ZAG-DERIVED PEPTIDE AND USE THEREOF

20200246428 ยท 2020-08-06

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a zinc-alpha-2-glycoprotein (ZAG) protein-derived peptide and a use thereof. The ZAG protein-derived peptide according to the present invention shows an expression reducing effect of various immune factors shown in acute or chronic atopic dermatitis, and has a decreased immune response and decreased IgE expression and thus may be used to prevent, treat or improve xeroderma or an abnormal skin barrier function such as atopic dermatitis, an allergic disease or inflammation.

Claims

1. A method of treating or improving xeroderma or an abnormal skin barrier function, which comprises administering a therapeutically or physiologically effective amount of a zinc-alpha-2-glycoprotein (ZAG) protein-derived peptide into a subject in need thereof.

2. The method of claim 1, wherein the ZAG protein-derived peptide is a peptide consisting of an amino acid sequence of 10-mer or more and 50-mer or less, which includes a fragment of the ZAG protein.

3. The method of claim 2, wherein the fragment of the ZAG protein consists of a 10-mer to 30-mer contiguous amino acid sequence among the amino acid sequence constituting the ZAG protein.

4. The method of claim 2, wherein the fragment of the ZAG protein consists of any one amino acid sequence selected from SEQ ID NOs: 1 to 19.

5. The method of claim 1, wherein the fragment of the ZAG protein consists of any one amino acid sequence selected from SEQ ID NOs: 20 to 26.

6-10. (canceled)

11. A method of treating or improving an allergic disease, which comprises administering a therapeutically or physiologically effective amount of a zinc-alpha-2-glycoprotein (ZAG) protein-derived peptide in need thereof.

12. The method of claim 11, wherein the ZAG protein-derived peptide is a peptide consisting of an amino acid sequence of 10-mer or more and 50-mer or less, which includes a fragment of the ZAG protein.

13. The method of claim 12, wherein the fragment of the ZAG protein consists of a 10-mer to 30-mer contiguous amino acid sequence among the amino acid sequence constituting the ZAG protein.

14. The method of claim 12, wherein the fragment of the ZAG protein consists of any one amino acid sequence selected from SEQ ID NOs: 1 to 19.

15. The method of claim 12, wherein the fragment of the ZAG protein consists of any one amino acid sequence selected from SEQ ID NOs: 20 to 26.

16. A method of treating or improving inflammation, which comprises administering a therapeutically or physiologically effective amount of a zinc-alpha-2-glycoprotein (ZAG) protein-derived peptide in need thereof.

17. The method of claim 16, wherein the ZAG protein-derived peptide is a peptide consisting of an amino acid sequence of 10-mer or more and 50-mer or less, which includes a fragment of the ZAG protein.

18. The method of claim 17, wherein the fragment of the ZAG protein consists of a 10-mer to 30-mer contiguous amino acid sequence among the amino acid sequence constituting the ZAG protein.

19. The method of claim 17, wherein the fragment of the ZAG protein consists of any one amino acid sequence selected from SEQ ID NOs: 1 to 19.

20. The method of claim 17, wherein the fragment of the ZAG protein consists of any one amino acid sequence selected from SEQ ID NOs: 20 to 26.

Description

BRIEF DESCRIPTION OF DRAWINGS

[0050] FIG. 1 shows the result of in vitro efficacy testing of each peptide against atopic dermatitis. (a) is the result for RAW 264.7 macrophages, (b) is the result for RBL-2H3 mast cells, (c) is the result for keratinocytes, (d) is the result for B lymphocytes, and (e) is the result for T lymphocytes.

[0051] FIG. 2 is the result of in vitro efficacy testing of each peptide listed in Table 4 against atopic dermatitis. (a) shows the result for RAW 264.7 macrophages, (b) shows the result for RBL-2H3 mast cells, (c) shows the result for keratinocytes, (d) is the result for B lymphocytes, and (e) shows the result for T lymphocytes.

MODES OF INVENTION

[0052] Hereinafter, the advantages and features of the present invention and the methods of accomplishing the same will become apparent with reference to the detailed description of exemplary embodiments and the accompanying drawings. However, the present invention is not limited to the exemplary embodiments disclosed below, and may be embodied in many different forms. These exemplary embodiments are merely provided to complete the disclosure of the present invention and fully convey the scope of the present invention to those of ordinary skill in the art, and the present invention should be defined by only the accompanying claims.

Preparation Example 1. Synthesis and Isolation of Peptide

[0053] To identify a peptide including an active site in the ZAG protein, in the entire sequence of 298 amino acids (GenBank: AAH05306.1; SEQ ID NO: 19), 18 peptide candidate groups (Z1 to Z18, SEQ ID NOs: 1 to 18, respectively) were established such that 15 amino acids overlapped. Each peptide was prepared by solid-phase peptide synthesis. It was confirmed by HPLC analysis that the synthesized peptide of the present invention has a purity of 90% or more. The molecular weight of the purified peptide was confirmed by mass spectrometry (Table 1: Peptide candidate groups and amino acid sequences used to identify ZAG protein active site).

TABLE-US-00001 TABLE1 SEQ Nameof M.W. ID peptide (g/mol) Sequence NO. Z1 3443.74 QENQDGRYSLTYIYTGLSKHVEDVPAFQAL 1 Z2 3589.04 GSLNDLQFFRYNSKDRKSQPMGLWRQVEGM 2 Z3 3751.07 EDWKQDSQLQKAREDIFMETLKDIVEYYND 3 Z4 3485.73 SNGSHVLQGRFGCEIENNRSSGAFWKYYYD 4 Z5 3520.96 GKDYIEFNKEIPAWVPFDPAAQITKQKWEA 5 Z6 3604.16 EPVYVQRAKAYLEEECPATLRKYLKYSKNI 6 Z7 3370.85 LDRQDPPSVVVTSHQAPGEKKKLKCLAYDF 7 Z8 3344.62 YPGKIDVHWTRAGEVQEPELRGDVLHNGNG 8 Z9 3296.64 TYQSWVVVAVPPQDTAPYSCHVQHSSLAQP 9 Z10 3396.73 GLSKHVEDVPAFQALGSLNDLQFFRYNSKD 10 Z11 3661.07 RKSQPMGLWRQVEGMEDWKQDSQLQKARED 11 Z12 3535.93 PFDPAAQITKQKWEAEPVYVQRAKAYLEEE 12 Z13 3457.97 CPATLRKYLKYSKNILDRQDPPSVVVTSHQ 13 Z14 3478.88 IFMETLKDIVEYYNDSNGSHVLQGRFGCEI 14 Z15 3691.00 ENNRSSGAFWKYYYDGKDYIEFNKEIPAWV 15 Z16 3420.95 APGEKKKLKCLAYDFYPGKIDVHWTRAGEV 16 Z17 3306.57 QEPELRGDVLHNGNGTYQSWVVVAVPPQDT 17 Z18 3215.56 AVPPQDTAPYSCHVQHSSLAQPLVVPWEAS 18

Example 1. Selection of Peptide by In Vitro Efficacy Test Against Atopic Dermatitis

[0054] To select an amino acid sequence corresponding to a key active site of ZAG having efficacy in the alleviation of atopic symptoms from 18 peptide candidate groups, an atopic dermatitis efficacy test was performed. Five types of immune-related cells were treated with ZAG peptide candidate groups (Z1-Z18, SEQ ID NOs: 1 to 18, respectively) and the ZAG protein (Z0, SEQ ID NOs: 19) at a concentration of 1 g/mL for 24 hours, and then treated with a stimulator suitable for each cell line for the listed time to confirm an immune response. The experiment was performed with a group treated with only a stimulator as a positive control experimental group, and a group treated with only a vehicle without a stimulator as a negative control experimental group (Table 2: Efficacy test method for atopic dermatitis). An inflammatory response-related enzyme used as a stimulator is produced by immune cells, and histamine initiates an inflammatory response. The immune cells migrating to a damaged region release cytokines such as tumor necrosis factor- (TNF-) and interleukin-6 (IL-6) to directly lyse foreign invasive substances or collect other immune cells to initiate an inflammatory response. An efficacy test using inflammation-inducing materials, interferon- and skin inflammation-related factor CCL-17/thymus- and activation-regulated chemokine (TARC) was also performed to confirm an immune response.

TABLE-US-00002 TABLE 2 Stimulator Vehicle Time Inflammatory Cell Type concentration (diluent) duration target RAW 264.7 LPS 0.1 g/mL PBS 24 hours IL-6 (Macrophage) RBL-2H3 PMA 1 g/mL, DMSO 12 hours Histamine (Mast cell) A23187 1 g/mL RPMI 1788 LPS 0.1 g/mL PBS 24 hours IgE (B-lymphocyte) HaCaT TNF- 0.4 g/mL, PBS 24 hours CCL17/ (Keratinocyte) IFN- 0.4 g/mL TARC T-lymphocyte IL-2 50 ng/mL PBS 12 hours IL-4

Example 1-1. Atopic Dermatitis Efficacy Test Using Macrophages

[0055] Macrophages (RAW 264.7 cells) were treated with a stimulator LPS at a concentration of 0.1 g/mL for 24 hours, and then the concentration of IL-6 released in a cell culture medium was confirmed by ELISA assay. In the experimental groups treated with Z0, Z1 to Z10, and Z14, compared with an experimental group only treated with a stimulator, the IL-6 concentration was significantly decreased (FIG. 1A).

Example 1-2. Atopic Dermatitis Efficacy Test Using Mast Cells

[0056] Mast cells (RBL-2H3) were treated with 1 g/mL of PMA and 1 g/mL of A23187 as stimulators for 12 hours, and a concentration of histamine released in a cell culture medium was confirmed by ELISA assay. In the experimental groups treated with Z0, Z1 to Z11, Z14, Z15, Z17, and Z18, compared with an experimental group only treated with the stimulators, the histamine concentration was significantly decreased (FIG. 1B).

Example 1-3. Atopic Dermatitis Efficacy Test Using Keratinocytes

[0057] Keratinocytes (HaCaT cells) were treated with 0.4 g/mL of TNF- and 0.4 g/mL of IFN- as stimulators for 24 hours, and then a concentration of CCL17/TARC released in a cell culture medium was confirmed by ELISA assay. In the Z0, Z1 to Z8, Z10, Z12 to Z14 and Z18 groups, the CCL17/TARC concentration was significantly decreased (FIG. 1C).

Example 1-4. B Atopic Dermatitis Efficacy Test Using B Lymphocytes

[0058] B lymphocytes (RPMI 1788) were treated with 0.1 g/mL of LPS as a stimulator for 24 hours, and a concentration of IgE released in a cell culture medium was confirmed by ELISA assay. In the Z0, Z3 to Z8, Z12 to Z14 and Z16 to Z18 groups, IgE was significantly decreased (FIG. 1D)

Example 1-5. T Atopic Dermatitis Efficacy Test Using T Lymphocytes

[0059] An atopic dermatitis efficacy test using T lymphocytes was performed with six peptide candidate groups (Z3, Z4, Z5, Z12, Z14, and Z15), which were determined to have efficacy from the results of Examples 1-1 to 1-4 described above. T lymphocytes were treated with 50 ng/mL of IL-2 as a stimulator for 12 hours, and a concentration of IL-4 released in a cell culture medium was confirmed by ELISA assay. Here, in the Z3, Z4, Z5, Z12, Z14, and Z15-treated sample groups, IL-4 was significantly decreased (FIG. 1E).

[0060] As a result of the atopic dermatitis efficacy test with the five cell lines, the Z3 peptides have efficacy in all cell lines and were confirmed as a material that can be used against atopic dermatitis (Table 3).

TABLE-US-00003 TABLE 3 Result of efficacy test for ZAG protein-derived peptides Cell line RAW RBL- HaCaT B lympho- T lympho- 264.7 2H3 (human) cyte cyte (mouse) (rat) CCL17/ (human) (human) target IL-6 Histamine TARC IgE IL-4 Z0 (AZGP1) Z1 Z2 Z3 Z4 Z5 Z6 Z7 Z8 Z9 Z10(Z1-2) Z11(Z2-2) Z12(Z5-2) Z13(Z6-2) Z14(Z3-2) Z15(Z4-2) Z16(Z4-2) Z17(Z8-2) Z18(Z9-2)

Preparation Example 2. Additional Synthesis of ZAG-Derived Peptides

[0061] Based on the ZAG3 peptide (ZAG3) selected as the key active site of ZAG having efficacy in the alleviation of atopic symptoms from 18 peptide candidate groups (Z1 to Z18), ZAG3-derived oligopeptides were additionally synthesized (Table 4). Each peptide in Table 4 was synthesized by solid-phase peptide synthesis. It was confirmed by HPLC that the synthesized peptide in the present invention has a purity of 90% or more. The molecular weight of the purified peptide was confirmed by mass spectrometry.

TABLE-US-00004 TABLE4 Peptidecandidategroupsandaminoacidsequences usedtoidentifytheactivesiteofZAGproteins SEQ Nameof M.W. ID peptide (g/mol) Sequence NO. Z20mer-1 2497.69 EDWKQDSQLQKAREDIFMET 20 Z20mer-2 2379.68 DSQLQKAREDIFMETLKDIV 21 Z20mer-3 2492.75 KAREDIFMETLKDIVEYYND 22 Z15mer-1 1875.98 EDWKQDSQLQKARED 23 Z15mer-2 1811.02 DSQLQKAREDIFMET 24 Z15mer-3 1808.14 KAREDIFMETLKDIV 25 Z15mer-4 1893.16 IFMETLKDIVEYYND 26

Example 2. Selection of Peptide by In Vitro Atopic Dermatitis Efficacy Test

[0062] To select an amino acid sequence having a superior effect from additionally synthesized Z20mer-1, Z20mer-2, Z20mer-3, Z15mer-1, Z15mer-2, Z15mer-3 and Z15mer-4 peptides, an atopic dermatitis efficacy test was performed. Various types of immune cells were treated with each of Z20mer-1, Z20mer-2, Z20mer-3, Z15mer-1, Z15mer-2, Z15mer-3 and Z15mer-4 at a concentration of 1 g/mL for 24 hours, and then treated with a stimulator suitable for each cell line for the listed time to confirm an immune response. The atopic dermatitis efficacy test method was performed by the same method as described in Example 1 and Table 2.

[0063] The experiment was performed with experimental groups: 1) negative control: vehicle-treated group (Neg), 2) positive control: a group treated with only a stimulator (Pos), and 3) experimental group: groups treated with a stimulator and ZAG3 or a ZAG3-derived oligopeptide (Z20mer-1, Z20mer-2, Z20mer-3, Z15mer-1, Z15mer-2, Z15mer-3 or Z15mer-4). Concentrations were measured from cell culture by ELISA.

Example 2-1. Atopic Dermatitis Efficacy Test Using Macrophages

[0064] Macrophages (RAW 264.7 cells) were treated with a stimulator LPS at a concentration of 0.1 g/mL for 24 hours, and then a concentration of IL-6 released in a cell culture medium was confirmed by ELISA assay. As compared with the positive control (Pos), the IL-6 concentration was significantly decreased in the ZAG3, 20mer-3, 15mer-1, 15mer-2, 15mer-3 and 15mer-4-treated groups (FIG. 2A)

Example 2-2. Atopic Dermatitis Efficacy Test Using Mast Cells

[0065] Mast cells (RBL-2H3) were treated with 1 g/mL of PMA and 1 g/mL of A23187 as simulators for 12 hours, and then a concentration of histamine released in a cell culture medium was confirmed by ELISA assay. As compared with the positive control (Pos), in all of the oligopeptide-treated groups, the histamine release was reduced (FIG. 2B).

Example 2-3. Atopic Dermatitis Efficacy Test Using Keratinocytes

[0066] Keratinocytes (HaCaT cells) were treated with 0.4 g/mL of TNF- and 0.4 g/mL of IFN- as stimulators for 24 hours, and then a concentration of CCL17/TARC released in a cell culture medium was confirmed by ELISA assay. As compared with the positive control (Pos), the CCL17/TARC concentration was significantly decreased in the ZAG3, 20mer-1, 15mer-3 and 15mer-4-treated groups (FIG. 2C).

Example 2-4. Atopic Dermatitis Efficacy Test Using B Lymphocytes

[0067] B lymphocytes (RPMI 1788) were treated with 0.1 g/mL of LPS as a stimulator for 24 hours, and then a concentration of IgE released in a cell culture medium was confirmed by ELISA assay. As compared with the positive control (Pos), in all of the oligopeptide-treated groups, IgE was reduced (FIG. 2D).

Example 2-5. Atopic Dermatitis Efficacy Test Using T Lymphocytes

[0068] An experiment was performed on T lymphocytes using the target peptides selected through the previous experiment. As compared with the positive control (Pos), in all of the oligopeptide-treated groups (Z20mer-1, Z20mer-2, Z20mer-3, Z15mer-1, Z15mer-2, Z15mer-3, and Z15mer-4), IL-4 was reduced (FIG. 2E).

[0069] The test results of the comparative analysis for the efficacy of the total peptide which had been subjected to the atopic dermatitis efficacy test with five types of cell lines have statistical significance, determining as effective, compared with the positive control, and it was confirmed that the peptide is a material that can be used against atopic dermatitis (Table 5).

TABLE-US-00005 TABLE 5 Results of efficacy test for ZAG protein-derived peptides Cell line RAW RBL- HaCaT B lympho- T lympho- 264.7 2H3 (human) cyte cyte (mouse) (rat) CCL17/ (human) (human) target IL-6 Histamine TARC IgE IL-4 Z20mer-1 Z20mer-2 Z20mer-3 Z15mer-1 Z15mer-2 Z15mer-3 Z15mer-4