reducing mesothelin shed from cell membranes, the method comprising administering to the cells the polypeptide of claim 1 in an amount effective to reduce mesothelin shed from the cell membranes of the cells.
17. A method of reducing activity of TNF converting enzyme in a mammal, the method comprising administering the polypeptide of claim 1 to the mammal in an amount effective to reduce the activity of TNF converting enzyme in the mammal.
18. A method of detecting the presence of cancer in a mammal, the method comprising: (a) contacting a sample comprising one or more cells from the mammal with the polypeptide of claim 1, thereby forming a complex, and (b) detecting the complex, wherein detection of the complex is indicative of the presence of cancer.
19. A method of treating or preventing cancer in a mammal, the method comprising administering to the mammal the polypeptide of claim 1 in an amount effective to treat or prevent cancer in the mammal.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION OF THE INVENTION
[0029] An embodiment of the invention provides polypeptides and proteins comprising an antigen binding domain of an anti-mesothelin antibody. The polypeptides and proteins advantageously specifically recognize and bind to a specific region of human mesothelin (mesothelin.sub.582-598(IPNGYLVLDLSMQEALS) (SEQ ID NO: 1)) or any portion thereof with high affinity, provided that the portion of human mesothelins.sub.582-598 is at least 5 (e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16) amino acid residues in length. An embodiment of the invention provides polypeptides and proteins which advantageously specifically recognize and bind to human mesothelin (mesothelin.sub.582-598(IPNGYLVLDLSMQEALS) (SEQ ID NO: 1)) or any portion thereof with high affinity, provided that the human mesothelin.sub.582-598 sequence or portion thereof is 5-17, 6-17, 7-17, 8-17, 9-17, 10-17, 11-17, 12-17, 13-17, 14-17, 15-17, 16-17, 5-16, 6-16, 7-16, 8-16, 9-16, 10-16, 11-16, 12-16, 13-16, 14-16, 15-16, 5-15, 6-15, 7-15, 8-15, 9-15, 10-15, 11-15, 12-15, 13-15, 14-15, 5-14, 6-14, 7-14, 8-14, 9-14, 10-14, 11-14, 12-14, 13-14, 5-13, 6-13, 7-13, 8-13, 9-13, 10-13, 11-13, 12-13, 5-12, 6-12, 7-12, 8-12, 9-12, 10-12, 11-12, 5-11, 6-11, 7-11, 8-11, 9-11, 10-11, 5-10, 6-10, 7-10, 8-10, 9-10, 5-9, 6-9, 7-9, 8-9, 5-8, 6-8, 7-8, 5-7, 6-7, or 5-6 amino acids in length. In an embodiment, the portion of human mesothelin.sub.582-598 comprises LVLDL (SEQ ID NO: 63).
[0030] Mesothelin (SEQ ID NO: 56) is expressed by normal, non-tumor, or non-cancerous mesothelial cells lining the pleura, peritoneum, and pericardium and is over-expressed by tumor or cancer cells from a variety of different cancers such as, e.g., ovarian cancer, pancreatic cancer, lung cancer (e.g., lung adenocarcinoma), esophageal cancer, gastric cancer, synovial sarcoma, and mesothelioma. The expression of mesothelin by normal, non-tumor, or non-cancerous cells is not as robust as the expression by tumor or cancer cells. In this regard, the tumor or cancer cells can over-express mesothelin or express mesothelin at a significantly higher level, as compared to the expression of mesothelin by normal, non-tumor, or non-cancerous cells.
[0031] Mesothelin is constantly shed from cells by TNF converting enzyme (TACE; also referred to as ADAM17) leaving behind only a short protein fragment on the cell surface. There are two TACE cleavage sites in mesothelin which are five amino acid residues apart. TACE may cleave mesothelin at either of the two cleavage sites. The first TACE cleavage site is positioned between amino acid residues 586 and 587. Cleavage at the first TACE cleavage site yields a portion of mesothelin having the terminal sequence of 566-QRQDDLDTLGLGLQGGIPNGY-586 (SEQ ID NO: 57) that is released from the cell and a portion of mesothelin left associated with the cell surface which has the terminal sequence of 587-LVLDLSMQEALS-598 (SEQ ID NO: 58). The second TACE cleavage site is positioned between amino acid residues 591 and 592. Cleavage at the second TACE cleavage site yields a portion of mesothelin having the terminal sequence of 566-QRQDDLDTLGLGLQGGIPNGYLVLDL-591 (SEQ ID NO: 59) that is released from the cell and a portion of mesothelin left associated with the cell surface which has the terminal sequence of 592-SMQEALS-598 (SEQ ID NO: 60). Antibodies that bind to the shed portions of mesothelin may be rapidly released from the cell and may lose their effector function.
[0032] In an embodiment of the invention, the inventive polypeptides and proteins may elicit an antigen-specific response against mesothelin.sub.582-598 (IPNGYLVLDLSMQEALS) (SEQ ID NO: 1). Accordingly, without being bound to a particular theory or mechanism, it is believed that by specifically recognizing and binding mesothelin.sub.582-598 (IPNGYLVLDLSMQEALS) (SEQ ID NO: 1), the inventive proteins and polypeptides may provide for one or more of the following: detecting mesothelin-expressing cancer cells, targeting and destroying mesothelin-expressing cancer cells, reducing or eliminating cancer cells, facilitating infiltration of immune cells and/or effector molecules to tumor site(s), enhancing/extending anti-cancer responses, reducing or preventing the shedding of mesothelin from cells, and reducing or preventing the activity of TACE. By recognizing and binding to mesothelin.sub.582-598 (IPNGYLVLDLSMQEALS) (SEQ ID NO: 1), the inventive polypeptides and proteins may remain associated with the cancer cell for longer periods of time and may be more effective in killing cancer cells as compared to, for example, those antibodies which bind to the portion of mesothelin which is shed from the cell and which bind at a position that is more distal from the TACE cleavage sites than mesothelin.sub.582-598 (IPNGYLVLDLSMQEALS) (SEQ ID NO: 1).
[0033] An embodiment of the invention provides a polypeptide which specifically recognizes and binds to human mesothelin.sub.582-598 (IPNGYLVLDLSMQEALS) (SEQ ID NO: 1). The term polypeptide as used herein includes oligopeptides and refers to a single chain of amino acids connected by one or more peptide bonds. The polypeptide may comprise one or more variable regions (e.g., two variable regions) of an antigen binding domain of an anti-mesothelin antibody, each variable region comprising a complementarity determining region (CDR) 1, a CDR2, and a CDR3. The polypeptide can comprise the CDRs (i) SEQ ID NOs: 2-7, (ii) SEQ ID NOs: 8-13, or (iii) SEQ ID NOs: 14-19.
[0034] An embodiment of the invention provides a polypeptide comprising the CDR regions of the 2B4 anti-mesothelin antibody. In this regard, the polypeptide may comprise a first variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 2 (CDR1 of first variable region), a CDR2 comprising the amino acid sequence of SEQ ID NO: 3 (CDR2 of first variable region), and a CDR3 comprising the amino acid sequence of SEQ ID NO: 4 (CDR3 of first variable region), and a second variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 5 (CDR1 of second variable region), a CDR2 comprising the amino acid sequence of SEQ ID NO: 6 (CDR2 of second variable region), and a CDR3 comprising the amino acid sequence of SEQ ID NO: 7 (CDR3 of second variable region). In this regard, the inventive polypeptide can comprise (i) all of SEQ ID NOs: 2-4, (ii) all of SEQ ID NOs: 5-7, or (iii) all of SEQ ID NOs: 2-7. Preferably, the polypeptide comprises all of SEQ ID NOs: 2-7.
[0035] In an embodiment of the invention, the polypeptide comprising the CDR regions of the 2B4 anti-mesothelin antibody further comprises the framework regions of the 2B4 anti-mesothelin antibody. In this regard, the polypeptide comprising the CDR regions of the 2B4 anti-mesothelin antibody further comprises the amino acid sequence of SEQ ID NO: 32 (framework region (FR) 1 of first variable region), the amino acid sequence of SEQ ID NO: 33 (FR2 of first variable region), the amino acid sequence of SEQ ID NO: 34 (FR3 of first variable region), the amino acid sequence of SEQ ID NO: 35 (FR4 of first variable region), the amino acid sequence of SEQ ID NO: 36 (FR1 of second variable region), the amino acid sequence of SEQ ID NO: 37 (FR2 of second variable region), the amino acid sequence of SEQ ID NO: 38 (FR3 of second variable region), and the amino acid sequence of SEQ ID NO: 39 (FR4 of second variable region). In this regard, the inventive polypeptide can comprise (i) all of SEQ ID NOs: 2-4 and 32-35, (ii) all of SEQ ID NOs: 5-7 and 36-39; or (iii) all of SEQ ID NOs: 2-7 and 32-39.
[0036] An embodiment of the invention provides a polypeptide comprising the CDR regions of the 7B5 anti-mesothelin antibody. In this regard, the polypeptide may comprise a first variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 8 (CDR1 of first variable region), a CDR2 comprising the amino acid sequence of SEQ ID NO: 9 (CDR2 of first variable region), and a CDR3 comprising the amino acid sequence of SEQ ID NO: 10 (CDR3 of first variable region), and a second variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 11 (CDR1 of second variable region), a CDR2 comprising the amino acid sequence of SEQ ID NO: 12 (CDR2 of second variable region), and a CDR3 comprising the amino acid sequence of SEQ ID NO: 13 (CDR3 of second variable region). In this regard, the inventive polypeptide can comprise (i) all of SEQ ID NOs: 8-10, (ii) all of SEQ ID NOs: 11-13, or (iii) all of SEQ ID NOs: 8-13. Preferably, the polypeptide comprises all of SEQ ID NOs: 8-13.
[0037] In an embodiment of the invention, the polypeptide comprising the CDR regions of the 7B5 anti-mesothelin antibody further comprises the framework regions of the 7B5 anti-mesothelin antibody. In this regard, the polypeptide comprising the CDR regions of the 7B5 anti-mesothelin antibody further comprises the amino acid sequence of SEQ ID NO: 40 (FR1 of first variable region), the amino acid sequence of SEQ ID NO: 41 (FR2 of first variable region), the amino acid sequence of SEQ ID NO: 42 (FR3 of first variable region), the amino acid sequence of SEQ ID NO: 43 (FR4 of first variable region), the amino acid sequence of SEQ ID NO: 44 (FR1 of second variable region), the amino acid sequence of SEQ ID NO: 45 (FR2 of second variable region), the amino acid sequence of SEQ ID NO: 46 (FR3 of second variable region), and the amino acid sequence of SEQ ID NO: 47 (FR4 of second variable region). In this regard, the inventive polypeptide can comprise (i) all of SEQ ID NOs: 8-10 and 40-43, (ii) all of SEQ ID NOs: 11-13 and 44-47; or (iii) all of SEQ ID NOs: 8-13 and 40-47.
[0038] An embodiment of the invention provides a polypeptide comprising the CDR regions of the 15B6 anti-mesothelin antibody. In this regard, the polypeptide may comprise a first variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 14 (CDR1 of first variable region), a CDR2 comprising the amino acid sequence of SEQ ID NO: 15 (CDR2 of first variable region), and a CDR3 comprising the amino acid sequence of SEQ ID NO: 16 (CDR3 of first variable region), and a second variable region comprising a CDR1 comprising the amino acid sequence of SEQ ID NO: 17 (CDR1 of second variable region), a CDR2 comprising the amino acid sequence of SEQ ID NO: 18 (CDR2 of second variable region), and a CDR3 comprising the amino acid sequence of SEQ ID NO: 19 (CDR3 of second variable region). In this regard, the inventive polypeptide can comprise (i) all of SEQ ID NOs: 14-16, (ii) all of SEQ ID NOs: 17-19, or (iii) all of SEQ ID NOs: 14-19. Preferably, the polypeptide comprises all of SEQ ID NOs: 14-19.
[0039] In an embodiment of the invention, the polypeptide comprising the CDR regions of the 15B6 anti-mesothelin antibody further comprises the framework regions of the 15B6 anti-mesothelin antibody. In this regard, the polypeptide comprising the CDR regions of the 15B6 anti-mesothelin antibody further comprises the amino acid sequence of SEQ ID NO: 48 (FR1 of first variable region), the amino acid sequence of SEQ ID NO: 49 (FR2 of first variable region), the amino acid sequence of SEQ ID NO: 50 (FR3 of first variable region), the amino acid sequence of SEQ ID NO: 51 (FR4 of first variable region), the amino acid sequence of SEQ ID NO: 52 (FR1 of second variable region), the amino acid sequence of SEQ ID NO: 53 (FR2 of second variable region), the amino acid sequence of SEQ ID NO: 54 (FR3 of second variable region), and the amino acid sequence of SEQ ID NO: 55 (FR4 of second variable region). In this regard, the inventive polypeptide can comprise (i) all of SEQ ID NOs: 14-16 and 48-51, (ii) all of SEQ ID NOs: 17-19 and 52-55; or (iii) all of SEQ ID NOs: 14-19 and 48-55.
[0040] In an embodiment, each respective polypeptide comprises one or more variable regions (e.g., first and second variable regions) of an antigen binding domain of an anti-mesothelin antibody, each variable region comprising the respective CDRs as described above. In an embodiment of the invention, the first variable region is the heavy chain of an anti-mesothelin antibody and the second variable region is the light chain of an anti-mesothelin antibody.
[0041] An embodiment of the invention provides a polypeptide comprising one or both variable regions of the 2B4 anti-mesothelin antibody. In this regard, the first variable region may comprise SEQ ID NO: 20. The second variable region may comprise SEQ ID NO: 21. Accordingly, in an embodiment of the invention, the polypeptide comprises SEQ ID NO: 20, SEQ ID NO: 21, or both SEQ ID NOs: 20 and 21. Preferably, the polypeptide comprises both of SEQ ID NOs: 20-21.
[0042] An embodiment of the invention provides a polypeptide comprising one or both variable regions of the 7B5 anti-mesothelin antibody. In this regard, the first variable region may comprise SEQ ID NO: 22. The second variable region may comprise SEQ ID NO: 23. Accordingly, in an embodiment of the invention, the polypeptide comprises SEQ ID NO: 22, SEQ ID NO: 23, or both SEQ ID NOs: 22 and 23. Preferably, the polypeptide comprises both of SEQ ID NOs: 22-23.
[0043] An embodiment of the invention provides a polypeptide comprising one or both variable regions of the 15B6 anti-mesothelin antibody. In this regard, the first variable region may comprise SEQ ID NO: 24. The second variable region may comprise SEQ ID NO: 25. Accordingly, in an embodiment of the invention, the polypeptide comprises SEQ ID NO: 24, SEQ ID NO: 25, or both SEQ ID NOs: 24 and 25. Preferably, the polypeptide comprises both of SEQ ID NOs: 24-25.
[0044] An embodiment of the invention provides a protein which specifically recognizes and binds to human mesothelin.sub.582-598(IPNGYLVLDLSMQEALS) (SEQ ID NO: 1). The protein may comprise at least one of the polypeptides described herein. By protein it is meant a molecule comprising one or more polypeptide chains.
[0045] In an embodiment, the protein can comprise (a) a first polypeptide chain comprising SEQ ID NOs: 2-4 and a second polypeptide chain comprising SEQ ID NOs: 5-7; (b) a first polypeptide chain comprising SEQ ID NOs: 8-10 and a second polypeptide chain comprising SEQ ID NOs: 11-13; or (c) a first polypeptide chain comprising SEQ ID NOs: 14-16 and a second polypeptide chain comprising SEQ ID NOs: 17-19. In an embodiment of the invention, the protein may comprise (a) a first polypeptide chain comprising SEQ ID NO: 20 and a second polypeptide chain comprising SEQ ID NO: 21; (b) a first polypeptide chain comprising SEQ ID NO: 22 and a second polypeptide chain comprising SEQ ID NO: 23; or (c) a first polypeptide chain comprising SEQ ID NO: 24 and a second polypeptide chain comprising SEQ ID NO: 25.
[0046] In an embodiment, the protein can comprise (a) a first polypeptide chain comprising SEQ ID NOs: 2-4 and SEQ ID NOs: 32-35 and a second polypeptide chain comprising SEQ ID NOs: 5-7 and SEQ ID NOs: 36-39; (b) a first polypeptide chain comprising SEQ ID NOs: 8-10 and SEQ ID NOs: 40-43 and a second polypeptide chain comprising SEQ ID NOs: 11-13 and SEQ ID NOs: 44-47; or (c) a first polypeptide chain comprising SEQ ID NOs: 14-16 and SEQ ID NOs: 48-51 and a second polypeptide chain comprising SEQ ID NOs: 17-19 and SEQ ID NOs: 52-55.
[0047] In an embodiment, the protein can be, for example, a fusion protein. If, for example, the protein comprises a single polypeptide chain comprising (a) a first polypeptide chain comprising SEQ ID NOs: 2-4 and a second polypeptide chain comprising SEQ ID NOs: 5-7; (b) a first polypeptide chain comprising SEQ ID NOs: 8-10 and a second polypeptide chain comprising SEQ ID NOs: 11-13; or (c) a first polypeptide chain comprising SEQ ID NOs: 14-16 and a second polypeptide chain comprising SEQ ID NOs: 17-19, or if the first and/or second polypeptide chain(s) of the protein further comprise(s) other amino acid sequences, e.g., an amino acid sequence encoding an immunoglobulin or a portion thereof, then the inventive protein can be a fusion protein. In this regard, an embodiment of the invention also provides a fusion protein comprising at least one of the inventive polypeptides described herein along with at least one other polypeptide. The other polypeptide can exist as a separate polypeptide of the fusion protein, or can exist as a polypeptide, which is expressed in frame (in tandem) with one of the inventive polypeptides described herein. The other polypeptide can encode any peptidic or proteinaceous molecule, or a portion thereof, including, but not limited to an immunoglobulin, CD3, CD4, CD8, an MHC molecule, a CD1 molecule, e.g., CD1a, CD1b, CD1c, CD1d, etc.
[0048] The fusion protein can comprise one or more copies of the inventive polypeptide and/or one or more copies of the other polypeptide. For instance, the fusion protein can comprise 1, 2, 3, 4, 5, or more, copies of the inventive polypeptide and/or of the other polypeptide. Suitable methods of making fusion proteins are known in the art, and include, for example, recombinant methods. See, for instance, Choi et al., Mol. Biotechnol. 31: 193-202 (2005).
[0049] It is contemplated that the polypeptides and proteins may be useful as anti-mesothelin binding moieties. In this regard, an embodiment of the invention provides an anti-mesothelin binding moiety comprising any of the polypeptides or proteins described herein. In an embodiment of the invention, the anti-mesothelin binding moiety comprises an antigen binding portion of any of the polypeptides or proteins described herein. The antigen binding portion can be any portion that has at least one antigen binding site. In an embodiment, the anti-mesothelin binding moiety is an antibody, a Fab fragment (Fab), F(ab)2 fragment, diabody, triabody, tetrabody, bispecific antibody, single-chain variable region fragment (scFv), or disulfide-stabilized variable region fragment (dsFv).
[0050] In an embodiment, the anti-mesothelin binding moiety is an antibody. The antibody may be, for example, a recombinant antibody comprising at least one of the inventive polypeptides or proteins described herein. As used herein, recombinant antibody refers to a recombinant (e.g., genetically engineered) protein comprising at least one of the inventive polypeptides or proteins and one or more polypeptide chains of an antibody, or a portion thereof. The polypeptide of an antibody, or portion thereof, can be, for example, a constant region of a heavy or light chain, or an Fc fragment of an antibody, etc. The polypeptide chain of an antibody, or portion thereof, can exist as a separate polypeptide of the recombinant antibody. Alternatively, the polypeptide chain of an antibody, or portion thereof, can exist as a polypeptide, which is expressed in frame (in tandem) with the polypeptide or protein. The polypeptide of an antibody, or portion thereof, can be a polypeptide of any antibody or any antibody fragment.
[0051] The antibody of an embodiment of the invention can be any type of immunoglobulin that is known in the art. For instance, the anti-mesothelin binding moiety can be an antibody of any isotype, e.g., IgA, IgD, IgE, IgG (e.g., IgG1, IgG2, IgG3, or IgG4), IgM, etc. The antibody can be monoclonal or polyclonal. The antibody can be a naturally-occurring antibody, e.g., an antibody isolated and/or purified from a mammal, e.g., mouse, rabbit, goat, horse, chicken, hamster, human, etc. Alternatively, the antibody can be a genetically-engineered antibody, e.g., a humanized antibody or a chimeric antibody. The antibody can be in monomeric or polymeric form. Also, the antibody can have any level of affinity or avidity for mesothelin.
[0052] Methods of testing antibodies for the ability to bind to mesothelin are known in the art and include any antibody-antigen binding assay, such as, for example, radioimmunoassay (RIA), enzyme-linked immunosorbent assay (ELISA), Western blot, immunoprecipitation, and competitive inhibition assays (see, e.g., Murphy et al., infra, and U.S. Patent Application Publication No. 2002/0197266 A1).
[0053] Suitable methods of making antibodies are known in the art. For instance, standard hybridoma methods are described in, e.g., Antibodies: A Laboratory Manual, 2.sup.nd Ed., CSH Press (2013), and Murphy et al. (eds.), Janeway's Immunobiology, 9.sup.th Ed., Taylor & Francis, Inc., New York, N.Y. (2016). Alternatively, other methods, such as Epstein-Barr virus (EBV)-hybridoma methods and bacteriophage vector expression systems are known in the art. Further, methods of producing antibodies in non-human animals are described in, e.g., U.S. Pat. Nos. 5,545,806, 5,569,825, and 5,714,352, and U.S. Patent Application Publication No. 2002/0197266 A1.
[0054] Phage display furthermore can be used to generate an antibody. In this regard, phage libraries encoding antigen-binding variable (V) domains of antibodies can be generated using standard molecular biology and recombinant DNA techniques. See, for instance, Green et al. (eds.), Molecular Cloning, A Laboratory Manual, 4.sup.th Edition, Cold Spring Harbor Laboratory Press, New York (2012) and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY (2007). Phage encoding a variable region with the desired specificity are selected for specific binding to the desired antigen, and a complete or partial antibody is reconstituted comprising the selected variable domain. Nucleic acid sequences encoding the reconstituted antibody are introduced into a suitable cell line, such as a myeloma cell used for hybridoma production, such that antibodies having the characteristics of monoclonal antibodies are secreted by the cell (see, e.g., Murphy et al., supra, Huse et al., supra, and U.S. Pat. No. 6,265,150).
[0055] Antibodies can be produced by transgenic mice that are transgenic for specific heavy and light chain immunoglobulin genes. Such methods are known in the art and described in, for example U.S. Pat. Nos. 5,545,806 and 5,569,825, and Murphy et al., supra.
[0056] Methods for generating humanized antibodies are well known in the art and are described in detail in, for example, Murphy et al., supra, U.S. Pat. Nos. 5,225,539, 5,585,089 and 5,693,761, European Patent No. 0239400 B1, and United Kingdom Patent No. 2188638. Humanized antibodies can also be generated using the antibody resurfacing technology described in U.S. Pat. No. 5,639,641 and Pedersen et al., J. Mol. Biol., 235, 959-973 (1994).
[0057] In a preferred embodiment, the anti-mesothelin binding moiety is a single-chain variable region fragment (scFv). A single-chain variable region fragment (scFv), which is a truncated Fab fragment including the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide, can be generated using routine recombinant DNA technology techniques (see, e.g., Murphy et al., supra). Similarly, disulfide-stabilized variable region fragments (dsFv) can be prepared by recombinant DNA technology (see, e.g., Reiter et al., Protein Engineering, 7: 697-704 (1994)). The anti-mesothelin binding moieties of embodiments of the invention, however, are not limited to these exemplary types of antibody fragments.
[0058] Also, the anti-mesothelin binding moiety can be modified to comprise a detectable label, such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin, an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
[0059] Included in the scope of the embodiments of the invention are functional portions of the inventive polypeptides and proteins described herein. The term functional portion when used in reference to a polypeptide or protein refers to any part or fragment of the polypeptide or protein of the embodiments of the invention, which part or fragment retains the biological activity of the polypeptide or protein of which it is a part (the parent polypeptide or protein). Functional portions encompass, for example, those parts of a polypeptide or protein that retain the ability to recognize target cells, or detect, treat, or prevent cancer, to a similar extent, the same extent, or to a higher extent, as the parent polypeptide or protein. In reference to the parent polypeptide or protein, the functional portion can comprise, for instance, about 10%, 25%, 30%, 50%, 68%, 80%, 90%, 95%, or more, of the parent polypeptide or protein.
[0060] The functional portion can comprise additional amino acids at the amino or carboxy terminus of the portion, or at both termini, which additional amino acids are not found in the amino acid sequence of the parent polypeptide or protein. Desirably, the additional amino acids do not interfere with the biological function of the functional portion, e.g., to recognize target cells, reduce mesothelin shed from cells, reduce TACE activity in mammals, detect cancer, treat or prevent cancer, etc. More desirably, the additional amino acids enhance the biological activity, as compared to the biological activity of the parent polypeptide or protein.
[0061] Included in the scope of the embodiments of the invention are functional variants of the inventive polypeptides or proteins described herein. The term functional variant as used herein refers to a polypeptide or protein having substantial or significant sequence identity or similarity to a parent polypeptide or protein, which functional variant retains the biological activity of the polypeptide or protein of which it is a variant. Functional variants encompass, for example, those variants of the polypeptide or protein described herein (the parent polypeptide or protein) that retain the ability to recognize target cells to a similar extent, the same extent, or to a higher extent, as the parent polypeptide or protein. In reference to the parent polypeptide or protein, the functional variant can, for instance, be at least about 30%, about 50%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more identical in amino acid sequence to the parent polypeptide or protein.
[0062] A functional variant can, for example, comprise the amino acid sequence of the parent polypeptide or protein with at least one conservative amino acid substitution. Alternatively or additionally, the functional variants can comprise the amino acid sequence of the parent polypeptide or protein with at least one non-conservative amino acid substitution. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with or inhibit the biological activity of the functional variant. The non-conservative amino acid substitution may enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the parent polypeptide or protein.
[0063] Amino acid substitutions of the inventive polypeptides or proteins are preferably conservative amino acid substitutions. Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties. For instance, the conservative amino acid substitution can be an acidic/negatively charged polar amino acid substituted for another acidic/negatively charged polar amino acid (e.g., Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g., Ala, Gly, Val, Ile, Leu, Met, Phe, Pro, Trp, Cys, Val, etc.), a basic/positively charged polar amino acid substituted for another basic/positively charged polar amino acid (e.g. Lys, His, Arg, etc.), an uncharged amino acid with a polar side chain substituted for another uncharged amino acid with a polar side chain (e.g., Asn, Gln, Ser, Thr, Tyr, etc.), an amino acid with a beta-branched side-chain substituted for another amino acid with a beta-branched side-chain (e.g., Ile, Thr, and Val), an amino acid with an aromatic side-chain substituted for another amino acid with an aromatic side chain (e.g., His, Phe, Trp, and Tyr), etc.
[0064] The polypeptide or protein can consist essentially of the specified amino acid sequence or sequences described herein, such that other components, e.g., other amino acids, do not materially change the biological activity of the polypeptide, protein, functional portion, or functional variant.
[0065] The polypeptides or proteins of embodiments of the invention (including functional portions and functional variants) can be of any length, i.e., can comprise any number of amino acids, provided that the polypeptides or proteins (or functional portions or functional variants thereof) retain their biological activity, e.g., the ability to specifically bind to antigen, detect cancer cells in a mammal, or treat or prevent cancer in a mammal, etc. For example, the polypeptide or protein can be about 50 to about 5,000 amino acids long, such as 50, 70, 75, 100, 125, 150, 175, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, or more amino acids in length.
[0066] The polypeptides or proteins of embodiments of the invention (including functional portions and functional variants of the invention) can comprise synthetic amino acids in place of one or more naturally-occurring amino acids. Such synthetic amino acids are known in the art, and include, for example, aminocyclohexane carboxylic acid, norleucine, -amino n-decanoic acid, homoserine, S-acetylaminomethyl-cysteine, trans-3-and trans-4-hydroxyproline, 4-aminophenylalanine, 4-nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, -phenylserine -hydroxyphenylalanine, phenylglycine, -naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, aminomalonic acid, aminomalonic acid monoamide, N-benzyl-N-methyl-lysine, N,N-dibenzyl-lysine, 6-hydroxylysine, ornithine, -aminocyclopentane carboxylic acid, -aminocyclohexane carboxylic acid, -aminocycloheptane carboxylic acid, -(2-amino-2-norbornane)-carboxylic acid, ,-diaminobutyric acid, ,-diaminopropionic acid, homophenylalanine, and -tert-butylglycine.
[0067] The polypeptides or proteins of embodiments of the invention (including functional portions and functional variants) can be glycosylated, amidated, carboxylated, phosphorylated, esterified, N-acylated, cyclized via, e.g., a disulfide bridge, or converted into an acid addition salt and/or optionally dimerized or polymerized.
[0068] The polypeptides or proteins of embodiments of the invention (including functional portions and functional variants thereof) can be obtained by methods known in the art. The polypeptides or proteins may be made by any suitable method of making polypeptides or proteins. Suitable methods of de novo synthesizing polypeptides and proteins are described in references, such as Chan et al., Fmoc Solid Phase Peptide Synthesis, Oxford University Press, Oxford, United Kingdom, 2000; Peptide and Protein Drug Analysis, ed. Reid, R., Marcel Dekker, Inc., 2000; Epitope Mapping, ed. Westwood et al., Oxford University Press, Oxford, United Kingdom, 2001; and U.S. Pat. No. 5,449,752. Also, polypeptides and proteins can be recombinantly produced using the nucleic acids described herein using standard recombinant methods. See, e.g., Green et al., supra, and Ausubel et al., supra. Further, some of the polypeptides or proteins of the embodiments of the invention (including functional portions and functional variants thereof) can be isolated and/or purified from a source, such as a plant, a bacterium, an insect, a mammal, e.g., a rat, a human, etc. Methods of isolation and purification are well-known in the art. Alternatively, the polypeptides or proteins described herein (including functional portions and functional variants thereof) can be commercially synthesized by companies, such as Synpep (Dublin, Calif.), Peptide Technologies Corp. (Gaithersburg, Md.), and Multiple Peptide Systems (San Diego, Calif.). In this respect, the inventive polypeptides or proteins can be synthetic, recombinant, isolated, and/or purified.
[0069] Included in the scope of the embodiments of the invention are conjugates, e.g., bioconjugates, comprising any of the inventive polypeptides, proteins, anti-mesothelin binding moieties, functional portions, or functional variants thereof. Conjugates, as well as methods of synthesizing conjugates in general, are known in the art (See, for instance, Hudecz, F., Methods Mol. Biol. 298: 209-223 (2005) and Kirin et al., Inorg Chem. 44(15): 5405-5415 (2005)). In this regard, an embodiment of the invention provides a conjugate comprising (a) any of the polypeptides, proteins, or anti-mesothelin binding moieties described herein conjugated or fused to (b) an effector molecule. The effector molecule may be any therapeutic molecule or a molecule that facilitates the detection of the conjugate such as a drug, toxin, label (e.g., any of the detectable labels described herein), small molecule, or another antibody. For example, the toxin may be Pseudomonas exotoxin A (PE) or variants thereof such as, e.g., any of PE24, PE4E, PE40, PE38, PE25, PE38QQR, PE38KDEL, PE-LR, and PE35, as described in, e.g., U.S. Pat. Nos. 4,892,827; 5,512,658; 5,602,095; 5,608,039; 5,821,238; 5,854,044; and 8,871,906, each of which is incorporated herein by reference. PE variants include PE which has been modified to remove B cell and/or T-cell epitopes to reduce the immunogenicity of the PE as described in, for example, any of U.S. Pat. Nos. 9,206,240; 9,346,859; 9,388,222; 8,907,060; 8,871,906; 8,936,792; and U.S. Patent Publication No. 2014/154248, each of which is incorporated herein by reference. PE is a bacterial toxin with cytotoxic activity that may be effective for destroying or inhibiting the growth of undesireable cells, e.g., cancer cells. Accordingly, PE may be useful for treating or preventing diseases such as cancer.
[0070] Examples of drugs that may be suitable in the inventive conjugates include, but are not limited to, pyrrolobenzodiazepine (PBD) dimer, tubulin-binders such as, for example, dolastatin 10, monomethyl dolastatin 10, auristain E, monomethyl auristain E (MMAE), auristatin F, monomethyl auristatin F, HTI-286, tubulysin M, maytansinoid AP-3, cryptophycin, Boc-Val-Dil-Dap-OH, tubulysin IM-1, Boc-Val-Dil-Dap-Phe-OMe, tubulysin IM-2, Boc-Nme-Val-Val-Dil-Dap-OH, tubulysin IM-3, and colchicine DA; DNA-alkylators(duocarmycin analogs) such as, for example, duocarmycin SA, duocarmycin CN, duocarmycin DMG, duocarmycin DMA, duocarmycin MA, duocarmycin TM, duocarmycin MB, duocarmycin GA; tomaymycin DM; SJG-136; illudin S; irofulven; apaziquone; triptolide; staurosporine; camptothecin; methotrexate; and other anti-cancer drugs such as, for example, kinase inhibitors, histone deacetylase (HDAC) inhibitors, proteasome inhibitors, and matrix metalloproteinase (MMP) inhibitors. In an embodiment, the drug is MMAE or PBD dimer.
[0071] The polypeptides, proteins, or anti-mesothelin binding moieties described herein may be conjugated or fused to (b) an effector molecule (such as a drug, toxin, label, small molecule, or an antibody) directly or indirectly, e.g., via a linking moiety. The linking moiety may be any suitable linking moiety known in the art. In an embodiment, the linking moiety is a cleavable linker that may be cleaved upon administration of the conjugate to a mammal.
[0072] Further provided by an embodiment of the invention is a nucleic acid comprising a nucleotide sequence encoding any of the polypeptides, proteins, anti-mesothelin binding moieties, conjugates, or functional portions or functional variants thereof.
[0073] An embodiment of the invention provides a nucleic acid comprising a nucleotide sequence encoding any of the polypeptides, proteins, or anti-mesothelin binding moieties described herein. In this regard, the nucleic acid comprises a nucleotide sequence encoding first and second variable regions (i) SEQ ID NOs: 26 and 27 (2B4 antibody), (ii) SEQ ID NOs: 28 and 29 (7B5 antibody), or (iii) SEQ ID NOs: 30 and 31 (15B6 antibody), respectively.
[0074] Nucleic acid as used herein includes polynucleotide, oligonucleotide, and nucleic acid molecule, and generally means a polymer of DNA or RNA, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and which can contain a natural, non-natural or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide. In some embodiments, the nucleic acid does not comprise any insertions, deletions, inversions, and/or substitutions. However, it may be suitable in some instances, as discussed herein, for the nucleic acid to comprise one or more insertions, deletions, inversions, and/or substitutions. In some embodiments, the nucleic acid may encode additional amino acid sequences that do not affect the function of the polypeptide or protein and which may or may not be translated upon expression of the nucleic acid by a host cell. In an embodiment of the invention, the nucleic acid is complementary DNA (cDNA). In an embodiment of the invention, the nucleic acid comprises a codon-optimized nucleotide sequence.
[0075] The nucleic acids of an embodiment of the invention may be recombinant. As used herein, the term recombinant refers to (i) molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments to nucleic acid molecules that can replicate in a living cell, or (ii) molecules that result from the replication of those described in (i) above. For purposes herein, the replication can be in vitro replication or in vivo replication.
[0076] The nucleic acids can consist essentially of the specified nucleotide sequence or sequences described herein, such that other components, e.g., other nucleotides, do not materially change the biological activity of the encoded polypeptide, protein, anti mesothelin-binding moieties, functional portion, or functional variant.
[0077] A recombinant nucleic acid may be one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques, such as those described in Green et al., supra. The nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. See, for example, Green et al., supra, and Ausubel et al., supra. For example, a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides). Examples of modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxymethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N.sup.6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N.sup.6-substituted adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N.sup.6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, 3-(3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine. Alternatively, one or more of the nucleic acids of the embodiments of the invention can be purchased from companies, such as Macromolecular Resources (Fort Collins, Colo.) and Synthegen (Houston, Tex.).
[0078] The nucleic acid can comprise any isolated or purified nucleotide sequence which encodes any of the polypeptides, proteins, anti-mesothelin binding moieties, conjugates, or functional portions or functional variants thereof. Alternatively, the nucleotide sequence can comprise a nucleotide sequence which is degenerate to any of the sequences or a combination of degenerate sequences.
[0079] An embodiment of the invention also provides an isolated or purified nucleic acid comprising a nucleotide sequence which is complementary to the nucleotide sequence of any of the nucleic acids described herein or a nucleotide sequence which hybridizes under stringent conditions to the nucleotide sequence of any of the nucleic acids described herein.
[0080] The nucleotide sequence which hybridizes under stringent conditions may hybridize under high stringency conditions. By high stringency conditions is meant that the nucleotide sequence specifically hybridizes to a target sequence (the nucleotide sequence of any of the nucleic acids described herein) in an amount that is detectably stronger than non-specific hybridization. High stringency conditions include conditions which would distinguish a polynucleotide with an exact complementary sequence, or one containing only a few scattered mismatches from a random sequence that happened to have a few small regions (e.g., 3-10 bases) that matched the nucleotide sequence. Such small regions of complementarity are more easily melted than a full-length complement of 14-17 or more bases, and high stringency hybridization makes them easily distinguishable. Relatively high stringency conditions would include, for example, low salt and/or high temperature conditions, such as provided by about 0.02-0.1 M NaCl or the equivalent, at temperatures of about 50-70 C. Such high stringency conditions tolerate little, if any, mismatch between the nucleotide sequence and the template or target strand, and are particularly suitable for detecting expression of any of the inventive polypeptides, proteins, anti-mesothelin binding moieties, conjugates, or functional portions or functional variants thereof. It is generally appreciated that conditions can be rendered more stringent by the addition of increasing amounts of formamide.
[0081] The embodiments of the invention also provide a nucleic acid comprising a nucleotide sequence that is at least about 70% or more, e.g., about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to any of the nucleic acids described herein.
[0082] In an embodiment, the nucleic acids of the embodiments of the invention can be incorporated into a recombinant expression vector. In this regard, an embodiment of the invention provides recombinant expression vectors comprising any of the nucleic acids of the invention. For purposes herein, the term recombinant expression vector means a genetically-modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell. The vectors of the embodiments of the invention are not naturally-occurring as a whole. However, parts of the vectors can be naturally-occurring. The inventive recombinant expression vectors can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double-stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides. The recombinant expression vectors can comprise naturally-occurring or non-naturally-occurring internucleotide linkages, or both types of linkages. Preferably, the non-naturally occurring or altered nucleotides or internucleotide linkages do not hinder the transcription or replication of the vector.
[0083] In an embodiment, the recombinant expression vector can be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host cell. Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. The vector can be selected from the group consisting of the pUC series (Fermentas Life Sciences, Glen Burnie, Md.), the pBluescript series (Stratagene, LaJolla, Calif.), the pET series (Novagen, Madison, Wis.), the pGEX series (Pharmacia Biotech, Uppsala, Sweden), and the pEX series (Clontech, Palo Alto, Calif.). Bacteriophage vectors, such as GT10, GT11, ZapII (Stratagene), EMBL4, and NM1149, also can be used. Examples of plant expression vectors include pBI01, pBI101.2, pBI101.3, pBI121 and pBIN19 (Clontech). Examples of animal expression vectors include pEUK-Cl, pMAM, and pMAMneo (Clontech). The recombinant expression vector may be a viral vector, e.g., a retroviral vector.
[0084] A number of transfection techniques are generally known in the art. Transfection methods include calcium phosphate co-precipitation, direct micro injection into cultured cells, electroporation, liposome mediated gene transfer, lipid mediated transduction, and nucleic acid delivery using high velocity microprojectiles.
[0085] In an embodiment, the recombinant expression vectors can be prepared using standard recombinant DNA techniques described in, for example, Green et al., supra, and Ausubel et al., supra. Constructs of expression vectors, which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell. Replication systems can be derived, e.g., from ColE1, 2 plasmid, , SV40, bovine papilloma virus, and the like.
[0086] The recombinant expression vector may comprise regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host cell (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate, and taking into consideration whether the vector is DNA- or RNA-based. The recombinant expression vector may comprise restriction sites to facilitate cloning.
[0087] The recombinant expression vector can include one or more marker genes, which allow for selection of transformed or transfected host cells. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like. Suitable marker genes for the inventive expression vectors include, for instance, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes.
[0088] The recombinant expression vector can comprise a native or nonnative promoter operably linked to the nucleotide sequence encoding the polypeptides, proteins, anti-mesothelin binding moieties, conjugates, or functional portions or functional variants thereof, or to the nucleotide sequence which is complementary to or which hybridizes to the nucleotide sequence encoding the inventive polypeptides, proteins, anti-mesothelin binding moieties, conjugates, or functional portions or functional variants thereof. The selection of promoters, e.g., strong, weak, inducible, tissue-specific and developmental-specific, is within the ordinary skill of the artisan. Similarly, the combining of a nucleotide sequence with a promoter is also within the ordinary skill of the artisan. The promoter can be a non-viral promoter or a viral promoter, e.g., a cytomegalovirus (CMV) promoter, an SV40 promoter, an RSV promoter, or a promoter found in the long-terminal repeat of the murine stem cell virus.
[0089] The inventive recombinant expression vectors can be designed for either transient expression, for stable expression, or for both. Also, the recombinant expression vectors can be made for constitutive expression or for inducible expression.
[0090] Further, the recombinant expression vectors can be made to include a suicide gene. As used herein, the term suicide gene refers to a gene that causes the cell expressing the suicide gene to die. The suicide gene can be a gene that confers sensitivity to an agent, e.g., a drug, upon the cell in which the gene is expressed, and causes the cell to die when the cell is contacted with or exposed to the agent. Suicide genes are known in the art (see, for example, Suicide Gene Therapy: Methods and Reviews, Springer, Caroline J. (Cancer Research UK Centre for Cancer Therapeutics at the Institute of Cancer Research, Sutton, Surrey, UK), Humana Press, 2004) and include, for example, the Herpes Simplex Virus (HSV) thymidine kinase (TK) gene, cytosine daminase, purine nucleoside phosphorylase, and nitroreductase.
[0091] An embodiment of the invention further provides a host cell comprising any of the recombinant expression vectors described herein. As used herein, the term host cell refers to any type of cell that can contain the inventive recombinant expression vector. The host cell can be a eukaryotic cell, e.g., plant, animal, fungi, or algae, or can be a prokaryotic cell, e.g., bacteria or protozoa. The host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human. The host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension. Suitable host cells are known in the art and include, for instance, DH5 E. coli cells, Chinese hamster ovarian cells, monkey VERO cells, COS cells, HEK293 cells, and the like. For purposes of amplifying or replicating the recombinant expression vector, the host cell may be a prokaryotic cell, e.g., a DH5 cell. For purposes of producing a recombinant polypeptide, protein, anti-mesothelin binding moiety, conjugate, or functional portion or functional variant thereof, the host cell may be a mammalian cell. The host cell may be a human cell. While the host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage, the host cell may be a peripheral blood lymphocyte (PBL) or a peripheral blood mononuclear cell (PBMC). The host cell may be a B cell or a T cell.
[0092] Also provided by an embodiment of the invention is a population of cells comprising at least one host cell described herein. The population of cells can be a heterogeneous population comprising the host cell comprising any of the recombinant expression vectors described, in addition to at least one other cell, e.g., a host cell (e.g., a T cell), which does not comprise any of the recombinant expression vectors, or a cell other than a T cell, e.g., a B cell, a macrophage, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cell, a muscle cell, a brain cell, etc. Alternatively, the population of cells can be a substantially homogeneous population, in which the population comprises mainly host cells (e.g., consisting essentially of) comprising the recombinant expression vector. The population also can be a clonal population of cells, in which all cells of the population are clones of a single host cell comprising a recombinant expression vector, such that all cells of the population comprise the recombinant expression vector. In one embodiment of the invention, the population of cells is a clonal population comprising host cells comprising a recombinant expression vector as described herein.
[0093] The polypeptides and proteins (including functional portions and variants thereof), nucleic acids, recombinant expression vectors, host cells (including populations thereof), anti-mesothelin binding moieties, and conjugates, all of which are collectively referred to as inventive anti-mesothelin materials hereinafter, can be isolated and/or purified. The term isolated as used herein means having been removed from its natural environment. The term purified or isolated does not require absolute purity or isolation; rather, it is intended as a relative term. Thus, for example, a purified (or isolated) host cell preparation is one in which the host cell is more pure than cells in their natural environment within the body. Such host cells may be produced, for example, by standard purification techniques. In some embodiments, a preparation of a host cell is purified such that the host cell represents at least about 50%, for example, at least about 70%, of the total cell content of the preparation. For example, the purity can be at least about 50%, can be greater than about 60%, about 70% or about 80%, or can be about 100%.
[0094] The inventive anti-mesothelin materials can be formulated into a composition, such as a pharmaceutical composition. In this regard, an embodiment of the invention provides a pharmaceutical composition comprising any of the inventive anti-mesothelin materials described herein and a pharmaceutically acceptable carrier. The inventive pharmaceutical compositions containing any of the inventive anti-mesothelin materials can comprise more than one inventive anti-mesothelin material, e.g., a conjugate and a nucleic acid, or two or more different conjugates. Alternatively, the pharmaceutical composition can comprise an inventive anti-mesothelin material in combination with other pharmaceutically active agents or drugs, such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
[0095] With respect to pharmaceutical compositions, the pharmaceutically acceptable carrier can be any of those conventionally used and is limited only by chemico-physical considerations, such as solubility and lack of reactivity with the active agent(s), and by the route of administration. The pharmaceutically acceptable carriers described herein, for example, vehicles, adjuvants, excipients, and diluents, are well-known to those skilled in the art and are readily available to the public. It is preferred that the pharmaceutically acceptable carrier be one which is chemically inert to the active agent(s) and one which has no detrimental side effects or toxicity under the conditions of use.
[0096] The choice of carrier will be determined in part by the particular inventive anti-mesothelin material, as well as by the particular method used to administer the inventive anti-mesothelin material. Accordingly, there are a variety of suitable formulations of the pharmaceutical composition of the embodiments of the invention. Preservatives may be used. Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. A mixture of two or more preservatives optionally may be used. The preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition.
[0097] Suitable buffering agents may include, for example, histidine or citrate-based buffers. Suitable buffering agents may include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. A mixture of two or more buffering agents optionally may be used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001% to about 4% by weight of the total composition.
[0098] The concentration of inventive anti-mesothelin material in the pharmaceutical formulations can vary, e.g., from less than about 1%, (e.g., at or at least about 4%) to as much as, for example, about 10% to about 50% or more by weight, and can be selected primarily by fluid volumes, and viscosities, in accordance with the particular mode of administration selected. Further, the amount of inventive anti-mesothelin material in the pharmaceutical formulations can vary, e.g., from less than about 1g/ml to greater than about 40 mg/ml, from about 1 g/ml to about 40 mg/ml, from about 1 g/ml to about 100 mg/ml, or from less than about 1 g/ml to greater than about 1000 mg/ml.
[0099] Methods for preparing administrable (e.g., parenterally administrable) compositions are known or apparent to those skilled in the art and are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 22nd ed. (2013).
[0100] The following formulations for parenteral (e.g., subcutaneous, intravenous, intraarterial, intramuscular, intradermal, intraperitoneal, interperitoneal, and intrathecal) administration are merely exemplary and are in no way limiting. More than one route can be used to administer the inventive anti-mesothelin materials, and in certain instances, a particular route can provide a more immediate and more effective response than another route.
[0101] Formulations suitable for parenteral administration include aqueous and nonaqueous isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and nonaqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The inventive anti-mesothelin material can be administered in a physiologically acceptable diluent in a pharmaceutical carrier, such as a sterile liquid or mixture of liquids, including water, saline, aqueous dextrose and related sugar solutions, an alcohol, such as ethanol or hexadecyl alcohol, a glycol, such as propylene glycol or polyethylene glycol, dimethylsulfoxide, glycerol, ketals such as 2,2-dimethyl-1,3-dioxolane-4-methanol, ethers, poly(ethyleneglycol) 400, oils, fatty acids, fatty acid esters or glycerides, or acetylated fatty acid glycerides with or without the addition of a pharmaceutically acceptable surfactant, such as a soap or a detergent, suspending agent, such as pectin, carbomers, methylcellulose, hydroxypropylmethylcellulose, or carboxymethylcellulose, or emulsifying agents and other pharmaceutical adjuvants.
[0102] Suitable soaps for use in parenteral formulations include fatty alkali metal, ammonium, and triethanolamine salts, and suitable detergents include (a) cationic detergents such as, for example, dimethyl dialkyl ammonium halides, and alkyl pyridinium halides, (b) anionic detergents such as, for example, alkyl, aryl, and olefin sulfonates, alkyl, olefin, ether, and monoglyceride sulfates, and sulfosuccinates, (c) nonionic detergents such as, for example, fatty amine oxides, fatty acid alkanolamides, and polyoxyethylenepolypropylene copolymers, (d) amphoteric detergents such as, for example, alkyl--aminopropionates, and 2-alkyl-imidazoline quaternary ammonium salts, and (e) mixtures thereof.
[0103] The parenteral formulations will typically contain, for example, from about 0.5% to about 25% by weight of the inventive anti-mesothelin material in solution. Preservatives and buffers may be used. In order to minimize or eliminate irritation at the site of injection, such compositions may contain one or more nonionic surfactants having, for example, a hydrophile-lipophile balance (HLB) of from about 12 to about 17. The quantity of surfactant in such formulations will typically range, for example, from about 5% to about 15% by weight. Suitable surfactants include polyethylene glycol sorbitan fatty acid esters, such as sorbitan monooleate and the high molecular weight adducts of ethylene oxide with a hydrophobic base, formed by the condensation of propylene oxide with propylene glycol. The parenteral formulations can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials, and can be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid excipient, for example, water, for injections, immediately prior to use. Extemporaneous injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described.
[0104] Injectable formulations are in accordance with an embodiment of the invention. The requirements for effective pharmaceutical carriers for injectable compositions are well-known to those of ordinary skill in the art (see, e.g., A Practical Guide to Contemporary Pharmacy Practice, 3rd Edition, Lippincott Williams and Wilkins, Philadelphia, Pa., Thompson and Davidow, eds., (2009), and Handbook on Injectable Drugs, Trissel, 16th ed., (2010)).
[0105] An effective amount or an amount effective to treat refers to a dose that is adequate to carry out any one or more of the following: (a) prevent or treat cancer; (b) reduce or prevent TACE activity and (c) reduce mesothelin shed from cell membranes in an individual. Amounts effective for a therapeutic or prophylactic use will depend on, for example, the stage and severity of the disease or disorder being treated, the age, weight, and general state of health of the patient, and the judgment of the prescribing physician. The size of the dose will also be determined by the active selected, method of administration, timing and frequency of administration, the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular active, and the desired physiological effect. It will be appreciated by one of skill in the art that various diseases or disorders could require prolonged treatment involving multiple administrations, perhaps using the inventive anti-mesothelin materials in each or various rounds of administration. By way of example and not intending to limit the embodiments of the invention, the dose of the inventive anti-mesothelin material can be about 0.001 to about 1000 mg/kg body weight of the subject being treated/day, from about 0.01 to about 10 mg/kg body weight/day, about 0.01 mg to about 1 mg/kg body weight/day.
[0106] For purposes of the embodiments of the invention, the amount or dose of the inventive anti-mesothelin material administered should be sufficient to effect a therapeutic or prophylactic response in the subject or animal over a reasonable time frame. For example, the dose of the inventive anti-mesothelin material should be sufficient to bind to mesothelin, reduce mesothelin shed from cell membranes, reduce TACE activity, or detect, treat or prevent cancer in a period of from about 2 hours or longer, e.g., about 12 to about 24 or more hours, from the time of administration. In certain embodiments, the time period could be even longer. The dose will be determined by the efficacy of the particular inventive anti-mesothelin material and the condition of the animal (e.g., human), as well as the body weight of the animal (e.g., human) to be treated.
[0107] For purposes of the embodiments of the invention, an assay, which comprises, for example, comparing the extent to which target cells are killed upon administration of a given dose of the inventive anti-mesothelin material to a mammal, among a set of mammals of which is each given a different dose of the inventive anti-mesothelin material, could be used to determine a starting dose to be administered to a mammal. The extent to which target cells are killed upon administration of a certain dose can be assayed by methods known in the art.
[0108] The delivery systems useful in the context of embodiments of the invention may include time-released, delayed release, and sustained release delivery systems such that the delivery of the inventive composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. The inventive composition can be used in conjunction with other therapeutic agents or therapies. Such systems can avoid repeated administrations of the inventive composition, thereby increasing convenience to the subject and the physician, and may be particularly suitable for certain composition embodiments of the invention.
[0109] Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075,109. Delivery systems also include non-polymer systems that are lipids including sterols such as cholesterol, cholesterol esters, and fatty acids or neutral fats such as mono-di-and tri-glycerides; hydrogel release systems; sylastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosional systems in which the active composition is contained in a form within a matrix and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer. In addition, pump-based hardware delivery systems can be used, some of which are adapted for implantation.
[0110] One of ordinary skill in the art will readily appreciate that the inventive anti-mesothelin materials of the invention can be modified in any number of ways, such that the therapeutic or prophylactic efficacy of the inventive anti-mesothelin materials is increased through the modification. For instance, the inventive anti-mesothelin materials can be modified into a depot form, such that the manner in which the inventive anti-mesothelin materials is released into the body to which it is administered is controlled with respect to time and location within the body. Depot forms of inventive anti-mesothelin materials can be, for example, an implantable composition comprising the inventive anti-mesothelin materials and a porous or non-porous material, such as a polymer, wherein the inventive anti-mesothelin materials are encapsulated by or diffused throughout the material and/or degradation of the non-porous material. The depot is then implanted into the desired location within the body and the inventive anti-mesothelin materials are released from the implant at a predetermined rate.
[0111] When the inventive anti-mesothelin materials are administered with one or more additional therapeutic agents, one or more additional therapeutic agents can be coadministered to the mammal. By coadministering is meant administering one or more additional therapeutic agents and the inventive anti-mesothelin materials sufficiently close in time such that the inventive anti-mesothelin materials can enhance the effect of one or more additional therapeutic agents, or vice versa. In this regard, the inventive anti-mesothelin materials can be administered first and the one or more additional therapeutic agents can be administered second, or vice versa. Alternatively, the inventive anti-mesothelin materials and the one or more additional therapeutic agents can be administered simultaneously.
[0112] It is contemplated that the inventive anti-mesothelin materials and pharmaceutical compositions can be used in methods of treating or preventing cancer in a mammal. Without being bound to a particular theory or mechanism, the inventive anti-mesothelin materials have biological activity, e.g., ability to recognize antigen, e.g., mesothelin, such that the anti-mesothelin material, can direct an effector molecule to a target cell or target tissue. In this regard, an embodiment of the invention provides a method of treating or preventing cancer, comprising administering to the mammal any of the polypeptides, proteins, functional portions, functional variants, nucleic acids, recombinant expression vectors, host cells, population of cells, anti-mesothelin binding moieties, conjugates, and/or the pharmaceutical compositions in an amount effective to treat or prevent cancer.
[0113] An embodiment of the invention further comprises lymphodepleting the mammal prior to administering the inventive anti-mesothelin materials. Examples of lymphodepletion include, but may not be limited to, nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, total body irradiation, etc.
[0114] The mammal referred to herein can be any mammal. As used herein, the term mammal refers to any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, and mammals of the order Logomorpha, such as rabbits. The mammals may be from the order Carnivora, including Felines (cats) and Canines (dogs). The mammals may be from the order Artiodactyla, including Bovines (cows) and Swines (pigs) or of the order Perssodactyla, including Equines (horses). The mammals may be of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). Preferably, the mammal is a human.
[0115] With respect to the inventive methods, the cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, rhabdomyosarcoma, bladder cancer (e.g., bladder carcinoma), bone cancer, brain cancer (e.g., medulloblastoma, neuroblastoma, and glioblastoma), breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the ovary, vulva, endometrium, or chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, Ewing's sarcoma, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, head and neck cancer (e.g., head and neck squamous cell carcinoma), Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, leukemia, liquid tumors, liver cancer, lung cancer (e.g., non-small cell lung carcinoma, lung adenocarcinoma), lymphoma, malignant mesothelioma, mastocytoma, melanoma, multiple myeloma, nasopharynx cancer, neuroblastoma, non-Hodgkin lymphoma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, ovarian cancer, pancreatic cancer, gastric cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, solid tumors, stomach cancer, testicular cancer, thyroid cancer, synovial cancer, and ureter cancer. Preferably, the cancer is ovarian cancer, endometrial cancer, cervical cancer, colonic cancer, pancreatic cancer, lung cancer (e.g., non-small cell lung carcinoma, lung adenocarcinoma), esophageal cancer, gastric cancer, synovial sarcoma, and mesothelioma. In an embodiment, the cancer is characterized by the expression or overexpression of mesothelin.
[0116] The terms treat, and prevent as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment or prevention. Rather, there are varying degrees of treatment or prevention of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. In this respect, the inventive methods can provide any amount of any level of treatment or prevention of cancer in a mammal. Furthermore, the treatment or prevention provided by the inventive method can include treatment or prevention of one or more conditions or symptoms of the disease, e.g., cancer, being treated or prevented. Also, for purposes herein, prevention can encompass delaying the onset of the disease, or a symptom or condition thereof.
[0117] Another embodiment of the invention provides a kit for treating or preventing cancer, the kit comprising any of the polypeptides, proteins, anti-mesothelin binding moieties, conjugates, nucleic acids, recombinant expression vectors, isolated host cells, populations of cells, or pharmaceutical compositions described herein with respect to other aspects of the invention. In an embodiment of the invention, the kit may further comprise any one or more of (a) pharmaceutically acceptable carrier(s) as described herein with respect to other aspects of the invention (e.g., buffering agent(s)); (b) printed instructions for using the kit; (c) one or more other pharmaceutically active agent(s) or drug(s), such as chemotherapeutic agent(s), as described herein with respect to other aspects of the invention. The printed instructions for using the kit may recite methods of administering the inventive anti-mesothelin material(s) as described herein with respect to other aspects of the invention. In an embodiment of the invention, the kit further comprises separate containers for holding each of the one or more pharmaceutically acceptable carrier(s), each of the one or more inventive anti-mesothelin material(s), and each of the one or more other pharmaceutically active agent(s) or drug(s).
[0118] Another embodiment of the invention provides any of the polypeptides, proteins, functional portions, functional variants, nucleic acids, recombinant expression vectors, host cells, population of cells, anti-mesothelin binding moieties, conjugates, or pharmaceutical compositions of the invention for use in a method of treating or preventing cancer.
[0119] Another embodiment of the invention provides a method of detecting the presence of cancer in a mammal comprising: (a) contacting a sample comprising one or more cells from the mammal with any of the polypeptides, proteins, functional portions, functional variants, nucleic acids, recombinant expression vectors, host cells, population of cells, anti-mesothelin binding moieties, or conjugates, thereby forming a complex, (b) and detecting the complex, wherein detection of the complex is indicative of the presence of cancer in the mammal.
[0120] The sample may be obtained by any suitable method, e.g., biopsy or necropsy. A biopsy is the removal of tissue and/or cells from an individual. Such removal may be to collect tissue and/or cells from the individual in order to perform experimentation on the removed tissue and/or cells. This experimentation may include experiments to determine if the individual has and/or is suffering from a certain condition or disease-state. The condition or disease may be, e.g., cancer.
[0121] With respect to an embodiment of the inventive method of detecting the presence of cancer in a mammal, the sample comprising cells of the mammal can be a sample comprising whole cells, lysates thereof, or a fraction of the whole cell lysates, e.g., a nuclear or cytoplasmic fraction, a whole protein fraction, or a nucleic acid fraction. If the sample comprises whole cells, the cells can be any cells of the mammal, e.g., the cells of any organ or tissue, including blood cells or endothelial cells.
[0122] For purposes of the inventive detecting method, the contacting can take place in vitro or in vivo with respect to the mammal. Preferably, the contacting is in vitro.
[0123] Also, detection of the complex can occur through any number of ways known in the art. For instance, the inventive polypeptides, proteins, functional portions, functional variants, nucleic acids, recombinant expression vectors, host cells, populations of cells, anti-mesothelin binding moieties, or conjugates, described herein, can be labeled with a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
[0124] Methods of testing an anti-mesothelin material for the ability to recognize target cells and for antigen specificity are known in the art. For instance, Clay et al., J. Immunol., 163: 507-513 (1999), teaches methods of measuring the release of cytokines (e.g., interferon-, granulocyte/monocyte colony stimulating factor (GM-CSF), tumor necrosis factor a (TNF-) or interleukin 2 (IL-2)). In addition, anti-mesothelin material function can be evaluated by measurement of cellular cytoxicity, as described in Zhao et al., J. Immunol., 174: 4415-4423 (2005).
[0125] Another embodiment of the invention provides a method of reducing mesothelin shed from cell membranes, the method comprising administering to cells any of the inventive polypeptides, proteins, anti-mesothelin binding moieties, conjugates, nucleic acids, recombinant expression vectors, host cells, population of cells, or the pharmaceutical compositions described herein, in an amount effective to reduce mesothelin shed from the cell membranes of the cells.
[0126] As used herein, reducing mesothelin shed from cell membranes means a reduction in the quantity of mesothelin protein, or portion thereof, removed from a cell following administration of one or more of the inventive anti-mesothelin materials compared to the quantity that would have been removed from the cell without the administration of the inventive anti-mesothelin material(s) to the cells.
[0127] Another embodiment of the invention provides a method of reducing the activity of TNF converting enzyme in a mammal, the method comprising administering to the mammal any of the polypeptides, proteins, anti-mesothelin binding moieties, conjugates, nucleic acids, recombinant expression vectors, host cells, population of cells, or the pharmaceutical compositions of the embodiments of the present invention, in an amount effective to reduce the activity of TNF converting enzyme in the mammal.
[0128] As used herein, reducing the activity of TNF converting enzyme means a reduction in the biological activity of TACE following administration of one or more of the inventive anti-mesothelin materials as compared to the biological activity of TACE without the administration of the inventive anti-mesothelin material(s) to the mammal. The biological activity of TACE may include, for example, TACE-mediated cleavage of mesothelin protein, or portion thereof, from a cell.
[0129] The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.
EXAMPLE 1
[0130] This example demonstrates that the inventive antibodies bind to mesothelin IPNGYLVLDLSMQEALS (SEQ ID NO: 1).
[0131] The amino acid sequences (peptides) that remain associated with the cell membrane when mesothelin is shed were determined to be: 587-LVLDLSMQEALS-598 (SEQ ID NO: 58) and 592-SMQEALS-598 (SEQ ID NO: 60). The S-598 is attached to phosphatidyl inositol.
[0132] To make antibodies to the region of mesothelin that is left behind when mesothelin is released and also to the TACE cutting sites, a peptide C-582-IPNGYLVLDLSMQEALS-598 (SEQ ID NO: 1) was made. This peptide contains the amino acids that are positioned close to the membrane as well as the amino acids making up the TACE cleavage sites. A cysteine was added at the amino terminus to allow conjugation to carrier proteins used for immunization of mice.
[0133] A keyhole limpet hemocyanin (KLH)-peptide conjugate was prepared and used to immunize Balb/C mice. The mice developed antibodies which reacted with native human mesothelin, indicating that the anti-peptide antibodies also recognize native human mesothelin.
[0134] Hybridomas were made from spleen cells of these mice, and clones were isolated that produced antibodies that reacted by enzyme-linked immunosorbent assay (ELISA) with Fc-mesothelin 296-599. The sequences of the Fv regions of the antibodies and the hybridomas produced are shown in Table 1. These antibodies are 15B6 (IgG 2b), 2B4 (IgG 2a), and 7B5 (IgG 1).
TABLE-US-00001 TABLE1 GHYMH(SEQIDNO:2) 2B4(IgG2a) VHCDR1 RINPYTGAINYNQNFKD(SEQIDNO:3) 2B4(IgG2a) VHCDR2 DLGGGY(SEQIDNO:4) 2B4(IgG2a) VHCDR3 RSSTGAVTTSNYAN(SEQIDNO:5) 2B4(IgG2a) VLCDR1 GTNNRAP(SEQIDNO:6) 2B4(IgG2a) VLCDR2 ALWYSSHWV(SEQIDNO:7) 2B4(IgG2a) VLCDR3 GHYMH(SEQIDNO:8) 7B5(IgG1) VHCDR1 RINPYTGAINYNQNFKD(SEQIDNO:9) 7B5(IgG1) VHCDR2 DLGGGY(SEQIDNO:10) 7B5(IgG1) VHCDR3 RSSTGAVTTSNYAN(SEQIDNO:11) 7B5(IgG1) VLCDR1 GTNNRAP(SEQIDNO:12) 7B5(IgG1) VLCDR2 ALWFGSHWV(SEQIDNO:13) 7B5(IgG1) VLCDR3 GYYMH(SEQIDNO:14) 15B6(IgG2b) VHCDR1 RINPYTGVPSYKHNFKD(SEQIDNO:15) 15B6(IgG2b) VHCDR2 ELGGY(SEQIDNO:16) 15B6(IgG2b) VHCDR3 RSSTGAVTTGNYPN(SEQIDNO:17) 15B6(IgG2b) VLCDR1 GTNNRAP(SEQIDNO:18) 15B6(IgG2b) VLCDR2 ALWFSSHWV(SEQIDNO:19) 15B6(IgG2b) VLCDR3 EVQLQQSGPELVKPGASVKISCKASGYPFTGHYM 2B4(IgG2a) VH HWVKQGHVKSLEWIGRINPYTGAINYNQNFKDKA SLSVEKSSSTAYMGLHSLTSEDSAVYYCVRDLGGG YWGQGTTLTVSS(SEQIDNO:20) QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNY 2B4(IgG2a) VL ANWVQEKPDHLFTGLIAGTNNRAPGVPARFSGSLIG DKAALTITGAQPEDEAIFFCALWYSSHW VFGGGTKLTVL(SEQIDNO:21) EVQLQQSGPELVKPGTSVKISCKASGYPFTGHYMHW 7B5(IgG1) VH VKQGHVKSLEWIGRINPYTGAINYNQNFKDKASLTV EKSSSTAYMGLHSLTSEDSAVYYCVRDLGGGYWGQ GTTLTVSS(SEQIDNO:22) QAVVTQESALTTSPGETVTLTCRSSTGAVT 7B5(IgG1) VL TSNYANWVQEKPDHLFTGLIAGTNNRAPGV PARFSGSLIGDKAALTITGAQPEDEAMFFCAL WFGSHWVFGGGTKLTVL(SEQIDNO:23) EVQLQQSGPVLVKPGASVKISCKASGYSFTGY 15B6(IgG2b) VH YMHWVRQSLVKRLEWIGRINPYTGVPSYKHNF KDKASLTVDKSSSTAYMELHSLTSEDSAVYYCA RELGGYWGQGTTLTVSS(SEQIDNO:24) QAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPN 15B6(IgG2b) VL WVQEKPDHLFTGLIAGTNNRAPGVPARFSGSLIGDK AALTITGAQTEDEAIYFCALWFSSHWVFGGGTKLTVL (SEQIDNO:25)
EXAMPLE 2
[0135] This example demonstrates that the antibodies of Example 1 bind to mesothelin on A431/M cells.
[0136] Binding assays were conducted with A431/M cells using FACS. A431/MSLN(M) cells were transfected with a MSLN(M) expression plasmid. Cells (10.sup.6) were incubated with monoclonal antibodies at concentrations ranging from 0.01 to 100 ng/ml for one hour. After the cells were washed, anti-mouse IgG-PE conjugates were added. The PE signal was detected and measured in Geometric Mean values by FACS. The results are shown in
EXAMPLE 3
[0137] This example demonstrates that the antibodies of Example 1 are specific for the carboxyl (C) terminus of mesothelin.
[0138] The monoclonal antibodies of Example 1 were also tested for binding to the AB1-L9 cell line, which was transfected with a plasmid encoding a portion of mesothelin (MSLN) attached to a mouse transferrin receptor (TFR) membrane spanning region and is missing the sequences in the peptide used for making the hybridomas. This transfected gene contains mesothelin (296-585) attached to TFR transmembrane domain LCFAAIALVIFFLIGFMSGYLGYG (SEQ ID NO: 64). Although the expression of mesothelin in transfected cells was confirmed by MN (control) antibody, none of the monoclonal antibodies bound to the AB1-L9 cell, indicating that they are specific for the C terminus of mesothelin (residues 584-598). These data indicate that the antibodies of Example 1 are specific for the C terminus of mesothelin.
EXAMPLE 4
[0139] This example demonstrates that the 15B6 antibody of Example 1 strongly binds to cancer cell lines known to express mesothelin.
[0140] The monoclonal 15B6 antibodies of Example 1 were tested for binding to cell lines KLM-1 (pancreatic cancer cell line), RH29 (mesothelioma), and A431/M, a cell line transfected with a mesothelin variant with M at position 593. 10.sup.6 cells of A431/M were incubated with the 15B6 antibodies of Example 1 at concentrations ranging from 1 to 10,000 ng/ml for one hour. 10.sup.6 cells of RH29 were incubated with the 15B6 antibodies of Example 1 at concentrations ranging from 0.001 to 10 ug/ml for one hour. 10.sup.6 cells of KLM-1 were incubated with the antibodies of Example 1 at concentrations ranging from 1 to 10,000 ng/ml for one hour. After washing the cells, anti-mouse IgG-PE conjugate was added.
[0141]
[0142]
[0143]
EXAMPLE 5
[0144] This example demonstrates that the 15B6 antibody of Example 1 binds to MSLN(M)-rFc.
[0145] One microgram per milliliter of MSLN(M)-rFc protein was coated on an ELISA plate. After overnight incubation, concentrations of antibody 15B6 ranging from less than 0.1 to 100 ng/ml were added. The amount of bound 15B6 was detected with anti-mouse IgG-HRP conjugates. 3,3,5,5-Tetramethylbenzidine (TMB) substrate was added and the OD 450 was determined with a micro plate reader. MN was used as the control antibody. The ELISA results are shown in
EXAMPLE 6
[0146] This example demonstrates that the 15B6 antibody of Example 1 binds to MSLN(V)-rFc.
[0147] One microgram per milliliter of MSLN(V)-rFc protein was coated on an ELISA plate. After overnight incubation, concentrations of antibody 15B6 ranging from less than 0.1 to 100 ng/ml were added. The amount of bound 15B6 was detected with anti-mouse IgG-HRP conjugates. TMB substrate was added and the OD 450 was determined with a micro plate reader. MN was used as the control antibody. The ELISA results are shown in
EXAMPLE 7
[0148] This example demonstrates that the 15B6 antibody of Example 1 dramatically reduces mesothelin shedding.
[0149] RH29 mesothelioma cells (3.510.sup.5) were incubated with various amounts of antibody (300 ug/ml or 50 ug/ml) for 2-4 days and the amount of mesothelin shed in the medium was measured by ELISA. MPC11 antibody was used as the control. Samples were taken on days 2, 3, and 4 (shown in
EXAMPLE 8
[0150] This example demonstrates that the antibodies of Example 1 compete with LVLDL peptide (SEQ ID NO: 63).
[0151] A competition assay was completed using the following peptides: peptide 1 having the sequence CLVLDLSMQEALS (SEQ ID NO: 61) and peptide 2 having the sequence CSMQEALS (SEQ ID NO: 62). An ELISA plate was coated with MSLN(M)-Fc or MSLN(V)-Fc. After overnight incubation, the plates were blocked and washed. The anti-mesothelin stalk antibodies of Example 1 (30 ng/ml) and peptide 1 or peptide 2 were added at different concentrations (100 micrograms/ml to 0.00001 micrograms/ml). After washing, anti-mouse IgG-HRP conjugate were added. The OD was then measured with ELISA.
[0152] The antibodies of Example 1 competed with peptide 1 but not peptide 2, which indicates that 587-LVLDL-591 (SEQ ID NO: 63) provides strong binding, although the other residues of IPNGYLVLDLSMQEALS could contribute to binding (see
EXAMPLE 9
[0153] This example demonstrates that the antibodies of Example 1 reduce mesothelin shedding.
[0154] The monoclonal antibodies were tested for their ability to reduce the shedding of mesothelin by cell line KLM-1 (100% M variant) and RH29 (V and M variant ratio 50:50). The cells (310.sup.5 cells) on Day -1 were placed in a 6 well plate in medium (2 ml). On Day 0 the medium was removed and 2 ml of fresh medium was added with or without the antibodies of the present invention (50 micrograms/ml). One hundred microliters of supernatant was removed on Days 1, 2, and 3 and the soluble mesothelin amount was deteiinined by ELISA. As seen in
EXAMPLE 10
[0155] This example demonstrates that antibodies of Example 1 bind to MSLN(V)-rFc and MSLN(M)-rFc variants.
[0156] An ELISA plate was coated with variants MSLN(M)-Fc or MSLN(V)-Fc. After washing, antibodies 15B6, 2B4, and 7B5 were added at concentrations ranging from less than 1 to more than 100 ng/ml. The amount of bound antibody was detected using anti-mouse IgG-horseradish peroxidase (HRP).
EXAMPLE 11
[0157] This example relates to the RH29 cell growth inhibition attributable to 15B6 antibodies of Example 1 observed.
[0158] RH29 cells were treated with 15B6 antibodies of Example 1 at concentrations ranging from less than 0.1 to 100 ug/ml to determine if they would inhibit growth of these cells. MN was used as the control antibody. The number of viable cells after 72 hours was measured by a WST-8 cell proliferation assay kit. The WST-8 proliferation assay (OD 450) results are shown in
[0159] All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein.
[0160] The use of the terms a and an and the and similar referents in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The terms comprising, having, including, and containing are to be construed as open-ended terms (i.e., meaning including, but not limited to,) unless otherwise noted. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.
[0161] Preferred embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.