Compositions and methods for diagnosing and treating inflammatory bowel disease and related disorders

10730916 ยท 2020-08-04

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention features biomarkers capable of diagnosing inflammatory bowel disease and methods of using such biomarkers to diagnose and selecting treatments for inflammatory bowel diseases.

Claims

1. A method for monitoring the condition of a subject having Crohn's disease, the method comprising: (a) contacting a microarray comprising a set of E. coli polypeptides comprising era, ybaN, yhgN, focA, gabT and ycdG, with sera derived from the subject; and (b) detecting in the subject's sera: (i) immunogenic reactivity to era relative to immunogenic reactivity to ybaN; (ii) immunogenic reactivity to yhgN relative to immunogenic reactivity to focA; and (iii) immunogenic reactivity to gabT relative to immunogenic reactivity to ycdG, wherein a reduction in the immunogenic reactivity of (i), (ii) and/or (iii) compared to the immunogenic reactivity of (i), (ii) and/or (iii) from an earlier time point identifies an improvement in the subject's condition, and an increase in the immunogenic reactivity of (i), (ii) and/or (iii) compared to the immunogenic reactivity of (i), (ii) and/or (iii) from the earlier time point identifies a worsening in the subject's condition, and wherein the microarray further comprises a set of E. coli polypeptides selected from the group consisting of rpsK, rpsL, sixA, ycfF, yhdN, yjhA, gntU, phnE, rcsC, thiS, ycfA, yfjV, aceB, agaZ, aidA, argB, argC, aroF, aroK, aspA, atpB, baiF, basS, cedA, citB, citG, clpX, cysD, cysJ, cysM, cysW, dgxA, dicC, dinD, ecnB, eno, fadB, fba, fdhE, fecB, fecR, fimB, fimC, fliA, fliS, flxA, folP, frvX, ftn, fumB, gabD, galR, gcpE, glvB, grxA, grxC, gst, hemX, hflX, hisS, hofH, hoxK, hsdM, hycA, hycF, hypC, ibpB, infC, ivbL, lasT, LDR-ABC, LDR-D, lldR, mcrD, metB, metJ, mltB, mviN, narY, nuoE, phbA, phnB, phnG, phnM, ppdB, ptpS, ptsN, purM, radC, rbfA, rbsB, recN, rffD, rpiB, rplP, rplQ, rplT, rpmJ, rpsG, rpsR, selD, slyA, slyD, ssi6, sugE, tdcB, thiF, torA, trmD, ubiG, umuD, vacJ, wcaA, ybbA, ybbQ, ycbF, ycdB, yceD, ycgN, ydfA, ydfD, ydfR, ydhL, ydiL, yedF, yehR, yejG, yejO, yfeC, yfhD, yfiC, yfiD, yfjI, yfjQ, ygbA, ygbD, ygbO, ygcQ, ygeW, ygfY, yhaA, yhaC, yhaN, yhcI, yhcJ, yhfR, yhfV, yhgH, yhgI, yicC, yieF, yieJ, yigK, yihA, yihD, yihK, yiiF, yijD, yijF, yjaI, yjbI, yjbL, yjbQ, yjbR, yjcS, yjeB, yjeJ, yjgF, yjhC, yjhE, yjhF, yjhO, yjiA, yliG, ymfE, yohL, yphC, yrbB, yhcP, yhhT, yhiW, aceF, allP, ansP, aqpZ, atoE, brnQ, celD, cobU, codB, cybB, cydB, cydC, dgt, dnaQ, ebgA, emrB, emrD, exuR, fabH, fabZ, fadA, fepD, flhD, glnQ, glpF, gppA, greA, hemY, JW0438, JW1949, lipA, lpxC, malX, malZ, menG, mrdB, murG, mutT, narU, nfrB, nrfE, ompC, oppC, oppF, pbuX, pheP, phsE, pnuC, potC, pssR, ptsH, putP, queA, rfaL, rffG, rocE, rplO, sdhD, secB, sfsA, slyX, sucB, sucD, tauB, thiL, trkH, udk, uidB, virK, yaaH, yabK, yadQ, yaeG, yagG, yagM, yaiV, yajR, ybdS, ybfB, ybfC, ybgE, ybhA, ybhL, ybhM, ybhN, ybhR, ycaD, yccY, yciQ, yciR, yciS, ydcD, yddH, ydeF, ydeZ, ydfO, ydjS, ydjZ, yeaS, yehK, yehY, yejF, yfjY, ygeD, ygfF, yggH, yghK, yghT, ygj Q, yhaH, yhaO, yhbX, yhcO, yhdM, yhdT, yheG, yheU, yhfU, yhhL, yhhS, yhiP, yhiQ, yhjX, yiaL, yiaQ, yibL, yibQ, yicO, yidY, yifE, yigF, yihG, yjeM, yjfF, yjfP, yjfY, yjhB, ymdD, ynaJ, yneC, yneG, ynjC, yoaA, yohG, yphA, yphG, yqcE, and yzgL, or fragments thereof.

2. A method for monitoring the condition of a subject having Crohn's disease, the method comprising: (a) contacting a microarray comprising a set of E. coli polypeptides comprising era, ybaN, yhgN, focA, gabT and ycdG, with sera derived from the subject; and (b) detecting in the subject's sera: (i) immunogenic reactivity to era relative to immunogenic reactivity to ybaN; (ii) immunogenic reactivity to yhgN relative to immunogenic reactivity to focA; and (iii) immunogenic reactivity to gabT relative to immunogenic reactivity to ycdG, wherein a reduction in the immunogenic reactivity of (i), (ii) and/or (iii) compared to the immunogenic reactivity of (i), (ii) and/or (iii) from an earlier time point identifies an improvement in the subject's condition, and an increase in the immunogenic reactivity of (i), (ii) and/or (iii) compared to the immunogenic reactivity of (i), (ii) and/or (iii) from the earlier time point identifies a worsening in the subject's condition, and wherein the microarray further comprises a set of E. coli polypeptides selected from the group consisting of rtn, cadA, lueO, mesJ, mhpF, modC, murA, nrfF, prpE, purK, tpiA, yciD, yejA, ygcE, ygfQ, yhjC, yjfH, yjiJ, yeeF, dgkA, dinI, emrY, folK, fsr, glnD, kch, maoC, msbA, nac, nagE, narI, ppx, prtC, rfaB, secF, secY/prlA, trkG, yafJ, yaiM, ybbC, ycbM, ydaA, ydbD, ydhV, yefI, yeiO, ygjR, yhiN, yjgT, yojl, yphD, yhcP, yhhT, yhiW, aceF, allP, ansP, aqpZ, atoE, brnQ, celD, cobU, codB, cybB, cydB, cydC, dgt, dnaQ, ebgA, emrB, emrD, exuR, fabH, fabZ, fadA, fepD, flhD, glnQ, glpF, gppA, greA, hemY, JW0438, JW1949, lipA, lpxC, malX, malZ, menG, mrdB, murG, mutT, narU, nfrB, nrfE, ompC, oppC, oppF, pbuX, pheP, phsE, pnuC, potC, pssR, ptsH, putP, queA, rfaL, rffG, rocE, rplO, sdhD, secB, sfsA, slyX, sucB, sucD, tauB, thiL, trkH, udk, uidB, virK, yaaH, yabK, yadQ, yaeG, yagG, yagM, yaiV, yajR, ybdS, ybfB, ybfC, ybgE, ybhA, ybhL, ybhM, ybhN, ybhR, ycaD, yccY, yciQ, yciR, yciS, ydcD, yddH, ydeF, ydeZ, ydfO, ydjS, ydjZ, yeaS, yehK, yehY, yejF, yfjY, ygeD, ygfF, yggH, yghK, yghT, ygjQ, yhaH, yhaO, yhbX, yhcO, yhdM, yhdT, yheG, yheU, yhfU, yhhL, yhhS, yhiP, yhiQ, yhjX, yiaL, yiaQ, yibL, yibQ, yicO, yidY, yifE, yigF, yihG, yjeM, yjfF, yjfP, yjfY, yjhB, ymdD, ynaJ, yneC, yneG, ynjC, yoaA, yohG, yphA, yphG, yqcE, and yzgL, or fragments thereof.

3. A method for monitoring the condition of a subject having Crohn's disease, the method comprising: (a) contacting a microarray comprising a set of E. coli polypeptides comprising era, ybaN, yhgN, focA, gabT and ycdG, with sera derived from the subject; and (b) detecting in the subject's sera: (i) immunogenic reactivity to era relative to immunogenic reactivity to ybaN; (ii) immunogenic reactivity to yhgN relative to immunogenic reactivity to focA; and (iii) immunogenic reactivity to gabT relative to immunogenic reactivity to ycdG, wherein a reduction in the immunogenic reactivity of (i), (ii) and/or (iii) compared to the immunogenic reactivity of (i), (ii) and/or (iii) from an earlier time point identifies an improvement in the subject's condition, and an increase in the immunogenic reactivity of (i), (ii) and/or (iii) compared to the immunogenic reactivity of (i), (ii) and/or (iii) from the earlier time point identifies a worsening in the subject's condition, and wherein the microarray further comprises a set of E. coli polypeptides selected from the group consisting of rpsK, rpsL, sixA, ycfF, yhdN, yjhA, gntU, phnE, rcsC, thiS, ycfA, yfjV, aceB, agaZ, aidA, argB, argC, aroF, aroK, aspA, atpB, baiF, basS, cedA, citB, citG, clpX, cysD, cysJ, cysM, cysW, dgxA, dicC, dinD, ecnB, eno, fadB, fba, fdhE, fecB, fecR, fimB, fimC, fliA, fliS, flxA, folP, frvX, ftn, fumB, gabD, galR, gcpE, glvB, grxA, grxC, gst, hemX, hflX, hisS, hofH, hoxK, hsdM, hycA, hycF, hypC, ibpB, infC, ivbL, lasT, LDR-ABC, LDR-D, lldR, mcrD, metB, metJ, mltB, mviN, narY, nuoE, phbA, phnB, phnG, phnM, ppdB, ptpS, ptsN, purM, radC, rbfA, rbsB, recN, rffD, rpiB, rplP, rplQ, rplT, rpmJ, rpsG, rpsR, selD, slyA, slyD, ssi6, sugE, tdcB, thiF, torA, trmD, ubiG, umuD, vacJ, wcaA, ybbA, ybbQ, ycbF, ycdB, yceD, ycgN, ydfA, ydfD, ydfR, ydhL, ydiL, yedF, yehR, yejG, yejO, yfeC, yfhD, yfiC, yfiD, yfjI, yfjQ, ygbA, ygbD, ygbO, ygcQ, ygeW, ygfY, yhaA, yhaC, yhaN, yhcI, yhcJ, yhfR, yhfV, yhgH, yhgI, yicC, yieF, yieJ, yigK, yihA, yihD, yihK, yiiF, yijD, yijF, yjaI, yjbI, yjbL, yjbQ, yjbR, yjcS, yjeB, yjeJ, yjgF, yjhC, yjhE, yjhF, yjhO, yjiA, yliG, ymfE, yohL, yphC, yrbB, rtn, cadA, lueO, mesJ, mhpF, modC, murA, nrfF, prpE, purK, tpiA, yciD, yejA, ygcE, ygfQ, yhjC, yjfH, yjiJ, yeeF, dgkA, dinI, emrY, folK, fsr, glnD, kch, maoC, msbA, nac, nagE, narI, ppx, prtC, rfaB, secF, secY/prlA, trkG, yafJ, yaiM, ybbC, ycbM, ydaA, ydbD, ydhV, yefI, yeiO, ygjR, yhiN, yjgT, yojl, and yphD, or fragments thereof.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is a schematic diagram showing the overall strategy used for the identification of novel serological biomarkers for inflammatory bowel disease using E. coli whole proteome chip. To fabricate the whole proteome chip, >4,000 E. coli proteins were cloned and expressed. These proteins were purified using high-throughput protein purification protocol and printed onto FullMoon slides using a ChipWriter Pro robot. 134 patient sera were collected from the Johns Hopkins Hospital for this analysis. These sera were screen by E. coli proteome chips. Two-level of data analyses were performed: (i) global IBD analysis was performed to identify differentially immunogenic proteins in healthy control, CD and ulcerative colitis using Significance Analysis of Microarray (SAM) and Gene Ontology (GO) enrichment analysis; and (ii) serological IBD biomarkers discovery using k-TSP algorithm.

(2) FIGS. 2A and 2B show representative images of E. coli proteome chips and a scatter plot, respectively. The proteome chip in FIG. 2A was probed with sera from Crohn's Disease patients and healthy controls, respectively. Two E. coli proteome chips probed with sera from a Crohn's Disease (CD) patient (left panel) and a healthy control (HC) (right panel). To identify the proteins that can be recognized by reactive serum antibodies, each E. coli protein chip was incubated with a serum from healthy control or Crohn's Disease, as illustrated in FIG. 1. Cy3-labeled anti-human immunoglobulin antibodies were then probed on the chips, allowing visualization of immunoreactive protein spots. The immunogenic profiles of both the IBD patients and healthy control were acquired by the resulting fluorescent signals. Green spots are spots of E. coli protein in the chips detected by serum antibodies, representing immunogenic reactions. The intensity of the protein spots reflects immunogenicity of the proteins. Middle panel shows some representative images of immunogenic spots of three pairs of specific proteins (see more information of these proteins in FIG. 5 and Tables 1-3) from these proteome chips. Every E. coli protein is spotted in duplicate on the chip. Crohn's Disease vs ulcerative colitis vs healthy control can be distinguished by comparing the signal intensities between protein spots on the E. coli proteome chips. FIG. 2B is a scatter plot showing duplicate spots are highly correlated with each other (R=0.985). Each point is the plot of the original protein spot expression vs. the technical replicate protein spot expression. All 4265 proteins of a single array are displayed in this scatter plot.

(3) FIGS. 3A to 3D show global immunogenic profiles of IBD patients' sera against E. coli proteins. FIG. 3A is a heatmap of 273 differentially immunogenic proteins between healthy controls (HC) and Crohn's Disease (CD) samples identified by SAM analysis. Yellow and blue colors indicate high and low immunogenic response, respectively. FIG. 3B is a heatmap of the 188 differentially immunogenic proteins between Crohn's Disease and ulcerative colitis samples identified by SAM analysis; and FIG. 3C illustrates 33 differentially immunogenic proteins between healthy controls and ulcerative colitis samples as identified by SAM analysis. Each row corresponds to a protein and each column corresponds to a sample. The expression level for each protein is normalized across the samples such that the mean is 0 and the standard deviation is 1. Blue and yellow indicates high and low immunogenic proteins, respectively. FIG. 3D is a Venn diagram of these differentially immunogenic proteins showing only limited overlapping among healthy control vs Crohn's Disease vs ulcerative colitis.

(4) FIG. 4 is a graph showing the distribution of the cellular component terms in the highly immunogenic response proteins of healthy controls (HC), CD and ulcerative colitis. Six Cellular Component terms from the Gene Ontology were examined. Cell projection term contains flagellum and fimbrium proteins. The main messages include: 1) approximately 80% of the highly immunogenic proteins are either membrane proteins in healthy control (p<0.0001), compared to only 37% of the top immunogenic proteins in Crohn's Disease patients (not statistically significant); 2) conversely, 30% of top immunogenic proteins in Crohn's Disease patients are intracellular proteins (p<0.05) compared to only 7% in healthy control (not statistically significant); 3) a significant higher percentage of cell wall proteins (26%) are immunogenic in ulcerative colitis (p<0.05) compared to those in healthy control and Crohn's Disease (not significant); and 4) a significant percentage of macromolecular complex proteins (16%; p<0.05) in Crohn's Disease compared to those in healthy control or ulcerative colitis (not statistically significant). No statistically significant enrichment of proteins of periplasmic space and cell projection were found in healthy control, Crohn's Disease and ulcerative colitis.

(5) FIGS. 5A to 5D show three heat maps showing that k-TSP identified the top three pairs of biomarkers that can discriminate controls from Crohn's Disease patients and protein spots. Each column of the heat maps represents the immunogenic reactivity by individual IBD patients or healthy control. Within a column, each row represents ratio of the immunogenic reactivity of a top scoring pair of proteins. The expression values represented are the ratio of immunogenic reactivity (fluorescent signal or intensity) to protein X divided by the signals to protein Y, referred to as the TSP ratio (X and Y being example proteins). If the immunogenic reactivity of a patient to protein X was greater than the reactivity to protein Y, the box will appear yellow, and blue for vice versa (see examples below). FIG. 5A depicts the classifier for healthy control vs Crohn's Disease (yellow=CD, blue=HC). For example, if immunogenic reaction against era is >ybaN, the subject is identifed as having Crohn's Disease and shows as yellow (light shading). If not, then its indicative of a healthy control (blue) (dark shading). FIG. 5B displays healthy control vs. ulcerative colitis classifier (yellow=ulcerative colitis, blue=healthy control). For example, if immunogenic reaction against relE is >cysE_wcaB, the subject is identified as having ulcerative colitis and shows as yellow, If not, then its indicative of it is classified as a healthy control (blue). FIG. 5C shows the Crohn's Disease vs. ulcerative colitis classifier (yellow=ulcerative colitis, blue=Crohn's Disease). If frvX is yidX, it is a ulcerative colitis (yellow), or else a CD (blue). See representative images of some of those protein pairs in FIG. 2. FIG. 5D shows representative protein spots that were differentially recognized by sera from Crohn's Disease vs ulcerative colitis, respectively. This figure shows the relative immunogenic reactivity (fluorescent signals) of frvX and yidX by serum antibodies from a CD and ulcerative colitis patient.

(6) FIGS. 6A-6C are scatter plots showing the immunogenic reactivity (signal) of the samples to era and ybaN individually (FIGS. 6A & B, respectively) and the TSP ratio (era/ybaN). FIG. 6C shows that immunogenic reactivity to era or ybaN alone (the top scoring pair in the HC vs CD k-TSP classifier) does not allow for class separation of the data; no threshold level would clearly separate healthy controls from Crohn's Disease. However, the ratio of the two features (top-scoring pair ratio) results in clear separation in the data lending well to classification FIG. 6C. Similar results were found when scatter plot analysis were done for the other two TSP pairs from the HC vs Crohn's Disease classifier as shown in FIG. 5A.

(7) FIGS. 7A and 7B show scatter plots of immunoreactivity of OmpC and fliC, respectively, which were carried out as described in FIG. 6C. The present study found that OmpC and fliC (Cbir), two of the known serological markers, performed poorly in the present study. The scatter plots display the normalized immunogenic signal to each protein for every serum sample. The samples are separated along the x-axis according to class (healthy control, CD, and ulcerative colitis). Both statistical analysis and visual inspection demonstrate that antibodies against neither protein are capable of discriminating among the classes.

DETAILED DESCRIPTION OF THE INVENTION

(8) The present invention provides biomarkers for use in serological testing for inflammatory bowel disease, and methods of using such markers to distinguish among intestinal disorders and selected effective therapies.

(9) The invention is based, at least in part, on the discovery of new serological markers using a whole E. coli proteome microarray as a novel high-throughput proteomic approach to screening and identifying IBD markers. Each protein array, which contains 4,256 E. coli K12 proteins, was screened using individual serum from healthy controls (n=39) and clinically well-characterized patients with IBD [66 Crohn's disease (CD) and 29 ulcerative colitis (UC)]. Proteins that could be recognized by serum antibodies were visualized and quantified using Cy3-labeled goat anti-human antibodies. Surprisingly, SAM (significant analysis of microarray) analysis identified a total of 417 E. coli proteins that were differentially recognized by serum antibodies between healthy controls and Crohn's Disease or ulcerative colitis. Among those, 169 proteins were identified as highly immunogenic in healthy controls, 186 proteins are highly immunogenic in Crohn's Disease, only 19 in ulcerative colitis. Using a supervised learning algorithm (k-Top Scoring Pairs), two sets of serum antibodies were identified that were novel biomarkers for specifically distinguishing Crohn's Disease from healthy controls (accuracy: 864%; p<0.01), and Crohn's Disease from ulcerative colitis (accuracy: 802%; p<0.01), respectively. The Set 1 antibodies recognized three pairs of E. coli proteins: era vs ybaN, yhgN vs focA, and gabT vs ycdG and the Set 2 antibodies recognized yidX vs frvX. The specificity and sensitivity of Set 1 antibodies were 815% and 893%, respectively, while those of set 2 antibodies were 841% and 706%, respectively. Serum antibodies identified for distinguishing healthy controls vs ulcerative colitis were only marginal, since their accuracy, specificity and sensitivity were 665%, 695%, and 617%, respectively (p<0.04). Taken together, novel sets of serological biomarkers have been identified for diagnosis of Crohn's disease vs healthy control and Crohn's disease vs ulcerative colitis.

(10) The use of biomarkers is particularly important because Crohn's disease and ulcerative colitis share many symptoms, both clinically and histologically. This makes the diagnosis of these two diseases difficult. The differences between Crohn's disease and ulcerative colitis exist at many levels. Crohn's disease may occur anywhere along the digestive tract from the mouth to the anus (although in most cases distal ileum and colon are affected). In ulcerative colitis, the large intestine (colon) is typically the only site that is affected. Second, the pattern of inflammation may be different. Ulcerative colitis tends to be continuous thoughout the inflamed area, while Crohn's disease exhibits skipped lessions or ranulomas (intermittent patterns between inflamed and healthy-looking tissues. Third, there can be difference in the degree of tissue penetration. In ulcerative colitis, the colonic mucosal lining is ulcerated, but this does not extend beyong the mucosal lining. In Crohn's, such ulceration is typically deeper and may extend to virtually any layers of colon wall. Finally, the complications associated with the disease may differ. In Crohn's disease patients may experience complications, such as fistulizing and structuring. These complications are much less frequent in ulcerative colitis. In up to 15% Crohn's patients, extra-intestinal manifistitions of disease can also occur. These may include inflammation in tissues or organs outside the gastrointestinal tract. Interesting general, smoking is bad and of a risk factor for Crohn's disease but protective or therapeutic for UC.

(11) Inflammatory Bowel Disease

(12) Serological testing is a non-invasive method for diagnosing IBD, and differentiating ulcerative colitis from Crohn's disease (Li et al., (2008) World J. Gastroenterol. 14, 5115-5124; Peyrin-Biroulet et al. (2007) Inflamm. Bowel. Dis. 13, 1561-1566; Vermeire et al. (2008) Gastroenterol. Clin. North Am. 37, 429-438). Several serological IBD biomarkers have been identified in the past decade, and some have been used in the clinics of IBD (Li et al., (2008) World J. Gastroenterol. 14, 5115-5124; Peyrin-Biroulet et al. (2007) Inflamm. Bowel. Dis. 13, 1561-1566; Vermeire et al. (2008) Gastroenterol. Clin. North Am. 37, 429-438). Many of these antibodies are produced on intestinal exposure to normal commensal bacteria in genetically susceptible individuals. Although it is not known whether these antibodies are pathogenic or not, they are specific to patients with either Crohn's disease or ulcerative colitis, and may reflect a dysregulated immune inflammatory response to intestinal bacterial antigens (Xavier (2007) Nature 448, 427-434, Strober (2002) Annu. Rev. Immunol. 20, 495-549; Blumberg (1999) Curr. Opin. Immunol. 11, 648-656; Papp et al., (2007) Inflamm. Bowel. Dis. 13, 984-992). Work on several experimental animal models of IBD have led to the suggestion that the pathogenesis of IBD may be the result of an aberrant immune response to normal commensal bacteria in genetically susceptible individuals. In fact, most of the major serological biomarkers being used in IBD clinics are antibodies to microbial antigens, including yeast oligomanna (anti-Saccharomyces cerevisiae, ASCA), bacterial outer membrane porin C (OmpC), Pseudomonas fluorescens bacterial sequence 12 (anti-I2), and most recently bacterial flagellin (CBir 1) ((Li et al., (2008) World J. Gastroenterol. 14, 5115-5124; Peyrin-Biroulet et al. (2007) Inflamm. Bowel. Dis. 13, 1561-1566; Vermeire et al. (2008) Gastroenterol. Clin. North Am. 37, 429-438)). All of these anti-microbial antibodies show preponderance in patients with Crohn's Disease. However, ASCA has been identified in up to 5% of patients with ulcerative colitis.

(13) In comparison, IBD-specific pANCA or antineutrophil cytoplasmic antibody w perinuclear highlighting was first described in 1990. Although generally considered an autoantibody, the specific antigenic stimulation for pANCA production remains unclear. This auto-antibody is present in up to 70% of patients with ulcerative colitis, and in up to 20% of patients with CD. Recently, a panel of five new anti-glycan antibodies have been identified, including anti-chitobioside IgA (ACCA), anti-laminaribioside IgG (ALCA), anti-manobioside IgG (AMCA), and antibodies against chemically synthesized () two major oligomannose epitopes, Man -1,3 Man -1,2 Man (Man3) and Man -1,3 Man -1,2 Man -1,2 Man (Man4) (Li (2008) World J. Gastroenterol. 14, 5115-5124, 13, 15). If desired, these conventional biomarkers may be used in combination with the new serological biomarkers delineated herein (e.g., FIG. 5 and Tables 2-5, and 7).

(14) Collectively, these antibodies are not generally present in either children or adults with non-IBD disease, and may represent serological markers of intestinal inflammation specific to ulcerative colitis or Crohn's disease. Though encouraging, none of the current commercially available biomarker tests/assays, including all of those mentioned above, can be used as stand-alone tools in clinics, and therefore they are currently only recommended as an adjunct to endoscopy in diagnosis and prognosis of the disease (Li (2008) World J. Gastroenterol. 14, 5115-5124; 16, 17). Therefore, additional specific and sensitive IBD biomarkers are needed.

(15) Proteomic technologies, such as 2-dimensional gel electrophoresis, various variations of mass spectrometry and protein chip (array) technology are now proving to be powerful tools in biomarker discovery and are beginning to be utilized in IBD biomarker discovery (Li (2008) World J. Gastroenterol. 14, 5115-5124; 18). These technologies enable robust, and/or large-scale and high-throughput identification and analysis of differential protein expression when comparing disease to control. Blood-based (serum or plasma-based) proteomics hold particular promises for biomarker discovery of various human diseases such as neurodegenerative diseases and cancers (Goldknopf (2008) Expert Rev. Proteomics. 5, 1-8; Maurya et al., (2007) Anticancer Res. 27, 1247-1255; Veenstra et al. (2005) 4, 409-418.-21). Antigen microarrays are also powerful tools that allow high-throughput serum analysis of aberrant immune responses in autoimmune diseases, as well as efficient discovery of biomarkers for infectious pathogens. The present invention provides methods of using an E coli proteome microarray to characterize differential immune responses (serum anti-E. coli antibodies) among patients clinically classified as having Crohn's disease, ulcerative colitis and healthy controls. In addition, the invention provides novel IBD-specific anti microbial antibodies, particularly anti-E. coli antibodies, which are present in IBD patients and were identified by screening the sera with E. coli protein arrays.

(16) Serum Antibody Biomarkers

(17) The present invention provides serum antibody biomarkers that are differentially present in subjects having an inflammatory bowel disease, such as Crohn's disease or ulcerative colitis. These serum antibody biomarkers specifically bind to particular E. coli polypeptides, which are delineated in FIG. 5 and Tables 2-5, and 7. In particular, the invention provides that serum antibody biomarkers of the invention may be used individually or in combination with other markers to provide a method of diagnosing an inflammatory bowel disease. In one embodiment, the diagnosis of an inflammatory bowel disease involves distinguishing an inflammatory bowel disease from healthy controls. In certain embodiments, biomarkers comprises the pairs and sets of E. coli polypeptides delineated in FIGS. 5A, 5B, and 5C and Table 7 and the corresponding serum antibodies. In another embodiment, the diagnosis of an inflammatory bowel disease involves distinguishing Crohn's disease from ulcerative colitis. The invention further provides methods for selecting or monitoring the efficacy of a therapeutic regimen in a subject having a inflammatory bowel disease Inflammatory bowel diseases include, but are not limited to Crohn's disease, ulcerative colitis, and indeterminate colitis.

(18) Serum antibody biomarkers that are differentially present in samples of subjects having a inflammatory bowel disease and healthy control subjects find application in methods and kits for diagnosing an inflammatory bowel disease, such as Crohn's disease or ulcerative colitis, or distinguishing inflammatory bowel disease from healthy control. Accordingly, methods are provided for identifying inflammatory bowel disease in a subject, which involve detecting a differential presence of a serum antibody biomarker in subjects with a inflammatory bowel disease in a biological sample (e.g., blood, sera, plasma) obtained from the subject. The amount of one or more serum antibody biomarkers found in a test sample compared to a control, or the presence or absence of one or more serum antibody biomarkers in the test sample provides useful information regarding the inflammatory bowel disease status of the patient.

(19) The serum antibody biomarkers can be measured in different types of biological samples. Preferably, the sample is a blood sample.

(20) Detection Methods

(21) The invention provides methods of detecting one or more serum antibody biomarkers associated with a inflammatory bowel disease or control markers in a blood sample obtained from a subject. The invention specifically describes the use of immunoassays to detect serum antibody biomarkers that specifically bind certain polypeptides or that measure the relative immune reaction against certain polypeptides. For example, the invention provides for the detection of greater immunogenic reactivity to era than to ybaN, greater immunogenic reactivity to yhgN than to focA, and greater immunogenic reactivity to gabT than ycdG. When each of these differential immunogenic reactivities is present then the subject is identified as having Crohn's Disease. In another example, the detection of greater immunogenic reactivity to frvX than to yidX identifies a subject as having ulcerative colitis.

(22) In other embodiments, the invention provides at Table 7 methods for distinguishing Crohn's disease, ulcerative colitis, and healthy controls. In particular, microarrays comprising E. coli polypeptides delineated herein are useful for measuring immunogenic reactivity present in subject sera. Measurements can be relative to the immunogenic reactivity of another E. coli polypeptide. In one embodiment, the method provides that the following pairs can be used to measure relative levels of immunogenic reactivity.

(23) For example, era>ybaN=Crohn's disease (CD)

(24) The sequence of E. coli polypeptides are known in the art and can be identified in public databases by searching on the gene or polypeptide name. For example, the E. coli era polypeptide is NCBI Reference Sequence: AAA03242.1. The amino acid sequence of an exemplary era polypeptide is provided below.

(25) TABLE-US-00001 1 msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaly 61 vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemylnklregkapvi 121 lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf 181 pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere 241 gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkyksgwadderalrslgyvdd 301 l

(26) The sequence of an exemplary E. coli ybaN polypeptide (NCBI Reference Sequence: AP_001117.1) is provided below:

(27) TABLE-US-00002 1 mqriiliiigwlavvlgtlgvvlpvlpttpfillaawcfarssprfhawllyrswfgsyl 61 rfwqkhhamprgvkpraillilltfaislwfvqmpwvrimllvilacllfymwripvide 121 kqekh

(28) In another example, yhgN>focA=CD. The sequence of an exemplary E. coli yhgN (NCBI Reference Sequence: AP_004357) is provided below:

(29) TABLE-US-00003 1 mneiisaavllilimdplgnlpifmsvlkhtepkrrraimvrelliallvmlvflfagek 61 ilaflslraetvsisggiilfliaikmifpsasgnssglpageepfivplaiplvagpti 121 latlmllshqypnqmghlvialllawggtfvillqsslflrllgekgvnalerlmglilv 181 mmatqmfldgirmwmkg

(30) The sequence of an exemplary E. coli focA (NCBI Reference Sequence: AP_001534) is provided below:

(31) TABLE-US-00004 1 mkadnpfdlllpaamakvaeeagvykatkhplktfylaitagvfisiafvfyitattgtg 61 tmpfgmaklvggicfslglilcvvcgadlftstvlivvakasgritwgqlaknwlnvyfg 121 nlvgallfvllmwlsgeymtangqwglnvlqtadhkvhhtfieavclgilanlmvclavw 181 msysgrslmdkafimvlpvamfvasgfehsianmfmipmgivirdfaspefwtavgsape 241 nfshltvmnfitdnlipvtigniigggllvgltywviylrendhh

(32) For example, gabT>ycdG=CD The sequence of an exemplary E. coli gabT (NCBI Reference Sequence: AP_003235.1) is provided below

(33) TABLE-US-00005 1 mnsnkelmqrrsgaiprgvgqihpifadraencrvwdvegreyldfaggiavintghlhp 61 kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk 121 iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise 181 ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade 241 vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag 301 npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf 361 edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc 421 fdeakq

(34) The sequence of an exemplary E. coli ycdG (NCBI Reference Sequence: AP_001637.1) is provided below.

(35) TABLE-US-00006 1 mamfgfphwqlkststesgvvapderlpfaqtavmgvqhavamfgatvlmpilmgldpnl 61 silmsgigtllfffitggrypsylgssaafvgvviaatgfngqginpnisialggiiacg 121 lvytviglvvmkigtrwierlmppvvtgavvmaiglnlapiavksysasafdswmavmtv 181 lciglvavftrgmiqrllilvglivacllygvmtnvlglgkavdftivshaawfglphfs 241 tpafngqammliapvavilvaenlghlkavagmtgrnmdpymgrafvgdglatmlsgsvg 301 gsgvttyaenigvmavtkvystivfvaaaviamllgfspkfgalihtipaaviggasivv 361 fgliavagariwvqnrvdlsqngnlimvavtivlgagdfaltlggftlggigtatfgail 421 lnallsrklvdvpppevvhqep

(36) In other examples yidX (NCBI AP_004097)>frvX=UC; relE (NCBI ABD51640.1)>cysE/wcaB (NCBI CAQ33933.1)=UC; lnt (NCBI AP_001306.1)>ybiO (NCBI AP_001439.1)=UC; ftsE (NCBI AP_004329.1)>pssR (NCBI F65179)=UC; yhgN (NCBI AP_004357.1)>yhfG (NCBI AP_004427.1)=UC; yafN (NCBI AP_000885.1)>dsbB(NCBI AP_001810.1)=UC; yihI (NCBI AP_003942.1)>yabK (NCBI AAC73178.1)=UC 421#15>yhdN (NCBI AAC76318.1)=UC; hisP (NCBI AAC75366.1)>rplO (NCBI AAC76326.1)=UC; cml (NCBI P12056.1)>nuoM (NCBI AP_002875.1)=UC; yieC (NCBI AAC76743.1)>nuol (NCBI AP_002879.1)=UC.

(37) One of skill in the art will recognize that any suitable method can be used to detect the serum antibody biomarkers described herein. Successful practice of the invention can be achieved with one or a combination of methods that can detect and/or quantify the markers. Such methods include, without limitation, hybridization-based methods including those employed in microarrays, mass spectrometry (e.g., laser desorption/ionization mass spectrometry), fluorescence (e.g. sandwich immunoassay), surface plasmon resonance, ellipsometry, atomic force microscopy, and 2-dimensional gel electrophoresis. Methods may further include, one or more of electrospray ionization mass spectrometry (ESI-MS), ESI-MS/MS, ESI-MS/(MS)n, matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS), desorption/ionization on silicon (DIOS), secondary ion mass spectrometry (SIMS), quadrupole time-of-flight (Q-TOF), atmospheric pressure chemical ionization mass spectrometry (APCI-MS), atmospheric pressure photoionization mass spectrometry (APPI-MS), quadrupole mass spectrometry, fourier transform mass spectrometry (FTMS), and ion trap mass spectrometry. In one preferred embodiment, detection methods employ a microchip array comprising immunogenic pathogen (e.g., E. coli) polypeptides.

(38) Microarrays

(39) As described herein, collections of immunogenic E. coli polypeptides may be used to identify serum antibody biomarker profiles that are associated with inflammatory bowel disease. These collections preferably include polypeptides that are differentially immunogenic (e.g., polypeptides that induce serum antibody biomarkers in healthy controls, but not in inflammatory bowel disease, or polypeptides that induce serum antibody biomarkers in inflammatory bowel disease or ulcerative colitis, but not in healthy controls). Such polypeptides of the invention are useful as hybridizable array elements in a microarray. Polypeptides useful in arrays of the invention include, but are not limited to, those polypeptides delineated in FIG. 5 and Tables 2-5, and 7. The array elements are organized in an ordered fashion such that each element is present at a specified location (i.e., an addressable location) on the substrate. Useful substrate materials include membranes, composed of paper, nylon or other materials, filters, chips, glass slides, and other solid supports. The ordered arrangement of the array elements allows hybridization patterns and intensities to be interpreted as levels of particular serum antibody biomarkers. Methods for making polypeptide microarrays are described, for example, by Ge (Nucleic Acids Res. 28: e3. i-e3. vii, 2000), MacBeath et al., (Science 289:1760-1763, 2000), Zhu et al (Nature Genet. 26:283-289), and in U.S. Pat. No. 6,436,665, hereby incorporated by reference.

(40) Serum antibody biomarkers associated with inflammatory bowel disease may be analyzed using protein microarrays comprising the entire E. coli proteome, or comprising as few as one, two, three, four, five, or six E. coli proteins. Typically, protein microarrays feature a protein, or fragment thereof, bound to a solid support. Suitable solid supports include membranes (e.g., membranes composed of nitrocellulose, paper, or other material), polymer-based films (e.g., polystyrene), beads, or glass slides. For some applications, proteins are spotted on a substrate using any convenient method known to the skilled artisan (e.g., by hand or by inkjet printer). Preferably, such methods retain the biological activity or function of the protein bound to the substrate (Ge et al., supra; Zhu et al., supra).

(41) The protein microarray is hybridized with blood, serum, or plasma derived from a subject. The sample comprises antibodies that specifically bind an E. coli polypeptide, thereby acting as probes. Probes can also include antibodies, candidate peptides, nucleic acids, or small molecule compounds derived from a peptide, nucleic acid, or chemical library. Hybridization conditions (e.g., temperature, pH, protein concentration, and ionic strength) are optimized to promote specific interactions. Such conditions are known to the skilled artisan and are described, for example, in Harlow, E. and Lane, D., Using Antibodies: A Laboratory Manual. 1998, New York: Cold Spring Harbor Laboratories. After removal of non-specific probes, specifically bound probes are detected, for example, by fluorescence, enzyme activity (e.g., an enzyme-linked calorimetric assay), direct immunoassay, radiometric assay, or any other suitable detectable method known to the skilled artisan.

(42) The biochip surfaces may, for example, be ionic, anionic, hydrophobic; comprised of immobilized nickel or copper ions, comprised of a mixture of positive and negative ions; and/or comprised of one or more antibodies, single or double stranded nucleic acids, proteins, peptides or fragments thereof, amino acid probes, or phage display libraries. Many protein biochips are described in the art. These include, for example, protein biochips produced by Ciphergen Biosystems (Fremont, Calif.), Packard BioScience Company (Meriden Conn.), Zyomyx (Hayward, Calif.) and Phylos (Lexington, Mass.). Examples of such protein biochips are described in the following patents or patent applications: U.S. Pat. No. 6,225,047 (Hutchens and Yip, Use of retentate chromatography to generate difference maps, May 1, 2001); International publication WO 99/51773 (Kuimelis and Wagner, Addressable protein arrays, Oct. 14, 1999); U.S. Pat. No. 6,329,209 (Wagner et al., Arrays of protein-capture agents and methods of use thereof, Dec. 11, 2001) and International publication WO 00/56934 (Englert et al., Continuous porous matrix arrays, Sep. 28, 2000).

(43) Serum antibody biomarkers may be captured with capture reagents (e.g., target polypeptides) immobilized to a solid support, such as a biochip, a multiwell microtiter plate, a resin, or nitrocellulose membranes that are subsequently probed for the presence of proteins. Capture can be on a chromatographic surface or a biospecific surface. For example, a serological sample containing the serum antibody biomarkers may be contacted with the active surface of a biochip for a sufficient time to allow binding. Then, unbound molecules are washed from the surface using a suitable eluant, such as phosphate buffered saline. In general, the more stringent the eluant, the more tightly the proteins must be bound to be retained after the wash.

(44) Upon capture on a biochip, analytes can be detected by a variety of detection methods selected from, for example, a gas phase ion spectrometry method, an optical method, an electrochemical method, atomic force microscopy and a radio frequency method. Gas phase ion spectrometry methods are described herein. Of particular interest is the use of mass spectrometry, and in particular, SELDI. Optical methods include, for example, detection of fluorescence, luminescence, chemiluminescence, absorbance, reflectance, transmittance, birefringence or refractive index (e.g., surface plasmon resonance, ellipsometry, a resonant mirror method, a grating coupler waveguide method or interferometry). Optical methods include microscopy (both confocal and non-confocal), imaging methods and non-imaging methods. Immunoassays in various formats (e.g., ELISA) are popular methods for detection of analytes captured on a solid phase. Electrochemical methods include voltametry and amperometry methods. Radio frequency methods include multipolar resonance spectroscopy.

(45) Mass spectrometry (MS) is a well-known tool for analyzing chemical compounds. Thus, in one embodiment, the methods of the present invention comprise performing quantitative MS to measure serum antibody biomarkers present in a serological sample. The method may be performed in an automated (Villanueva, et al., Nature Protocols (2006) 1(2):880-891) or semi-automated format. This can be accomplished, for example with MS operably linked to a liquid chromatography device (LC-MS/MS or LC-MS) or gas chromatography device (GC-MS or GC-MS/MS). Methods for performing MS are known in the field and have been disclosed, for example, in US Patent Application Publication Nos: 20050023454; 20050035286; U.S. Pat. No. 5,800,979 and references disclosed therein.

(46) The protein fragments, whether they are peptides derived from the main chain of the protein or are residues of a side-chain, are collected on the collection layer. They may then be analyzed by a spectroscopic method based on matrix-assisted laser desorption/ionization (MALDI) or electrospray ionization (ESI). The preferred procedure is MALDI with time of flight (TOF) analysis, known as MALDI-TOF MS. This involves forming a matrix on the membrane, e.g. as described in the literature, with an agent which absorbs the incident light strongly at the particular wavelength employed. The sample is excited by UV, or IR laser light into the vapour phase in the MALDI mass spectrometer. Ions are generated by the vaporization and form an ion plume. The ions are accelerated in an electric field and separated according to their time of travel along a given distance, giving a mass/charge (m/z) reading which is very accurate and sensitive. MALDI spectrometers are commercially available from PerSeptive Biosystems, Inc. (Frazingham, Mass., USA) and are described in the literature, e.g. M. Kussmann and P. Roepstorff, cited above.

(47) Diagnostics

(48) Levels of particular serum antibody biomarkers have been correlated with a particular inflammatory bowel disease state, and thus are useful in diagnosis. In one embodiment, a patient having a inflammatory bowel disease will show an alteration in the expression of one or more serum antibody biomarkers delineated herein. In another embodiment, a patient having a inflammatory bowel disease will have a particular expression profile that includes significantly altered expression of two or more serum antibody biomarkers. Alterations in serum antibody biomarkers levels are detected using methods known to the skilled artisan and described herein.

(49) If desired, biomarkers delineated herein are used alone or in combination with convention biomarkers, which include anti-glycan antibodies (e.g., anti-chitobioside IgA (ACCA), anti-laminaribioside IgG (ALCA), anti-manobioside IgG (AMCA)), antibodies against chemically synthesized () two major oligomannose epitopes, Man -1,3 Man -1,2 Man (Man3) and Man -1,3 Man -1,2 Man -1,2 Man (Man4) (Li (2008) World J. Gastroenterol. 14, 5115-5124; 13, 15), IBD-specific pANCA or antineutrophil cytoplasmic antibody, antibodies to microbial antigens (e.g., yeast oligomanna (anti-Saccharomyces cerevisiae, RSCA), bacterial outer membrane porin C (OmpC), Pseudomonas fluorescens bacterial sequence I2 (anti-I2), and antibodies against bacterial flagellin).

(50) In one embodiment, E. coli polypeptides or fragments derived from these polypeptides may be used as targets in a microarray. The microarray is used to assay the level of large numbers of serum antibody biomarkers simultaneously and to identify alterations in the overall or relative levels of expression. Such information can be used to diagnose a inflammatory bowel disease or a subject having a propensity to develop such a condition.

(51) In one embodiment, an increased level of a serum antibody biomarker that specifically binds frvX relative to the level of serum antibody biomarker that binds yidX identifies a subject as having ulcerative colitis. In another embodiment an increased level of serum antibody biomarker binding to era relative to ybaN, increased serum antibody biomarker binding to yhgN relative to focA, and/or increased serum antibody biomarker binding to gabT relative to ycdG identifies a subject as having Crohn's Disease. A variety of protocols for measuring an alteration in the expression of such polypeptides are known, including immunological methods (such as ELISAs and RIAs), and provide a basis for diagnosing an inflammatory bowel disease.

(52) In additional embodiment of the methods of the present invention, multiple markers are measured. The use of multiple markers increases the predictive value of the test and provides greater utility in diagnosis, treatment selection, patient stratification and patient monitoring. The process detects serum antibody biomarker profiles formed by the analysis of multiple markers. Such analysis may improve the sensitivity and specificity of tests delineated herein. Subtle variations in data from clinical samples indicate that certain patterns of serum antibody biomarker expression can predict phenotypes such as the presence or absence of a certain disease, a particular stage of disease progression, or a positive or adverse response to drug treatments.

(53) Data generated by detection of serum antibody biomarkers can be analyzed using any suitable means. In one embodiment, data is analyzed with the use of a programmable digital computer. The computer program generally contains a readable medium that stores data. This data can indicate the number of serum antibody biomarkers detected, including the strength of the signal generated by each marker. Data analysis can include the steps of determining signal strength of a marker detected. When the sample is measured and data is generated, the data is then analyzed by a computer software program

(54) As indicated above, the invention provides methods for aiding a human inflammatory bowel disease diagnosis using one or more serum antibody biomarkers, as specified herein. These markers can be used alone, in combination with other markers in any set, or with entirely different markers in aiding human inflammatory bowel disease diagnosis. The serum antibody biomarkers are differentially present in samples of a subject having or having a propensity to develop a inflammatory bowel disease and a healthy control subject in whom inflammatory bowel disease is undetectable. For example, some of the serum antibody biomarkers are expressed at an elevated level and/or are present at a higher frequency in human inflammatory bowel disease subjects than in normal subjects, while some of the serum antibody biomarkers are expressed at a decreased level and/or are present at a lower frequency in human inflammatory bowel disease subjects than in normal subjects. Therefore, detection of one or more of these markers in a person would provide useful information regarding the probability that the person may have an inflammatory bowel disease.

(55) The detection of a marker is then correlated with a probable diagnosis of inflammatory bowel disease. In some embodiments, the detection of the mere presence or absence of a marker, without quantifying the amount thereof, is useful and can be correlated with a probable diagnosis of inflammatory bowel disease. The measurement of markers may also involve quantifying the markers to correlate the detection of markers with a probable diagnosis of inflammatory bowel disease. Thus, if the amount of the markers detected in a subject being tested is different compared to a control amount (i.e., higher or lower than the control, depending on the marker), then the subject being tested has a higher probability of having inflammatory bowel disease.

(56) The correlation may take into account the amount of the serum antibody biomarkers in the sample compared to a control amount of the serum antibody biomarkers (up or down regulation of the marker or markers) in normal subjects or in subjects where inflammatory bowel disease is undetectable. A control can be, e.g., the average or median amount of marker present in comparable samples of normal subjects. The control amount is measured under the same or substantially similar experimental conditions as in measuring the test amount. As a result, the control can be employed as a reference standard, where the normal phenotype is known, and each result can be compared to that standard, rather than re-running a control.

(57) Accordingly, a serum antibody biomarkers profile may be obtained from a subject sample and compared to a reference marker profile obtained from a reference population, so that it is possible to classify the subject as belonging to or not belonging to the reference population. The correlation may take into account the presence or absence of the markers in a test sample and the frequency of detection of the same markers in a control. The correlation may take into account both of such factors to facilitate determination inflammatory bowel disease status.

(58) Any marker, individually, is useful in aiding in the determination of inflammatory bowel disease status. First, the selected serum antibody biomarkers is detected in a subject sample using the methods described herein (e.g. microarray analysis). Then, the result is compared with a control that distinguishes inflammatory bowel disease status from non-inflammatory bowel disease status. As is well understood in the art, the techniques can be adjusted to increase sensitivity or specificity of the diagnostic assay depending on the preference of the diagnostician.

(59) While individual serum antibody biomarkers are useful diagnostic markers, in some instances, a combination of markers provides greater predictive value than single markers alone. The detection of a plurality of markers (or absence thereof, as the case may be) in a sample can increase the percentage of true positive and true negative diagnoses and decrease the percentage of false positive or false negative diagnoses. Thus, one method of the present invention provides for the measurement of more than one marker.

(60) Optionally, methods described herein may be combined with any conventional method for the diagnosis of IBD (e.g., stool sample analysis, colonoscopy or sigmoidoscopy, barium x-ray, computerized axial tomography, and or capsule endoscopy).

(61) Monitoring

(62) Methods of characterizing inflammatory bowel disease in a subject are also useful in managing subject treatment based on the subject's status. The invention provides for such methods where the serum antibody biomarkers (or specific combinations of markers) are measured before and again after subject management. In these cases, the methods are used to monitor the status of the inflammatory bowel disease, e.g., response to inflammatory bowel disease treatment, amelioration of the disease or progression of the disease.

(63) For example, markers of the invention (e.g., antibodies that bind an E. coli polypeptide listed in FIG. 5 and Tables 2-5, and 7) can be used to monitor a subject's response to certain treatments of inflammatory bowel disease. The level or function of a marker delineated herein may be measured before treatment, during treatment, or following the conclusion of a treatment regimen. Preferably, multiple measurements (e.g., 2, 3, 4, 5) are made at one or more of those times. Measurements are made, for example, using an immunoassay, microarray or other method to determine the expression profile of one or more serum antibody biomarkers. Such monitoring may be useful, for example, in assessing the efficacy of a particular drug in a patient. Therapeutics that normalize the levels of a serum antibody biomarker (e.g., that increase or reduce levels to correspond to levels present in a healthy control subject) are taken as particularly useful in the invention.

(64) Kits

(65) In one aspect, the invention provides kits for monitoring and diagnosing inflammatory bowel disease, wherein the kits can be used to detect the markers described herein. For example, the kits can be used to detect any one or more of the markers differentially present in samples of inflammatory bowel disease subjects vs. normal subjects. If desired a kit of the invention includes any one or more of the E. coli polypeptides listed in FIG. 5 and Tables 2-5, and 7. In one embodiment, the kit comprises a set of biomarkers for distinguishing Crohn's Disease from healthy control, the set comprising era, ybaN, yhgN, focA, ga bT and ycdG. In another embodiment, the kit comprises the set of biomarkers for distinguishing Crohns from UC, which is yidx/frvx. If desired, the kit comprises reagents suitable for measuring conventional IBD biomarkers, including anti-glycan antibodies (e.g., anti-chitobioside IgA (ACCA), anti-laminaribioside IgG (ALCA), anti-manobioside IgG (AMCA)), antibodies against chemically synthesized () two major oligomannose epitopes, Man -1,3 Man -1,2 Man (Man3) and Man -1,3 Man -1,2 Man -1,2 Man (Man4) (Li (2008) World J. Gastroenterol. 14, 5115-512413, 15), IBD-specific pANCA or antineutrophil cytoplasmic antibody, antibodies to microbial antigens (e.g., yeast oligomanna (anti-Saccharomyces cerevisiae, RSCA), bacterial outer membrane porin C (OmpC), Pseudomonas fluorescens bacterial sequence 12 (anti-12), and antibodies against bacterial flagellin (air).

(66) The kits of the invention have many applications. For example, the kits can be used to distinguish between inflammatory bowel disease and control, to determine if a subject has a Crohn's Disease or ulcerative colitis, or to determine that the subject does not have inflammatory bowel disease, thus aiding in inflammatory bowel disease diagnosis. The kits can also be used to identify compounds that modulate expression of one or more of the serum antibody biomarkers in an animal model of inflammatory bowel disease.

(67) The kits of the invention may include instructions for the assay, reagents, testing equipment (test tubes, reaction vessels, needles, syringes, etc.), standards for calibrating the assay, and/or equipment provided or used to conduct the assay. Reagents may include acids, bases, oxidizing agents, marker species. The instructions provided in a kit according to the invention may be directed to suitable operational parameters in the form of a label or a separate insert.

(68) The kits may also include an adsorbent, wherein the adsorbent retains one or more markers selected from one or more of the markers described herein, and written instructions for use of the kit for detection of an inflammatory bowel disease. Such a kit could, for example, comprise: (a) a substrate comprising an adsorbent thereon, wherein the adsorbent is suitable for binding a serum antibody biomarkers, and (b) instructions to detect the serum antibody biomarkers by contacting a sample with the adsorbent and detecting the serum antibody biomarkers retained by the adsorbent. Accordingly, the kit could further comprise a detection reagent.

(69) Optionally, the kit may further comprise a standard or control information so that the test sample can be compared with the control information standard to determine if the test amount of a marker detected in a sample is a diagnostic amount consistent with a diagnosis of inflammatory bowel disease.

(70) Selection of a Treatment Method

(71) After a subject is diagnosed as having inflammatory bowel disease a method of treatment is selected. Because inflammatory bowel disease typically involves an excessive or undesirable immune response, therapies often involve treatment with immunosuppressive agents. Such therapies would not be appropriate for a subject that has irritable bowel syndrome. Thus, the invention provides methods for selecting an appropriate therapy for a subject, the method involving identifying a subject as having inflammatory bowel disease, Crohn's disease or ulcerative colitis, and administering to the subject a therapeutic treatment appropriate for that disease. Exemplary treatments for IBD include but are not limited to aminosalicylates, immunomodulators, infliximab, adalimumab, certolizumab, and/or antibiotics.

(72) Biomarkers identified herein are useful for identifying subjects in need of surgery. In particular embodiments, pairs and sets of biomarkers delineated in Tables 2-5, 7, and FIG. 5 are useful alone or in combination with existing biomarkers to identify subjects that could benefit from surgery.

(73) E. coli Polypeptides and Analogs

(74) Also included in the invention are E. coli polypeptides or fragments thereof that are modified in ways that enhance or do not inhibit their ability to bind a serum antibody. In one embodiment, the invention provides methods for optimizing an E. coli amino acid sequence or nucleic acid sequence by producing an alteration. Such changes may include certain mutations, deletions, insertions, or post-translational modifications. In one preferred embodiment, the E. coli amino acid sequence is modified to enhance protease resistance. Accordingly, the invention further includes polypeptides of other yeast or bacteria having at least 85%, 90%, 95% or greater sequence identity to an E. coli polypeptide delineated herein. In other embodiments, the invention includes analogs of any naturally-occurring polypeptide of the invention. Analogs can differ from the naturally-occurring the polypeptide of the invention by amino acid sequence differences, by post-translational modifications, or by both. Analogs of the invention will generally exhibit at least 85%, more preferably 90%, and most preferably 95% or even 99% identity with all or part of a naturally-occurring amino, acid sequence of the invention. The length of sequence comparison is at least 10, 13, 15 amino acid residues, preferably at least 25 amino acid residues, and more preferably more than 35 amino acid residues. Again, in an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e.sup.3 and e.sup.100 indicating a closely related sequence. Modifications include in vivo and in vitro chemical derivatization of polypeptides, e.g., acetylation, carboxylation, phosphorylation, or glycosylation; such modifications may occur during polypeptide synthesis or processing or following treatment with isolated modifying enzymes. Analogs can also differ from the naturally-occurring polypeptides of the invention by alterations in primary sequence. These include genetic variants, both natural and induced (for example, resulting from random mutagenesis by irradiation or exposure to ethanemethylsulfate or by site-specific mutagenesis as described in Sambrook, Fritsch and Maniatis, Molecular Cloning: A Laboratory Manual (2d ed.), CSH Press, 1989, or Ausubel et al., supra). Also included are cyclized peptides, molecules, and analogs which contain residues other than L-amino acids, e.g., D-amino acids or non-naturally occurring or synthetic amino acids, e.g., .beta. or .gamma. amino acids.

(75) In addition to full-length polypeptides, the invention also includes fragments of any one of the polypeptides of the invention. As used herein, the term a fragment means at least 5, 10, 13, or 15 amino acids in length. In other embodiments a fragment is at least 20 contiguous amino acids, at least 30 contiguous amino acids, or at least 50 contiguous amino acids, and in other embodiments at least 60 to 80 or more contiguous amino acids. Fragments of the invention can be generated by methods known to those skilled in the art or may result from normal protein processing (e.g., removal of amino acids from the nascent polypeptide that are not required for biological activity or removal of amino acids by alternative mRNA splicing or alternative protein processing events).

(76) Screening Assays

(77) Methods of the invention are useful for the high-throughput low-cost screening of candidate agents that bind an E. coli polypeptide described herein. A candidate agent that specifically binds to a E. coli is then isolated and tested for activity in an in vitro assay or in vivo assay. If desired, the candidate agent comprises a detectable label. In one embodiment, such polypeptides are subsequently screened for an effect on bacterial proliferation or as agents that block antibody binding to a E. coli polypeptide listed herein. One skilled in the art appreciates that the effects of a candidate agent on a cell is typically compared to a corresponding control cell not contacted with the candidate agent. Thus, the screening methods include comparing the effect of a candidate agent with an untreated control cell.

(78) In one embodiment, candidate compounds may be identified by first assaying those that specifically bind to an E. coli polypeptide of the invention. Such an interaction can be readily assayed using any number of standard binding techniques and functional assays (e.g., those described in Ausubel et al., supra). For example, a candidate compound may be tested in vitro for interaction and binding with a polypeptide of the invention and its ability to modulate bacterial proliferation may be assayed by any standard assays (e.g., those described herein)

(79) In one particular example, a candidate compound that binds to an E. coli polypeptide may be identified using a chromatography-based technique. For example, a recombinant E. coli polypeptide of the invention may be purified by standard techniques from cells engineered to express the polypeptide, or may be chemically synthesized, once purified the peptide is immobilized on a column. A solution of candidate agents is then passed through the column, and an agent that specifically binds the polypeptide or a fragment thereof is identified on the basis of its ability to bind to polypeptide and to be immobilized on the column. To isolate the agent, the column is washed to remove non-specifically bound molecules, and the agent of interest is then released from the column and collected. Agents isolated by this method (or any other appropriate method) may, if desired, be further purified (e.g., by high performance liquid chromatography). In addition, these candidate agents may be tested for their ability to reduce bacterial proliferation or block serum antibody binding to an E. coli polypeptide. Agents isolated by this approach may also be used, for example, as therapeutics to treat or prevent inflammatory bowel disease (e.g., Crohn's, ulcerative colitis). Compounds that are identified as binding to a an E. coli polypeptide with an affinity constant less than or equal to 1 nM, 5 nM, 10 nM, 100 nM, 1 mM or 10 mM are considered particularly useful in the invention.

(80) Such agents may be used, for example, as a therapeutic to combat the pathogenicity of an bacterial pathogen. Optionally, agents identified in any of the above-described assays may be confirmed as useful in conferring protection against the development of a pathogen infection in any standard animal model and, if successful, may be used as anti-pathogen therapeutics.

(81) Each of the protein sequences provided herein may also be used in the discovery and development of antipathogenic compounds (e.g., antibiotics). The E. coli protein, upon expression, can be used as a target for the screening of drugs to treat or prevent IBD.

(82) Test Compounds and Extracts

(83) In general, candidate agents are identified from large libraries of natural product or synthetic (or semi-synthetic) extracts or chemical libraries or from polypeptide or nucleic acid libraries, according to methods known in the art. Those skilled in the field of drug discovery and development will understand that the precise source of test extracts or compounds is not critical to the screening procedure(s) of the invention. Agents used in screens may include known those known as therapeutics for the treatment of pathogen infections. Alternatively, virtually any number of unknown chemical extracts or compounds can be screened using the methods described herein. Examples of such extracts or compounds include, but are not limited to, plant-, fungal-, prokaryotic- or animal-based extracts, fermentation broths, and synthetic compounds, as well as the modification of existing polypeptides.

(84) Libraries of natural polypeptides in the form of bacterial, fungal, plant, and animal extracts are commercially available from a number of sources, including Biotics (Sussex, UK), Xenova (Slough, UK), Harbor Branch Oceangraphics Institute (Ft. Pierce, Fla.), and PharmaMar, U.S.A. (Cambridge, Mass.). Such polypeptides can be modified to include a protein transduction domain using methods known in the art and described herein. In addition, natural and synthetically produced libraries are produced, if desired, according to methods known in the art, e.g., by standard extraction and fractionation methods. Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt et al., Proc. Natl. Acad. Sci. U.S.A. 90:6909, 1993; Erb et al., Proc. Natl. Acad. Sci. USA 91:11422, 1994; Zuckermann et al., J. Med. Chem. 37:2678, 1994; Cho et al., Science 261:1303, 1993; Carrell et al., Angew. Chem. Int. Ed. Engl. 33:2059, 1994; Carell et al., Angew. Chem. Int. Ed. Engl. 33:2061, 1994; and Gallop et al., J. Med. Chem. 37:1233, 1994. Furthermore, if desired, any library or compound is readily modified using standard chemical, physical, or biochemical methods.

(85) Numerous methods are also available for generating random or directed synthesis (e.g., semi-synthesis or total synthesis) of any number of polypeptides, chemical compounds, including, but not limited to, saccharide-, lipid-, peptide-, and nucleic acid-based compounds.

(86) Synthetic compound libraries are commercially available from Brandon Associates (Merrimack, N.H.) and Aldrich Chemical (Milwaukee, Wis.). Alternatively, chemical compounds to be used as candidate compounds can be synthesized from readily available starting materials using standard synthetic techniques and methodologies known to those of ordinary skill in the art. Synthetic chemistry transformations and protecting group methodologies (protection and deprotection) useful in synthesizing the compounds identified by the methods described herein are known in the art and include, for example, those such as described in R. Larock, Comprehensive Organic Transformations, VCH Publishers (1989); T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 2nd ed., John Wiley and Sons (1991); L. Fieser and M. Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons (1994); and L. Paquette, ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and Sons (1995), and subsequent editions thereof.

(87) Libraries of compounds may be presented in solution (e.g., Houghten, Biotechniques 13:412-421, 1992), or on beads (Lam, Nature 354:82-84, 1991), chips (Fodor, Nature 364:555-556, 1993), bacteria (Ladner, U.S. Pat. No. 5,223,409), spores (Ladner U.S. Pat. No. 5,223,409), plasmids (Cull et al., Proc Natl Acad Sci USA 89:1865-1869, 1992) or on phage (Scott and Smith, Science 249:386-390, 1990; Devlin, Science 249:404-406, 1990; Cwirla et al. Proc. Natl. Acad. Sci. 87:6378-6382, 1990; Felici, J. Mol. Biol. 222:301-310, 1991; Ladner supra.).

(88) In addition, those skilled in the art of drug discovery and development readily understand that methods for dereplication (e.g., taxonomic dereplication, biological dereplication, and chemical dereplication, or any combination thereof) or the elimination of replicates or repeats of materials already known for their activity should be employed whenever possible.

(89) When a crude extract is found to have E. coli polypeptide binding activity further fractionation of the positive lead extract is necessary to isolate molecular constituents responsible for the observed effect. Thus, the goal of the extraction, fractionation, and purification process is the careful characterization and identification of a chemical entity within the crude extract that treats or prevents IBD or acts as an antibiotic. Methods of fractionation and purification of such heterogenous extracts are known in the art. If desired, compounds shown to be useful as therapeutics are chemically modified according to methods known in the art.

(90) The present invention provides methods of treating inflammatory bowel disease and/or disorders or symptoms thereof which comprise administering a therapeutically effective amount of a pharmaceutical composition comprising a compound of the formulae herein to a subject (e.g., a mammal such as a human). Thus, one embodiment is a method of treating a subject suffering from or susceptible to a inflammatory bowel disease or disorder or symptom thereof. The method includes the step of administering to the mammal a therapeutic amount of an amount of a compound herein sufficient to treat the disease or disorder or symptom thereof, under conditions such that the disease or disorder is treated.

(91) The methods herein include administering to the subject (including a subject identified as in need of such treatment) an effective amount of a compound described herein, or a composition described herein to produce such effect. Identifying a subject in need of such treatment can be in the judgment of a subject or a health care professional and can be subjective (e.g. opinion) or objective (e.g. measurable by a test or diagnostic method). As used herein, the terms treat, treating, treatment, and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated. As used herein, the terms prevent, preventing, prevention, prophylactic treatment and the like refer to reducing the probability of developing a disorder or condition in a subject, who does not have, but is at risk of or susceptible to developing a disorder or condition.

(92) The therapeutic methods of the invention (which include prophylactic treatment) in general comprise administration of a therapeutically effective amount of the compounds herein, such as a compound of the formulae herein to a subject (e.g., animal, human) in need thereof, including a mammal, particularly a human. Such treatment will be suitably administered to subjects, particularly humans, suffering from, having, susceptible to, or at risk for a disease, disorder, or symptom thereof. Determination of those subjects at risk can be made by any objective or subjective determination by a diagnostic test or opinion of a subject or health care provider (e.g., genetic test, enzyme or protein marker, Marker (as defined herein), family history, and the like). The compounds herein may be also used in the treatment of any other disorders in which inflammation of the intestine may be implicated.

(93) In one embodiment, the invention provides a method of monitoring treatment progress. The method includes the step of determining a level of diagnostic marker (Marker) (e.g., any target delineated herein) or diagnostic measurement (e.g., screen, assay) in a subject suffering from or susceptible to a inflammatory bowel disease, or disorder or symptoms thereof associated with intestinal inflammation. The level of Marker determined in the method can be compared to known levels of Marker in either healthy normal controls or in other afflicted patients to establish the subject's disease status. In preferred embodiments, a second level of Marker in the subject is determined at a time point later than the determination of the first level, and the two levels are compared to monitor the course of disease or the efficacy of the therapy. In certain preferred embodiments, a pre-treatment level of Marker in the subject is determined prior to beginning treatment according to this invention; this pre-treatment level of Marker can then be compared to the level of Marker in the subject after the treatment commences, to determine the efficacy of the treatment.

(94) The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, 1989); Oligonucleotide Synthesis (Gait, 1984); Animal Cell Culture (Freshney, 1987); Methods in Enzymology Handbook of Experimental Immunology (Weir, 1996); Gene Transfer Vectors for Mammalian Cells (Miller and Calos, 1987); Current Protocols in Molecular Biology (Ausubel, 1987); PCR: The Polymerase Chain Reaction, (Mullis, 1994); Current Protocols in Immunology (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.

(95) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.

EXAMPLES

Example 1: Identification of IBD Serological Markers from E. coli Proteome Chips

(96) Sera was collected from 134 individuals (29 healthy control, 66 CD and 39 ulcerative colitis) from the Johns Hopkins Medical Institutes (Table 1).

(97) TABLE-US-00007 TABLE 1 Demographic and clinical information of IBD Patient and healthy controls. CD UC HC Patient Data/Characteristics (n = 66) (n = 29) (n = 39) Gender: female % 55 53 43 Age: mean/st dev (yrs) 36.7 13.1 38 14.5 47 12.4 Age at diagnosis: mean (yrs) 36.7 28 Duration of disease (yrs) 12.3 8.9 Extraintestinal disease: n (%) 7 (11) 3 (10) Surgery: n (%) 46 (70) 4 (12) Ethnicity: n (%) African American 29 (44) 10 (34) Caucasian 35 (53) 22 (75) Hispanic 2 (3) 0 Smoking: n (%) Past or present 17 (26) 5 (17) Nonsmoker 40 (60) 18 (62) Unknown 9 (14) 9 (35) Medications: n (%) Antibiotics 23 (35) 4 (14) 5-ASA 49 (74) 26 (90) Corticosteroids 16 (24) 9 (35) AZA/6-MP 26 (39) 17 (59) Methotrexate 0 1 (3) Infliximab 15 (23) 2 (7) Crohn's Disease Subtype: n (total) Nonstricturing and nonpenetrating 18 (27) Penetrating 26 (40) Stricturing 14 (21) Penetrating and stricturing 8 (12) Ulcerative Colitis: n (total) Left Sided Colitis 13 (45) Pancolitis 18 (62)

(98) To identify potential biomarkers for IBD diagnosis, the antibody repertoire of the IBD patients was profiled using the E. coli proteome chips that each contained more than 4,200 individual proteins (see schematic illustration of our strategy in (FIG. 1). Since each protein was spotted in duplicate on the chip, the reproducibility of duplicates of each protein was first analyzed. As shown in FIG. 2A, the visual appearance of duplicate spots was very similar. As shown in FIG. 2B in scatter plot, the duplicate spots of each protein were highly correlated, indicating the good quality of the array manufacturing. To recognize those reactive antibodies on the chips, the chips were probed with Cy3-labeled anti-human immunoglobulin antibodies. The immunogenic profiles of both the IBD patients and healthy control were acquired by the resulting fluorescent signals. CD vs ulcerative colitis vs healthy control can be distinguished by comparing the signal intensities between protein spots on the E. coli proteome chips (see FIG. 2A, which shows visual appearance of two representative chips probed with sera from CD and healthy control, respectively). Two-level of data analyses were performed with these immunogenic profiles (i) to identify differential immunogenic responses among CD vs ulcerative colitis vs healthy control using Significance Analysis of Microarray (SAM) and Gene Ontology (GO) enrichment analysis; and (ii) to construct robust classifiers to distinguish CD vs ulcerative colitis vs healthy control using k-TSP method.

Example 2: Global Immunogenic Profiles of IBD Against E. coli

(99) Sera samples from healthy control subjects (n=39), patients with Crohn's Disease (n=66), and patients with ulcerative colitis (n=29) (Table 1) were used to compare differences between healthy control and IBD immunogenic profiles. To investigate the differential global changes in immunogenic response to E. coli proteins among healthy control vs Crohn's Disease vs ulcerative colitis, SAM was employed as described herein above for the immunogenic profiles. For convenience, the E. coli proteins that were differentially recognized by serum antibodies from healthy control, Crohn's Disease or ulcerative colitis are referred to as differentially-expressed immunogenic proteins throughout. Heat maps shown in FIGS. 3A-C present a visual illustration of the differentially immunogenic proteins for each phenotype. 273 differentially immunogenic proteins were identified by SAM when compared healthy control with CD samples. 81 proteins are highly immunogenic in CD samples and 192 are highly immunogenic in healthy control samples (FIG. 3A). Conversely, 188 proteins have different immunogenic responses in the IBD subtypes, 51 and 137 are highly immunogenic in ulcerative colitis and CD samples, respectively (FIG. 3B). When healthy control and ulcerative colitis samples are compared, only 27 and 6 proteins are discriminatory and highly immunogenic in healthy control and ulcerative colitis samples, respectively (FIG. 3C). A full list of the immunogenic E. coli proteins in FIGS. 3A-C can be found in Tables 2-4, respectively.

(100) TABLE-US-00008 TABLE 2 SAM ANALYSIS OF HEALTHY CONTROLS (HC) VERSUS CROHN'S DISEASE (CD) (see FIG. 3A) SPOT PROTEIN NAME GO BP GO CC GO MF 81 Highly immunogenic proteins in CD yfiC yfiC Hypothetical protein yfiC /// 8168 // methyltransferase activity // predicted S-adenosyl-L- inferred from electronic annotation methionine-dependent /// 16740 // transferase activity // methyltransferase inferred from electronic annotation era era GTP-binding protein Era 50875 // cellular 5622 // 166 // nucleotide binding // inferred physiological intracellular // from electronic annotation /// 3676 process // inferred inferred from // nucleic acid binding // inferred from electronic electronic from electronic annotation /// 3723 annotation annotation /// // RNA binding // inferred from 16020 // electronic annotation /// 5525 // membrane // GTP binding // inferred from inferred from electronic annotation electronic annotation ygbD ygbD nitric oxide reductase 6118 // electron 15036 // disulfide oxidoreductase transport // inferred activity // inferred from electronic from electronic annotation /// 16491 // annotation oxidoreductase activity // inferred from electronic annotation /// 16731 // oxidoreductase activity, acting on iron-sulfur proteins as donors, NAD or NADP as acceptors yjhO yjhO /// KpLE2 phage-like element; 16787 // hydrolase activity // sgcX predicted endoglucanase with inferred from electronic annotation Zn-dependent exopeptidase domain aidA aidA DNA-3-methyladenine 6281 // DNA repair 5515 // protein binding // inferred glycosylase II /// 3-methyl- // inferred from from physical interaction /// 3677 // adenine DNA glycosylase II electronic DNA binding // inferred from annotation /// 6284 electronic annotation /// 3905 // // base-excision alkylbase DNA N-glycosylase repair // inferred activity // inferred from electronic from electronic annotation /// 16787 // hydrolase annotation /// 6974 activity // inferred from electronic // response to DNA annotation damage stimulus // inferred from electronic annotation /// 5975 // carbohydrate metabolism // inf yhcI yhcI /// N-acetylmannosamine kinase 5975 // 166 // nucleotide binding // inferred nanK carbohydrate from electronic annotation /// 5524 metabolism // // ATP binding // inferred from inferred from electronic annotation /// 9384 // N- electronic acylmannosamine kinase activity // annotation /// 6051 inferred from electronic annotation // N- /// 16301 // kinase activity // acetylmannosamine inferred from electronic annotation metabolism // inferred from electronic annotation fliS fliS flagellar protein FliS 9296 // flagellum 9288 // flagellum biogenesis // (sensu Bacteria) inferred from // inferred from electronic electronic annotation annotation /// 19861 // flagellum // inferred from electronic annotation infC infC Translation initiation factor IF-3 6412 // protein 3743 // translation initiation factor biosynthesis // activity // inferred from electronic inferred from annotation /// 3723 // RNA binding electronic // inferred from electronic annotation /// 6413 annotation // translational initiation // inferred from electronic annotation /// 6417 // regulation of protein biosynthesis // inferred from electronic annotation /// 6445 // regulation of metB metB cystathionine gamma-synthase 6520 // amino acid 3962 // cystathionine gamma- metabolism // synthase activity // inferred from inferred from electronic annotation /// 16740 // electronic transferase activity // inferred from annotation /// 8652 electronic annotation /// 16829 // // amino acid lyase activity // inferred from biosynthesis // electronic annotation inferred from electronic annotation /// 9086 // methionine biosynthesis // inferred from electronic annotation purM purM phosphoribosylaminoimidazole 6164 // purine 5737 // 3824 // catalytic activity // inferred synthetase nucleotide cytoplasm // from electronic annotation /// 4641 biosynthesis // inferred from // inferred from electronic phosphoribosylformylglycinamidine electronic annotation cyclo-ligase activity // inferred from annotation /// 6189 electronic annotation /// 16874 // // de novo IMP ligase activity // inferred from biosynthesis // electronic annotation inferred from electronic annotation argC argC N-acetyl-gamma-glutamyl- 6520 // amino acid 5737 // 3942 // N-acetyl-gamma-glutamyl- phosphate reductase metabolism // cytoplasm // phosphate reductase activity // inferred from inferred from inferred from electronic annotation electronic electronic /// 16491 // oxidoreductase activity annotation /// 6526 annotation // inferred from electronic // arginine annotation /// 16620 // biosynthesis // oxidoreductase activity, acting on inferred from the aldehyde or oxo group of do electronic annotation /// 8652 // amino acid biosynthesis // inferred from electronic annotation /// 9085 // lysine biosynthesis // inf phnB phnB PhnB protein /// hypothetical protein torA torA Trimethylamine-N-oxide 6118 // electron 42597 // 16491 // oxidoreductase activity // reductase 1 precursor /// transport // inferred periplasmic inferred from electronic annotation trimethylamine N-oxide from electronic space // inferred /// 30151 // molybdenum ion (TMAO) reductase I, catalytic annotation from electronic binding // inferred from electronic subunit annotation annotation /// 50626 // trimethylamine-N-oxide reductase (cytochrome c) activity // inferred from electronic annotation ibpB ibpB 16 kDa heat shock protein B /// 6457 // protein 5515 // protein binding // inferred heat shock chaperone folding // inferred from physical interaction /// 51082 from electronic // unfolded protein binding // annotation /// 6986 inferred from electronic annotation // response to unfolded protein // inferred from electronic annotation /// 50821 // protein stabilization // inferred from electronic annotation hycF hycF hydrogenase 4 FeS subunit /// 6118 // electron 5506 // iron ion binding // inferred formate hydrogenlyase transport // inferred from electronic annotation /// 9055 complex iron-sulfur protein from electronic // electron carrier activity // inferred annotation /// 6810 from electronic annotation /// 46872 // transport // // metal ion binding // inferred from inferred from electronic annotation /// 51536 // electronic iron-sulfur cluster binding // annotation ycbF ycbF predicted periplasmic pilini 6457 // protein 9289 // fimbrium 5515 // protein binding // inferred chaperone folding // inferred // inferred from from electronic annotation /// 51082 from electronic electronic // unfolded protein binding // annotation /// 7047 annotation /// inferred from electronic annotation // cell wall 30288 // organization and periplasmic biogenesis // space (sensu inferred from Proteobacteria) // electronic inferred from annotation electronic annotation /// 42597 // periplasmic space // inferred from electronic annotation ssi6 ssi6 hypothetical protein yjhE yjhE KpLE2 phage-like element; 6810 // transport // 16020 // 5215 // transporter activity // predicted membrane protein inferred from membrane // inferred from electronic annotation (pseudogene) electronic inferred from annotation electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation ygeW ygeW ornithine carbamoyltransferase 6207 // de novo 4070 // aspartate pyrimidine base carbamoyltransferase activity // biosynthesis // inferred from electronic annotation inferred from /// 16597 // amino acid binding // electronic inferred from electronic annotation annotation /// 6520 /// 16743 // carboxyl- and // amino acid carbamoyltransferase activity // metabolism // inferred from electronic annotation inferred from electronic annotation hofH hofH /// Putative general secretion 6810 // transport // 15627 // type II 8565 // protein transporter activity // gspH pathway protein H precursor /// inferred from protein secretion inferred from electronic annotation predicted general secretory electronic system complex pathway component, cryptic annotation /// 15628 // inferred from // type II protein electronic secretion system // annotation inferred from electronic annotation rffD rffD /// UDP-N-acetyl-D- 6118 // electron 16491 // oxidoreductase activity // wecC mannosamine dehydrogenase transport // inferred inferred from electronic annotation /// UDP-N-acetyl-D- from electronic mannosaminuronic acid annotation dehydrogenase yjhC yjhC KpLE2 phage-like element; 6118 // electron 16491 // oxidoreductase activity // predicted oxidoreductase transport // inferred inferred from electronic annotation from electronic annotation /// 8152 // metabolism // inferred from electronic annotation yjcS yjcS Hypothetical protein yjcS 5488 // binding // inferred from electronic annotation ftn ftn Ferritin 1 /// ferritin iron 6826 // iron ion 4322 // ferroxidase activity // storage protein (cytoplasmic) transport // inferred inferred from electronic annotation from electronic /// 5488 // binding // inferred from annotation /// 6879 electronic annotation /// 5506 // iron // iron ion ion binding // inferred from homeostasis // electronic annotation /// 8199 // inferred from ferric iron binding // inferred from electronic electronic annotation ybbQ ybbQ 2-hydroxy-3-oxopropionate 6098 // pentose- 4616 // phosphogluconate reductase phosphate shunt // dehydrogenase (decarboxylating) inferred from activity // inferred from electronic electronic annotation /// 8442 // 3- annotation /// 6573 hydroxyisobutyrate dehydrogenase // valine metabolism activity // inferred from electronic // inferred from annotation /// 8679 // 2-hydroxy-3- electronic oxopropionate reductase activit annotation /// 46487 // glyoxylate metabolism // inferred from electronic annotation ppdB ppdB Prepilin peptidase dependent protein B precursor /// hypothetical protein fimC fimC Chaperone protein fimC 6457 // protein 9289 // fimbrium 5515 // protein binding // inferred precursor /// chaperone, folding // inferred // inferred from from electronic annotation /// 51082 periplasmic from electronic electronic // unfolded protein binding // annotation /// 7047 annotation /// inferred from electronic annotation // cell wall 30288 // organization and periplasmic biogenesis // space (sensu inferred from Proteobacteria) // electronic inferred from annotation electronic annotation /// 42597 // periplasmic space // inferred from electronic annotation dgxA dgxA hypothetical protein fumB fumB Fumarate hydratase class I, 6091 // generation 3824 // catalytic activity // inferred anaerobic /// anaerobic class I of precursor from electronic annotation /// 4333 fumarate hydratase (fumarase metabolites and // fumarate hydratase activity // B) energy // inferred inferred from electronic annotation from electronic /// 5506 // iron ion binding // annotation /// 6099 inferred from electronic annotation // tricarboxylic acid /// 16829 // lyase activity // inferred cycle // inferred from electronic annotation from electronic annotation (thiS) thiS sulfur carrier protein ThiS 6790 // sulfur metabolism // inferred from electronic annotation yjeJ yjeJ Hypothetical protein yjeJ /// hypothetical protein cedA cedA Cell division activator cedA /// 7049 // cell cycle // cell division modulator inferred from electronic annotation /// 51301 // cell division // inferred from electronic annotation cysW cysW sulfate/thiosulfate transporter 6810 // transport // 9276 // cell wall 5215 // transporter activity // subunit inferred from (sensu inferred from electronic annotation electronic Proteobacteria) // /// 15116 // sulfate transporter annotation /// 8272 inferred from activity // inferred from electronic // sulfate transport // electronic annotation /// 15563 // uptake inferred from annotation /// permease activity // inferred from electronic 16020 // electronic annotation annotation membrane // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation ygcQ ygcQ Putative electron transfer 6118 // electron 9055 // electron carrier activity // flavoprotein subunit ygcQ transport // inferred inferred from electronic annotation from electronic /// 50660 // FAD binding // inferred annotation from electronic annotation rpsR rpsR 30S ribosomal protein S18 6412 // protein 5622 // 3723 // RNA binding // inferred biosynthesis // intracellular // from electronic annotation /// 3735 inferred from inferred from // structural constituent of ribosome electronic electronic // inferred from electronic annotation annotation /// annotation /// 19843 // rRNA 5840 // ribosome binding // inferred from electronic // inferred from annotation electronic annotation /// 30529 // ribonucleoprotein complex // inferred from electronic annotation narY narY nitrate reductase 2 (NRZ), beta 6118 // electron 9325 // nitrate 5506 // iron ion binding // inferred subunit transport // inferred reductase from electronic annotation /// 8940 from electronic complex // // nitrate reductase activity // annotation /// 6810 inferred from inferred from electronic annotation // transport // electronic /// 9055 // electron carrier activity // inferred from annotation /// inferred from electronic annotation electronic 16020 // /// 16491 // oxidoreductase activity annotation /// 42126 membrane // // nitrate inferred from metabolism // electronic inferred from annotation electronic annotation /// 42128 // nitrate assimilation // inferred from electr citB citB Transcriptional Regulatory 160 // two- 5737 // 156 // two-component response protein dpiA /// DNA-binding component signal cytoplasm // regulator activity // inferred from response regulator in two- transduction system inferred from electronic annotation /// 3677 // component regulatory system (phosphorelay) // electronic DNA binding // inferred from with citA inferred from annotation electronic annotation /// 30528 // electronic transcription regulator activity // annotation /// 6350 inferred from electronic annotation // transcription // inferred from electronic annotation /// 6355 // regulation of transcription, DNA- dependent // inferred from electronic annotation yjbR yjbR Protein yjbR /// hypothetical protein ybbA ybbA Hypothetical ABC transporter 6810 // transport // 166 // nucleotide binding // inferred ATP-binding protein ybbA /// inferred from from electronic annotation /// 5524 predicted transporter subunit: electronic // ATP binding // inferred from ATP-binding component of annotation electronic annotation /// 5525 // ABC superfamily GTP binding // inferred from electronic annotation /// 16887 // ATPase activity // inferred from electronic annotation gst gst Glutathione S-transferase /// 4364 // glutathione transferase glutathionine S-transferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation grxC grxC Glutaredoxin 3 6118 // electron 9055 // electron carrier activity // transport // inferred inferred from electronic annotation from electronic /// 15035 // protein disulfide annotation /// 6810 oxidoreductase activity // inferred // transport // from electronic annotation inferred from electronic annotation /// 9263 // deoxyribonucleotide biosynthesis // inferred from electronic annotation /// 45454 // cell redox homeostasis // infer cysD cysD sulfate adenylyltransferase 103 // sulfate 4781 // sulfate adenylyltransferase subunit 2 assimilation // (ATP) activity // inferred from inferred from electronic annotation /// 16740 // electronic transferase activity // inferred from annotation /// 8152 electronic annotation /// 16779 // // metabolism // nucleotidyltransferase activity // inferred from inferred from electronic annotation electronic annotation /// 8652 // amino acid biosynthesis // inferred from electronic annotation /// 19344 // cysteine biosynthesis // inferred from electronic annotation radC radC DNA repair protein RadC 6281 // DNA repair // inferred from electronic annotation /// 6974 // response to DNA damage stimulus // inferred from electronic annotation citG citG 2-(5-triphosphoribosyl)-3- 16740 // transferase activity // dephosphocoenzyme-A inferred from electronic annotation synthase /// triphosphoribosyl- /// 46917 // triphosphoribosyl- dephospho-CoA transferase dephospho-CoA synthase activity // inferred from electronic annotation fdhE fdhE formate dehydrogenase 6118 // electron 5506 // iron ion binding // inferred accessory protein FdhE transport // inferred from electronic annotation /// 9055 from electronic // electron carrier activity // inferred annotation from electronic annotation /// 20037 // heme binding // inferred from electronic annotation fecB fecB KpLE2 phage-like element; 6810 // transport // 42597 // 5381 // iron ion transporter activity iron-dicitrate transporter inferred from periplasmic // inferred from electronic subunit electronic space // inferred annotation /// 5506 // iron ion annotation /// 6811 from electronic binding // inferred from electronic // ion transport // annotation annotation inferred from electronic annotation /// 6826 // iron ion transport // inferred from electronic annotation /// 6827 // high affinity iron ion transport inferred from electronic annotation yhgH yhgH /// Hypothetical protein yhgH /// 9116 // nucleoside gntX gluconate periplasmic binding metabolism // protein with inferred from phosphoribosyltransferase electronic domain, GNT I system annotation (phnE) phnE membrane channel protein 6810 // transport // 5887 // integral 5215 // transporter activity // component of Pn transporter inferred from to plasma inferred from electronic annotation electronic membrane // /// 15604 // phosphonate transporter annotation /// 15716 inferred from activity // inferred from electronic // phosphonate electronic annotation transport // inferred annotation /// from electronic 16020 // annotation membrane // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation cysJ cysJ Sulfite reductase [NADPH] 103 // sulfate 5515 // protein binding // inferred flavoprotein alpha-component assimilation // from physical interaction /// 4783 // /// sulfite reductase, alpha inferred from sulfite reductase (NADPH) activity subunit, flavoprotein electronic // inferred from electronic annotation /// 6118 annotation /// 5506 // iron ion // electron transport binding // inferred from electronic // inferred from annotation /// 9055 // electron electronic carrier activity/ annotation /// 6810 // transport // inferred from electronic annotation /// 8652 // amino acid biosynthesis // inferred from electronic annotation 445#15 ygaX Putative transport protein /// 6810 // transport 16020 // 5215 // transporter activity predicted transporter membrane /// 16021 // integral to membrane fba fba /// fructose-bisphosphate aldolase 6096 // glycolysis // 5515 // protein binding // inferred fbaA /// fructose-bisphosphate inferred from from physical interaction /// 4332 // aldolase electronic fructose-bisphosphate aldolase annotation activity // inferred from electronic annotation /// 8270 // zinc ion binding // inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation yjbI yjbI hypothetical protein yfjQ yfjQ CP4-57 prophage; predicted protein mltB mltB Membrane-bound lytic murein 5975 // 16787 // hydrolase activity // transglycosylase B precursor carbohydrate inferred from electronic annotation metabolism // /// 16798 // hydrolase activity, inferred from acting on glycosyl bonds // inferred electronic from electronic annotation annotation yhaA yhaA /// propionate kinase/acetate 6082 // organic acid 5622 // 8776 // acetate kinase activity // tdcD kinase C, anaerobic metabolism // intracellular // inferred from electronic annotation inferred from inferred from /// 16301 // kinase activity // electronic electronic inferred from electronic annotation annotation /// 8152 annotation /// 16740 // transferase activity // // metabolism // inferred from electronic annotation inferred from /// 16774 // phosphotransferase electronic activity, c annotation /// 16310 // phosphorylation // inferred from electronic annotation yjeB yjeB Hypothetical protein yjeB /// 6412 // protein 3677 // DNA binding // inferred predicted DNA-binding biosynthesis // from electronic annotation /// 4826 transcriptional regulator inferred from // phenylalanine-tRNA ligase electronic activity // inferred from electronic annotation annotation /// 5524 // ATP binding // inferred from electronic annotation thiF thiF thiamine biosynthesis protein 9228 // thiamin 3824 // catalytic activity // inferred ThiF biosynthesis // from electronic annotation /// 16740 inferred from // transferase activity // inferred electronic from electronic annotation /// 16779 annotation // nucleotidyltransferase activity // inferred from electronic annotation gcpE gcpE /// 4-hydroxy-3-methylbut-2-en- 8299 // isoprenoid 5506 // iron ion binding // inferred ispG 1-yl diphosphate synthase /// 4- biosynthesis // from electronic annotation /// 16491 hydroxy-3-methylbut-2-en-1-yl inferred from // oxidoreductase activity // inferred diphosphate synthase electronic from electronic annotation /// 16728 annotation /// 16114 // oxidoreductase activity, acting on // terpenoid CH2 groups, disulfide as acceptor // biosynthesis // inferred from electronic annotation inferred from electronic annotation mviN mviN Virulence factor mviN 9405 // 16020 // homolog /// predicted inner pathogenesis // membrane // membrane protein inferred from inferred from electronic electronic annotation annotation /// 16021 // integral to membrane // inferred from electronic annotation yihK yihK /// GTP-binding protein 6412 // protein 5622 // 5515 // protein binding // inferred bipA typA/BipA /// GTP-binding biosynthesis // intracellular // from physical interaction /// 166 // protein inferred from inferred from nucleotide binding // inferred from electronic electronic electronic annotation /// 5525 // annotation annotation GTP binding // inferred from electronic annotation ubiG ubiG 3-demethylubiquinone-9 3- 6744 // ubiquinone 5515 // protein binding // inferred methyltransferase biosynthesis // from physical interaction /// 8168 // inferred from methyltransferase activity // inferred electronic from electronic annotation /// 8425 annotation // 2-polyprenyl-6-methoxy-1,4- benzoquinone methyltransferase activity // inferred from electronic annotati yejG yejG Hypothetical protein yejG /// hypothetical protein 304#1 lsrB AI2 transporter ygfY ygfY Hypothetical protein ygfY /// hypothetical protein 319#17 ydhZ Hypothetical protein ydhZ /// hypothetical protein 336#6 430#8 iscR Hypothetical protein yfhP /// DNA-binding transcriptional repressor yhfR yhfR /// predicted DNA-binding 6350 // transcription 5622 // 5515 // protein binding // inferred frlR transcriptional regulator // inferred from intracellular // from physical interaction /// 3677 // electronic inferred from DNA binding // inferred from annotation /// 6355 electronic electronic annotation /// 3700 // // regulation of annotation transcription factor activity // transcription, DNA- inferred from electronic annotation dependent // /// 30528 // transcription regulator inferred from activity // electronic annotation /// 45449 // regulation of transcription // inferred from electronic annotation phnG phnG PhnG protein /// carbon- 15716 // phosphorus lyase complex phosphonate subunit transport // inferred from electronic annotation /// 19634 // phosphonate metabolism // inferred from electronic annotation ymfE ymfE e14 prophage; predicted inner 16020 // membrane protein membrane // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation yejO yejO predicted autotransporter outer 7155 // cell 16020 // 5524 // ATP binding // inferred membrane protein adhesion // inferred membrane // from electronic annotation from electronic inferred from annotation electronic annotation /// 19867 // outer membrane // inferred from electronic annotation dicC dicC Qin prophage; DNA-binding 6350 // transcription 3677 // DNA binding // inferred transcriptional regulator for // inferred from from electronic annotation DicB electronic annotation /// 6355 // regulation of transcription, DNA- dependent // inferred from electronic annotation /// 7049 // cell cycle // inferred from electronic annotation /// 51301 // cell division // inferred from electronic annotation galR galR Galactose operon repressor /// 5975 // 5622 // 3677 // DNA binding // inferred DNA-binding transcriptional carbohydrate intracellular // from electronic annotation /// 3700 repressor metabolism // inferred from // transcription factor activity // inferred from electronic inferred from electronic annotation electronic annotation annotation /// 6012 // galactose metabolism // inferred from electronic annotation /// 6350 // transcription // inferred from electronic annotation /// 6355 // regulation of transcription, DNA- de yphC yphC Hypothetical zinc-type alcohol 8270 // zinc ion binding // inferred dehydrogenase-like protein from electronic annotation /// 16491 yphC // oxidoreductase activity // inferred from electronic annotation /// 46872 // metal ion binding // inferred from electronic annotation rplT rplT 50S ribosomal protein L20 27 // ribosomal 5622 // 3723 // RNA binding // inferred large subunit intracellular // from electronic annotation /// 3735 assembly and inferred from // structural constituent of ribosome maintenance // electronic // inferred from electronic inferred from annotation /// annotation /// 19843 // rRNA electronic 5840 // ribosome binding // inferred from electronic annotation /// 6412 // inferred from annotation // protein electronic biosynthesis // annotation /// inferred from 30529 // electronic ribonucleoprotein annotation complex // inferred from electronic annotation 267#6 paaJ acetyl-CoA acetyltransferase 8415 // acyltransferase activity /// 16740 // transferase activity selD selD selenophosphate synthetase 166 // nucleotide binding // inferred from electronic annotation /// 287 // magnesium ion binding // inferred from electronic annotation /// 3824 // catalytic activity // inferred from electronic annotation /// 4756 // selenide, water dikinase activity // tdcB tdcB threonine dehydratase 6520 // amino acid 3824 // catalytic activity // inferred metabolism // from electronic annotation /// 4794 inferred from // threonine ammonia-lyase activity electronic // inferred from electronic annotation /// 8152 annotation /// 16829 // lyase activity // metabolism // // inferred from electronic inferred from annotation electronic annotation yhfV yhfV Phosphotriesterase homology 9056 // catabolism // 8270 // zinc ion binding // inferred protein inferred from from electronic annotation /// 16788 electronic // hydrolase activity, acting on ester annotation bonds // inferred from electronic annotation yjaI yjaI /// Zinc resistance-associated 42597 // 8270 // zinc ion binding // inferred zraP protein precursor /// Zn- periplasmic from electronic annotation binding periplasmic protein space // inferred from electronic annotation hycA hycA Formate hydrogenlyase 6350 // transcription 16829 // lyase activity // inferred Regulatory protein hycA /// // inferred from from electronic annotation regulator of the transcriptional electronic regulator FhlA annotation /// 6355 // regulation of transcription, DNA- dependent // inferred from electronic annotation 192 Highly immunogenic response proteins in HC pbuX pbuX hypothetical protein fabH fabH 3-oxoacyl-(acyl carrier protein) synthase 6633 // fatty acid 3824 // catalytic biosynthesis // inferred from activity // inferred electronic annotation /// from electronic 8610 // lipid biosynthesis // annotation /// 4315 inferred from electronic // 3-oxoacyl-[acyl- annotation carrier protein] synthase activity // inferred from electronic annotation /// 8415 // acyltransferase activity // inferred from electronic annotation /// 16740/ glpF glpF Glycerol uptake facilitator protein /// 6810 // transport // inferred 16020 // membrane // 287 // magnesium glycerol facilitator from electronic annotation inferred from ion binding // electronic annotation inferred from /// 16021 // integral electronic to membrane // annotation /// 5215 inferred from // transporter electronic annotation activity // inferred from electronic annotation /// 46872 // metal ion binding // inferred from electronic annotation 273#6 ydcU Hypothetical ABC transporter permease 6810 // transport 16020 // membrane 5215 // transporter protein ydcU /// predicted /// 16021 // integral activity spermidine/putrescine transporter subunit to membrane ybhR ybhR Hypothetical protein ybhR /// predicted 6810 // transport // inferred 16020 // membrane // 5524 // ATP binding transporter subunit: membrane component from electronic annotation inferred from // inferred from of ABC superfamily electronic annotation electronic /// 16021 // integral annotation /// 42626 to membrane // // ATPase activity, inferred from coupled to electronic annotation transmembrane movement of substances // inferred from electronic annotation yqcE yqcE Hypothetical protein yqcE /// predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation flhD flhD transcriptional activator FlhD 6350 // transcription // 19861 // flagellum // 3677 // DNA inferred from electronic inferred from binding // inferred annotation /// 6355 // electronic annotation from electronic regulation of transcription, annotation /// 3700 DNA-dependent // inferred // transcription from electronic annotation factor activity // /// 9296 // flagellum inferred from biogenesis // inferred from electronic electronic annotation /// annotation /// 16563 45893 // positive regula // transcriptional activator activity // inferred from electronic annotation trkG trkG Rac prophage; potassium transporter 6810 // transport // inferred 16020 // membrane // 8324 // cation subunit from electronic annotation inferred from transporter activity /// 6811 // ion transport // electronic annotation // inferred from inferred from electronic /// 16021 // integral electronic annotation /// 6812 // cation to membrane // annotation /// 30955 transport // inferred from inferred from // potassium ion electronic annotation /// electronic annotation binding // inferred 6813 // potassium ion from electronic transport // inferred from annotation electronic annotation ybdS ybdS Citrate carrier/transporter 6814 // sodium ion transport 16020 // membrane // 5215 // transporter // inferred from electronic inferred from activity // inferred annotation electronic annotation from electronic annotation brnQ brnQ Branched-chain amino acid transport 6810 // transport // inferred 16020 // membrane // 15171 // amino acid system II carrier protein /// predicted from electronic annotation inferred from transporter activity branched chain amino acid transporter /// 6865 // amino acid electronic annotation // inferred from (LIV-II) transport // inferred from /// 16021 // integral electronic electronic annotation /// to membrane // annotation /// 15658 15803 // branched-chain inferred from // branched-chain aliphatic amino acid electronic annotation aliphatic amino acid transport // inferred from transporter activity electronic annotation // inferred from electronic annotation ycaD ycaD putative MFS family transporter protein 6810 // transport // inferred 16020 // membrane // 5215 // transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation ybhN ybhN Hypothetical protein ybhN /// conserved 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation yabK yabK /// thiamin ABC transporter membrane 6810 // transport // inferred 9276 // cell wall 5215 // transporter thiP component from electronic annotation (sensu activity // inferred Proteobacteria) // from electronic inferred from annotation electronic annotation /// 16020 // membrane // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation ycdG ycdG Putative purine permease ycdG /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter predicted transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation yojI yojI Hypothetical ABC transporter ATP- 6810 // transport // inferred 16020 // membrane // 166 // nucleotide binding protein yojI /// fused predicted from electronic annotation inferred from binding // inferred multidrug transport subunits of ABC /// 15833 // peptide transport electronic annotation from electronic superfamily: membrane component/ATP- // inferred from electronic /// 16021 // integral annotation /// 5524 binding component annotation /// 46677 // to membrane // // ATP binding // response to antibiotic // inferred from inferred from inferred from electronic electronic annotation electronic annotation annotation /// 15197 // peptide transporter activity // inferred from electronic annotation /// 16887 // ATPase activity // inferred from electronic annotation ybaN ybaN Hypothetical protein ybaN /// conserved 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation focA focA F1C major fimbrial subunit precursor 7155 // cell adhesion // 9289 // fimbrium // inferred from electronic inferred from annotation electronic annotation 321#3 yciR yciR Hypothetical protein yciR 7165 // signal transduction // 4871 // signal inferred from electronic transducer activity // annotation inferred from electronic annotation 427#1 yfgF Hypothetical protein yfgF /// predicted 16020 // membrane inner membrane protein /// 16021 // integral to membrane celD celD /// Cel operon repressor /// DNA-binding 6350 // transcription // 5622 // intracellular 3677 // DNA chbR transcriptional dual regulator inferred from electronic // inferred from binding // inferred annotation /// 6355 // electronic annotation from electronic regulation of transcription, annotation /// 3700 DNA-dependent // inferred // transcription from electronic annotation factor activity // /// 45449 // regulation of inferred from transcription // inferred from electronic electronic annotation annotation /// 43565 // sequence-specific DNA binding // inferred from electronic annotation uidB uidB Glucuronide carrier protein /// glucuronide 6810 // transport // inferred 16020 // membrane // 5215 // transporter transporter from electronic annotation inferred from activity // inferred /// 6814 // sodium ion electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 5351 electronic annotation to membrane // // sugar porter inferred from activity // inferred electronic annotation from electronic annotation /// 15293 // symporter activity // inferred from electronic annotation ydjS ydjS /// succinylglutamate desuccinylase /// 6525 // arginine metabolism 8270 // zinc ion astE succinylglutamate desuccinylase // inferred from electronic binding // inferred annotation /// 6527 // from electronic arginine catabolism // annotation /// 16787 inferred from electronic // hydrolase activity annotation /// 8152 // // inferred from metabolism // inferred from electronic electronic annotation annotation /// 16788 // hydrolase activity, acting on ester bonds // inferred from electronic annotation /// 46872 // metal ion bin rocE rocE hypothetical protein emrY emrY Multidrug resistance protein Y /// predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter multidrug efflux system from electronic annotation inferred from activity // inferred /// 6306 // DNA methylation electronic annotation from electronic // inferred from electronic /// 16021 // integral annotation /// 3677 annotation to membrane // // DNA binding // inferred from inferred from electronic annotation electronic annotation cydC cydC Transport ATP-binding protein cydC /// 6810 // transport // inferred 16020 // membrane // 166 // nucleotide fused cysteine transporter subunits of ABC from electronic annotation inferred from binding // inferred superfamily: membrane component/ATP- electronic annotation from electronic binding component /// 16021 // integral annotation /// 5524 to membrane // // ATP binding // inferred from inferred from electronic annotation electronic annotation /// 16887 // ATPase activity // inferred from electronic annotation /// 17111 // nucleoside- triphosphatase activity // inferred from electronic annotation yhhS yhhS hypothetical protein /// predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation 406#7 yfcH Hypothetical protein yfcH /// conserved 9225 // nucleotide-sugar 3824 // catalytic protein with NAD(P)-binding Rossmann- metabolism activity /// 51287 // fold domain NAD binding atoE atoE Short-chain fatty acids transporter /// short 6810 // transport // inferred 16020 // membrane // 15635 // short-chain chain fatty acid transporter from electronic annotation inferred from fatty acid /// 15912 // short-chain fatty electronic annotation transporter activity acid transport // inferred /// 16021 // integral // inferred from from electronic annotation to membrane // electronic inferred from annotation electronic annotation ybgE ybgE Protein ybgE /// conserved inner membrane protein JW0438 mdlA Multidrug resistance-like ATP-binding 6810 // transport 16021 // integral to 166 // nucleotide protein mdlA membrane binding /// 5524 // ATP binding /// 16887 // ATPase activity /// 17111 // nucleoside- triphosphatase activity /// 42626 // ATPase activity, coupled to transmembrane movement of substances (yhhT) yhhT Hypothetical protein yhhT /// predicted 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation ybhM ybhM Hypothetical protein ybhM yicO yicO Hypothetical protein yicO /// predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter xanthine/uracil permase from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation ybhL ybhL Hypothetical protein ybhL /// predicted 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation yhiQ yhiQ Hypothetical protein yhiQ ydaA ydaA /// Protein ydaA /// stress-induced protein 6950 // response to stress // uspE inferred from electronic annotation ydjZ ydjZ Hypothetical protein ydjZ /// conserved 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation dnaQ dnaQ DNA polymerase III subunit epsilon 6260 // DNA replication // 5622 // intracellular 287 // magnesium inferred from electronic // inferred from ion binding // annotation electronic annotation inferred from electronic annotation /// 3677 // DNA binding // inferred from electronic annotation /// 3887 // DNA-directed DNA polymerase activity // inferred from electronic annotation /// 4518 // nuclease activity // inferred from electronic annotation yidY yidY /// Hypothetical transport protein yidY /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter mdtL multidrug efflux system protein from electronic annotation inferred from activity // inferred /// 46677 // response to electronic annotation from electronic antibiotic // inferred from /// 16021 // integral annotation electronic annotation to membrane // inferred from electronic annotation 211#11 dgkA dgkA Diacylglycerol kinase 8654 // phospholipid 16020 // membrane // 4143 // biosynthesis // inferred from inferred from diacylglycerol electronic annotation electronic annotation kinase activity // /// 16021 // integral inferred from to membrane // electronic inferred from annotation /// 16301 electronic annotation // kinase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation secF secF protein export protein SecF 6605 // protein targeting // 9276 // cell wall 8565 // protein inferred from electronic (sensu transporter activity annotation /// 6810 // Proteobacteria) // // inferred from transport // inferred from inferred from electronic electronic annotation /// electronic annotation annotation /// 15450 6886 // intracellular protein /// 15627 // type II // protein transport // inferred from protein secretion translocase activity electronic annotation /// system complex // // inferred from 15031 // protein transport // inferred from electronic inferred from electronic electronic annotation annotation annotation /// 16020 // membrane // inferred from electronic annotation /// 16021 // integral ybbC ybbC hypothetical protein fadA fadA acetyl-CoA acetyltransferase 6629 // lipid metabolism // 3988 // acetyl-CoA inferred from electronic C-acyltransferase annotation /// 6631 // fatty activity // inferred acid metabolism // inferred from electronic from electronic annotation annotation /// 8415 /// 16042 // lipid catabolism // acyltransferase // inferred from electronic activity // inferred annotation from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation fepD fepD Ferric enterobactin transport system 6810 // transport // inferred 16020 // membrane // 5215 // transporter permease protein fepD from electronic annotation inferred from activity // inferred electronic annotation from electronic annotation sdhD sdhD succinate dehydrogenase cytochrome b556 6099 // tricarboxylic acid 16020 // membrane // 5506 // iron ion small membrane subunit cycle // inferred from inferred from binding // inferred electronic annotation /// electronic annotation from electronic 6118 // electron transport // /// 16021 // integral annotation /// 46872 inferred from electronic to membrane // // metal ion binding annotation /// 6810 // inferred from // inferred from transport // inferred from electronic annotation electronic electronic annotation annotation yeiO yeiO /// Sugar efflux transporter B /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter setB lactose/glucose efflux system from electronic annotation inferred from activity // inferred /// 8643 // carbohydrate electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 5351 electronic annotation to membrane // // sugar porter inferred from activity // inferred electronic annotation from electronic annotation /// 15542 // sugar efflux transporter activity // inferred from electronic annotation yhfU yhfU Hypothetical protein yhfU /// hypothetical protein (yeeF) yeeF Hypothetical transport protein yeeF /// 6810 // transport // inferred 16020 // membrane // 5279 // amino acid- predicted amino-acid transporter from electronic annotation inferred from polyamine /// 6865 // amino acid electronic annotation transporter activity transport // inferred from /// 16021 // integral // inferred from electronic annotation to membrane // electronic inferred from annotation /// 15171 electronic annotation // amino acid transporter activity // inferred from electronic annotation yaeG yaeG /// Carbohydrate diacid regulator /// DNA- 6350 // transcription // cdaR binding transcriptional activator inferred from electronic annotation /// 6355 // regulation of transcription, DNA-dependent // inferred from electronic annotation nac nac Nitrogen assimilation Regulatory protein 6350 // transcription // 3677 // DNA nac /// DNA-binding transcriptional dual inferred from electronic binding // inferred regulator of nitrogen assimilation annotation /// 6355 // from electronic regulation of transcription, annotation /// 3700 DNA-dependent // inferred // transcription from electronic annotation factor activity // /// 42128 // nitrate inferred from assimilation // inferred from electronic electronic annotation annotation msbA msbA Probable transport ATP-binding protein 6810 // transport // inferred 9276 // cell wall 166 // nucleotide msbA /// fused lipid transporter subunits of from electronic annotation (sensu binding // inferred ABC superfamily: membrane /// 6869 // lipid transport // Proteobacteria) // from electronic component/ATP-binding component inferred from electronic inferred from annotation /// 5524 annotation electronic annotation // ATP binding // /// 16020 // inferred from membrane // inferred electronic from electronic annotation /// 16887 annotation /// 16021 // ATPase activity // // integral to inferred from membrane // inferred electronic from electronic annotation /// 17111 annotation // nucleoside- triphosphatase activity // inferred from electronic annotation narI narI Respiratory nitrate reductase 1 gamma 6118 // electron transport // 9325 // nitrate 5506 // iron ion chain /// nitrate reductase 1, gamma inferred from electronic reductase complex // binding // inferred (cytochrome b(NR)) subunit annotation /// 6810 // inferred from from electronic transport // inferred from electronic annotation annotation /// 8940 electronic annotation /// /// 16020 // // nitrate reductase 42128 // nitrate assimilation membrane // inferred activity // inferred // inferred from electronic from electronic from electronic annotation annotation /// 16021 annotation /// 16491 // integral to // oxidoreductase membrane // inferred activity // inferred from electronic from electronic annotation annotation /// 46872 // metal ion binding // inferred from electronic annotation oppC oppC Oligopeptide transport system permease 6810 // transport // inferred 16020 // membrane // 5215 // transporter protein oppC /// oligopeptide transporter from electronic annotation inferred from activity // inferred subunit /// 6857 // oligopeptide electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 15198 electronic annotation /// to membrane // // oligopeptide 15031 // protein transport // inferred from transporter activity inferred from electronic electronic annotation // inferred from annotation electronic annotation yibQ yibQ Hypothetical protein yibQ precursor /// predicted polysaccharide deacetylase pheP pheP Phenylalanine-specific permease /// 6810 // transport // inferred 16020 // membrane // 5279 // amino acid- phenylalanine transporter from electronic annotation inferred from polyamine /// 6865 // amino acid electronic annotation transporter activity transport // inferred from /// 16021 // integral // inferred from electronic annotation to membrane // electronic inferred from annotation /// 15171 electronic annotation // amino acid transporter activity // inferred from electronic annotation 16-3B0 emrD emrD Multidrug resistance protein D /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter multidrug efflux system protein from electronic annotation inferred from activity // inferred /// 15893 // drug transport // electronic annotation from electronic inferred from electronic /// 16021 // integral annotation /// 15238 annotation to membrane // // drug transporter inferred from activity // inferred electronic annotation from electronic annotation ydeZ ydeZ /// AI2 transporter 6810 // transport // inferred 16020 // membrane // 5215 // transporter lsrD from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation 280#1 ddpX D-ala-D-ala dipeptidase, Zn-dependent 6508 // proteolysis 5618 // cell wall 8233 // peptidase activity /// 8237 // metallopeptidase activity /// 16787 // hydrolase activity /// 16805 // dipeptidase activity ybfC ybfC hypothetical protein ydcD ydcD hypothetical protein ygjR ygjR Hypothetical oxidoreductase ygjR /// 6118 // electron transport // 16020 // membrane // 16491 // predicted NAD(P)-binding dehydrogenase inferred from electronic inferred from oxidoreductase annotation /// 8152 // electronic annotation activity // inferred metabolism // inferred from /// 16021 // integral from electronic electronic annotation to membrane // annotation inferred from electronic annotation yehY yehY Hypothetical ABC transporter permease 6810 // transport // inferred 16020 // membrane // 5215 // transporter protein yehY /// predicted transporter from electronic annotation inferred from activity // inferred subunit: membrane component of ABC electronic annotation from electronic superfamily /// 16021 // integral annotation to membrane // inferred from electronic annotation ppx ppx Exopolyphosphatase 16020 // membrane // 287 // magnesium inferred from ion binding // electronic annotation inferred from electronic annotation /// 4309 // exopolyphosphatase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation nagE nagE PTS system, N-acetylglucosamine-specific 6810 // transport // inferred 16020 // membrane // 5351 // sugar porter IIABC component from electronic annotation inferred from activity // inferred /// 9401 // electronic annotation from electronic phosphoenolpyruvate- /// 16021 // integral annotation /// 8982 dependent sugar to membrane // // protein-N(PI)- phosphotransferase system // inferred from phosphohistidine- inferred from electronic electronic annotation sugar annotation /// 19866 // organelle phosphotransferase inner membrane // activity // inferred inferred from from electronic electronic annotation annotation kch kch Putative potassium channel protein /// 6810 // transport // inferred 16020 // membrane // 5216 // ion channel voltage-gated potassium channel from electronic annotation inferred from activity // inferred /// 6811 // ion transport // electronic annotation from electronic inferred from electronic /// 16021 // integral annotation annotation /// 6813 // to membrane // potassium ion transport // inferred from inferred from electronic electronic annotation annotation yjeM yjeM Hypothetical transporter yjeM /// predicted 6810 // transport // inferred 16020 // membrane // 5279 // amino acid- transporter from electronic annotation inferred from polyamine /// 6865 // amino acid electronic annotation transporter activity transport // inferred from /// 16021 // integral // inferred from electronic annotation to membrane // electronic inferred from annotation electronic annotation ybfB ybfB predicted inner membrane protein 16020 // membrane // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation 279#6 ddpC D-ala-D-ala transporter subunit 6810 // transport 16020 // membrane 5215 // transporter /// 16021 // integral activity to membrane aqpZ aqpZ aquaporin Z 6810 // transport // inferred 16020 // membrane // 5215 // transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation /// 15250 to membrane // // water channel inferred from activity // inferred electronic annotation from electronic annotation yhjX yhjX Hypothetical protein yhjX 6810 // transport // inferred 16020 // membrane // 5215 // transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation /// 15297 to membrane // // antiporter activity inferred from // inferred from electronic annotation electronic annotation malX malX PTS system, maltose and glucose-specific 6810 // transport // inferred 16020 // membrane // 5351 // sugar porter IIABC component /// fused maltose and from electronic annotation inferred from activity // inferred glucose-specific PTS enzymes: IIB /// 9401 // electronic annotation from electronic component -! IIC component phosphoenolpyruvate- /// 16021 // integral annotation /// 8982 dependent sugar to membrane // // protein-N(PI)- phosphotransferase system // inferred from phosphohistidine- inferred from electronic electronic annotation sugar annotation phosphotransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotati ycbM ycbM /// Putative aliphatic sulfonates transport 6810 // transport // inferred 16020 // membrane // 5215 // transporter ssuC permease protein ssuC /// alkanesulfonate from electronic annotation inferred from activity // inferred transporter subunit electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation narU narU Nitrite extrusion protein 2 /// nitrate/nitrite 6810 // transport // inferred 16020 // membrane // 15103 // inorganic transporter from electronic annotation inferred from anion transporter /// 15698 // inorganic anion electronic annotation activity // inferred transport // inferred from /// 16021 // integral from electronic electronic annotation /// to membrane // annotation 42128 // nitrate assimilation inferred from // inferred from electronic electronic annotation annotation lpxC lpxC UDP-3-O-[3-hydroxymyristoyl] N- 8610 // lipid biosynthesis // 8759 // UDP-3-O- acetylglucosamine deacetylase inferred from electronic [3- annotation /// 9245 // lipid A hydroxymyristoyl] biosynthesis // inferred from N- electronic annotation acetylglucosamine deacetylase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation secY/prlA secY /// preprotein translocase SecY /// protein 6605 // protein targeting // 16020 // membrane // 15450 // protein prlA translocase subunit SecY inferred from electronic inferred from translocase activity annotation /// 6810 // electronic annotation // inferred from transport // inferred from /// 16021 // integral electronic electronic annotation /// to membrane // annotation 9306 // protein secretion // inferred from inferred from electronic electronic annotation annotation /// 15031 // protein transport // inferred from electronic annotation (yhcP) yhcP Hypothetical protein yhcP /// p- 6810 // transport // inferred 16020 // membrane // hydroxybenzoic acid efflux system from electronic annotation inferred from component electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation phsE phsE /// Penicillin-binding protein 6B precursor /// 6508 // proteolysis // inferred 5618 // cell wall // 4180 // dacD D-alanyl-D-alanine carboxypeptidase from electronic annotation inferred from carboxypeptidase (penicillin-binding protein 6b) /// 8360 // regulation of cell electronic annotation activity // inferred shape // inferred from /// 16020 // from electronic electronic annotation /// membrane // inferred annotation /// 8233 9252 // peptidoglycan from electronic // peptidase activity biosynthesis // inferred from annotation // inferred from electronic annotation electronic annotation /// 9002 // serine-type D- Ala-D-Ala carboxypeptidase activity // inferred from electronic annotation /// 16787/ hemY hemY predicted protoheme IX synthesis protein 6779 // porphyrin 16020 // membrane // biosynthesis // inferred from inferred from electronic annotation electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation yciS yciS Hypothetical protein yciS /// conserved 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation malZ malZ Maltodextrin glucosidase 5975 // carbohydrate 3824 // catalytic metabolism // inferred from activity // inferred electronic annotation from electronic annotation /// 4558 // alpha-glucosidase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation /// 16798 // hydrolase activity, acting ymdD ymdD /// glucans biosynthesis protein 9250 // glucan biosynthesis 16020 // membrane // 8415 // mdoC // inferred from electronic inferred from acyltransferase annotation electronic annotation activity // inferred /// 16021 // integral from electronic to membrane // annotation /// 16740 inferred from // transferase electronic annotation activity // inferred from electronic annotation /// 16741 // transferase activity, transferring one-carbon groups // inferred from electronic annotation /// 1 316#4 rsxA hypothetical protein rfaB rfaB UDP-D- 9058 // biosynthesis // 16740 // transferase galactose:(glucosyl)lipopolysaccharide- inferred from electronic activity // inferred 1,6-D-galactosyltransferase annotation /// 9103 // from electronic lipopolysaccharide annotation /// 16757 biosynthesis // inferred from // transferase electronic annotation activity, transferring glycosyl groups // inferred from electronic annotation emrB emrB multidrug efflux system protein 6810 // transport // inferred 16020 // membrane // 5215 // transporter from electronic annotation inferred from activity // inferred /// 46677 // response to electronic annotation from electronic antibiotic // inferred from /// 16021 // integral annotation electronic annotation to membrane // inferred from electronic annotation 356#7 yegJ hypothetical protein fsr fsr Fosmidomycin resistance protein /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter predicted fosmidomycin efflux system from electronic annotation inferred from activity // inferred /// 46677 // response to electronic annotation from electronic antibiotic // inferred from /// 16021 // integral annotation electronic annotation to membrane // inferred from electronic annotation yigF yigF conserved inner membrane protein 233#6 yceJ Cytochrome b561 homolog 2 /// predicted 6118 // electron transport /// 16020 // membrane 5506 // iron ion cytochrome b561 6810 // transport /// 16021 // integral binding /// 46872 // to membrane metal ion binding 331#2 yeaE Hypothetical protein yeaE 16491 // oxidoreductase activity mrdB mrdB Rod shape-determining protein rodA 7049 // cell cycle // inferred 9276 // cell wall from electronic annotation (sensu /// 8360 // regulation of cell Proteobacteria) // shape // inferred from inferred from electronic annotation electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation thiL thiL thiamine monophosphate kinase 9228 // thiamin biosynthesis 9030 // thiamin // inferred from electronic phosphate kinase annotation activity // inferred from electronic annotation /// 16301 // kinase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation yphD yphD predicted sugar transporter subunit: 6810 // transport // inferred 16020 // membrane // 5215 // transporter membrane component of ABC superfamily from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation fabZ fabZ (3R)-hydroxymyristoyl ACP dehydratase 6633 // fatty acid 5737 // cytoplasm // 16829 // lyase biosynthesis // inferred from inferred from activity // inferred electronic annotation /// electronic annotation from electronic 8610 // lipid biosynthesis // annotation /// 16836 inferred from electronic // hydro-lyase annotation /// 9245 // lipid A activity // inferred biosynthesis // inferred from from electronic electronic annotation annotation yoaA yoaA conserved protein with nucleoside 6139 // nucleobase, 166 // nucleotide triphosphate hydrolase domain nucleoside, nucleotide and binding // inferred nucleic acid metabolism // from electronic inferred from electronic annotation /// 3676 annotation // nucleic acid binding // inferred from electronic annotation /// 3677 // DNA binding // inferred from electronic annotation /// 4386 // helicase activity // inferred from electronic annotation yfjY yfjY CP4-57 prophage; predicted DNA repair 6281 // DNA repair // protein inferred from electronic annotation nrfE nrfE heme lyase (NrfEFG) for insertion of heme 6461 // protein complex 16020 // membrane // 15232 // heme into c552, subunit NrfE assembly // inferred from inferred from transporter activity electronic annotation /// electronic annotation // inferred from 8535 // cytochrome c /// 16021 // integral electronic oxidase complex assembly // to membrane // annotation inferred from electronic inferred from annotation /// 15886 // heme electronic annotation transport // inferred from electronic annotation /// 17004 // cytochrome com udk udk uridine kinase 8655 // pyrimidine salvage // 166 // nucleotide inferred from electronic binding // inferred annotation /// 9058 // from electronic biosynthesis // inferred from annotation /// 4849 electronic annotation // uridine kinase activity // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 16301 // kinase activity // inferred from electronic annotation yhhL yhhL Hypothetical protein yhhL /// conserved inner membrane protein JW1949 yedS_3 Pseudo sucB sucB dihydrolipoamide acetyltransferase 6099 // tricarboxylic acid 45252 // oxoglutarate 4149 // cycle // inferred from dehydrogenase dihydrolipoyllysine- electronic annotation /// complex // inferred residue 8152 // metabolism // from electronic succinyltransferase inferred from electronic annotation activity // inferred annotation from electronic annotation /// 5515 // protein binding // inferred from electronic annotation /// 8415 // acyltransferase activity // inferred from electronic annotation /// 1674 aceF aceF dihydrolipoamide acetyltransferase 6096 // glycolysis // inferred 45254 // pyruvate 5515 // protein from electronic annotation dehydrogenase binding // inferred /// 8152 // metabolism // complex // inferred from physical inferred from electronic from electronic interaction /// 4742 annotation annotation // dihydrolipoyllysine- residue acetyltransferase activity // inferred from electronic annotation /// 5515 // protein binding // inferred from electronic annotation /// 8415 // acyltran yaiV yaiV Hypothetical protein yaiV /// predicted 6355 // regulation of 5622 // intracellular 3700 // transcription DNA-binding transcriptional regulator transcription, DNA- // inferred from factor activity // dependent // inferred from electronic annotation inferred from electronic annotation electronic annotation yccY yccY /// phosphotyrosine-protein phosphatase 6470 // protein amino acid 4721 // etp dephosphorylation // inferred phosphoprotein from electronic annotation phosphatase activity // inferred from electronic annotation /// 4725 // protein tyrosine phosphatase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation yhaO yhaO predicted transporter 6810 // transport // inferred 16020 // membrane // 5215 // transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation yhiP yhiP Hypothetical transporter yhiP /// predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter transporter from electronic annotation inferred from activity // inferred /// 6857 // oligopeptide electronic annotation from electronic transport // inferred from /// 16021 // integral annotation electronic annotation to membrane // inferred from electronic annotation yaaH yaaH Hypothetical protein yaaH /// conserved 16020 // membrane // inner membrane protein associated with inferred from acetate transport electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation oppF oppF Oligopeptide transport ATP-binding 6810 // transport // inferred 16020 // membrane // 166 // nucleotide protein oppF /// oligopeptide transporter from electronic annotation inferred from binding // inferred subunit /// 6857 // oligopeptide electronic annotation from electronic transport // inferred from annotation /// 5524 electronic annotation /// // ATP binding // 15031 // protein transport // inferred from inferred from electronic electronic annotation /// 15833 // annotation /// 15197 peptide transport // inferred // peptide from electronic annotation transporter activity // inferred from electronic annotation /// 15198 // oligopeptide transporter activity pnuC pnuC Protein pnuC /// predicted nicotinamide 6810 // transport // inferred 16020 // membrane // mononucleotide transporter from electronic annotation inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation ansP ansP L-asparagine permease /// L-asparagine 6810 // transport // inferred 16020 // membrane // 5279 // amino acid- transporter from electronic annotation inferred from polyamine /// 6865 // amino acid electronic annotation transporter activity transport // inferred from /// 16021 // integral // inferred from electronic annotation to membrane // electronic inferred from annotation /// 15171 electronic annotation // amino acid transporter activity // inferred from electronic annotation cybB cybB Cytochrome b561 6118 // electron transport // 16020 // membrane // 5506 // iron ion inferred from electronic inferred from binding // inferred annotation /// 6810 // electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 46872 electronic annotation to membrane // // metal ion binding inferred from // inferred from electronic annotation electronic annotation yddH yddH Hypothetical protein yddH 6118 // electron transport // 16491 // inferred from electronic oxidoreductase annotation activity // inferred from electronic annotation sfsA sfsA sugar fermentation stimulation protein /// 3677 // DNA sugar fermentation stimulation protein A binding // inferred from electronic annotation slyX slyX hypothetical protein dinI dinI DNA-damage-inducible protein I /// DNA 6281 // DNA repair // damage-inducible protein I inferred from electronic annotation /// 6974 // response to DNA damage stimulus // inferred from electronic annotation /// 9432 // SOS response // inferred from electronic annotation ynjC ynjC fused transporter subunits of ABC 6810 // transport // inferred 16020 // membrane // 5215 // transporter superfamily: membrane components from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation 411#1 yfdG CPS-53 (KpLE1) prophage; bactoprenol- 271 // polysaccharide 16020 // membrane linked glucose translocase (flippase) biosynthesis /// 6810 // /// 16021 // integral transport to membrane yjgT yjgT /// Gnt-II system L-idonate transporter /// L- 6810 // transport // inferred 16020 // membrane // 5351 // sugar porter idnT idonate and D-gluconate transporter from electronic annotation inferred from activity // inferred /// 15725 // gluconate electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 15128 electronic annotation /// to membrane // // gluconate 19521 // D-gluconate inferred from transporter activity metabolism // inferred from electronic annotation // inferred from electronic annotation electronic annotation yheG yheG Probable general secretion pathway protein E 6810 // transport // inferred 5622 // intracellular 166 // nucleotide from electronic annotation // inferred from binding // inferred /// 15628 // type II protein electronic annotation from electronic secretion system // inferred /// 15627 // type II annotation /// 5524 from electronic annotation protein secretion // ATP binding // system complex // inferred from inferred from electronic electronic annotation annotation /// 8565 // protein transporter activity // inferred from electronic annotation /// 17111 // nucleoside- triphosphatase activity dgt dgt deoxyguanosinetriphosphate 46039 // GTP metabolism // 287 // magnesium triphosphohydrolase inferred from electronic ion binding // annotation inferred from electronic annotation /// 3824 // catalytic activity // inferred from electronic annotation /// 8832 // dGTPase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from folK folK 2-amino-4-hydroxy-6- 9396 // folic acid and 3848 // 2-amino-4- hydroxymethyldihydropteridine derivative biosynthesis // hydroxy-6- pyrophosphokinase inferred from electronic hydroxymethyldihydropteridine annotation diphosphokinase activity // inferred from electronic annotation /// 16301 // kinase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation gppA gppA /// Guanosine-5-triphosphate,3-diphosphate 8894 // guanosine- gpp pyrophosphatase /// guanosine 5-triphosphate,3- pentaphosphatase/exopolyphosphatase diphosphate diphosphatase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation glnD glnD PII uridylyl-transferase 6807 // nitrogen compound 3824 // catalytic metabolism // inferred from activity // inferred electronic annotation /// from electronic 8152 // metabolism // annotation /// 8773 inferred from electronic // [protein-PII] annotation /// 9399 // uridylyltransferase nitrogen fixation // inferred activity // inferred from electronic annotation from electronic annotation /// 16597 // amino acid binding // inferred from electronic annotation /// 16740 // transferase yhbX yhbX Outer-membrane protein yhbX precursor 8152 // metabolism // 16020 // membrane // 8484 // sulfuric ester /// predicted hydrolase, inner membrane inferred from electronic inferred from hydrolase activity // annotation electronic annotation inferred from /// 16021 // integral electronic to membrane // annotation inferred from electronic annotation ygjQ ygjQ Hypothetical protein ygjQ 323#1 ydiV Hypothetical protein ydiV /// hypothetical protein cydB cydB Cytochrome D ubiquinol oxidase subunit 6118 // electron transport // 16020 // membrane // 5506 // iron ion II /// cytochrome d terminal oxidase, inferred from electronic inferred from binding // inferred subunit II annotation /// 6810 // electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 16491 electronic annotation to membrane // // oxidoreductase inferred from activity // inferred electronic annotation from electronic annotation /// 46872 // metal ion binding // inferred from electronic annotation ybhA ybhA Hypothetical protein ybhA /// predicted 6812 // cation transport // 16020 // membrane // 287 // magnesium hydrolase inferred from electronic inferred from ion binding // annotation /// 8152 // electronic annotation inferred from metabolism // inferred from electronic electronic annotation annotation /// 3824 // catalytic activity // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 15662 // ATPase activity, coupled to transmembrane yibL yibL hypothetical protein yifE yifE Protein yifE /// hypothetical protein ygfF ygfF predicted NAD(P)-binding oxidoreductase 8152 // metabolism // 5515 // protein with NAD(P)-binding Rossmann-fold inferred from electronic binding // inferred domain annotation from physical interaction /// 16491 // oxidoreductase activity // inferred from electronic annotation rffG rffG dTDP-glucose 4,6-dehydratase 9103 // lipopolysaccharide 3824 // catalytic biosynthesis // inferred from activity // inferred electronic annotation /// from electronic 9225 // nucleotide-sugar annotation /// 8460 metabolism // inferred from // dTDP-glucose electronic annotation /// 4,6-dehydratase 44237 // cellular metabolism activity // inferred // inferred from electronic from electronic annotation annotation /// 16829 // lyase activity // inferred from electronic annotation /// 50662 // coenzyme binding // yeaS yeaS Hypothetical protein yeaS /// neutral 6865 // amino acid transport 16020 // membrane // 5293 // lysine amino-acid efflux system // inferred from electronic inferred from permease activity // annotation electronic annotation inferred from /// 16021 // integral electronic to membrane // annotation inferred from electronic annotation yaiM yaiM /// Hypothetical protein yaiM /// predicted 4759 // serine frmB esterase esterase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation /// 4091 // carboxylesterase activity // inferred from electronic annotation ygeD ygeD Hypothetical protein ygeD /// predicted 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation yjhB yjhB KpLE2 phage-like element; predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation codB codB Cytosine permease /// cytosine transporter 6810 // transport // inferred 16020 // membrane // 15205 // nucleobase from electronic annotation inferred from transporter activity /// 15931 // nucleobase, electronic annotation // inferred from nucleoside, nucleotide and /// 16021 // integral electronic nucleic acid transport // to membrane // annotation inferred from electronic inferred from annotation /// 19858 // electronic annotation cytosine metabolism // inferred from electronic annotation rfaL rfaL O-antigen ligase 9103 // lipopolysaccharide 16020 // membrane // 16874 // ligase biosynthesis // inferred from inferred from activity // inferred electronic annotation electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation yiaQ yiaQ /// Probable hexulose-6-phosphate synthase /// 5975 // carbohydrate 5515 // protein sgbH 3-keto-L-gulonate 6-phosphate metabolism // inferred from binding // inferred decarboxylase electronic annotation /// from physical 6207 // de novo pyrimidine interaction /// 287 // base biosynthesis // inferred magnesium ion from electronic annotation binding // inferred from electronic annotation /// 4590 // orotidine-5- phosphate decarboxylase activity // inferred from electronic annotation /// 16829 // lyase activ potC potC spermidine/putrescine ABC transporter 6810 // transport // inferred 16020 // membrane // 5215 // transporter membrane component /// from electronic annotation inferred from activity // inferred spermidine/putrescine ABC transporter electronic annotation from electronic membrane protein /// 16021 // integral annotation to membrane // inferred from electronic annotation secB secB export protein SecB 6457 // protein folding // 51082 // unfolded inferred from electronic protein binding // annotation /// 6605 // protein inferred from targeting // inferred from electronic electronic annotation /// annotation 6810 // transport // inferred from electronic annotation /// 15031 // protein transport // inferred from electronic annotation murG murG N-acetylglucosaminyl transferase 5975 // carbohydrate 5618 // cell wall // 16740 // transferase metabolism // inferred from inferred from activity // inferred electronic annotation /// electronic annotation from electronic 7049 // cell cycle // inferred /// 9276 // cell wall annotation /// 16757 from electronic annotation (sensu // transferase /// 8360 // regulation of cell Proteobacteria) // activity, transferring shape // inferred from inferred from glycosyl groups // electronic annotation /// electronic annotation inferred from 9252 // peptidoglycan /// 16020 // electronic biosynthesis // inferred from membrane // inferred annotation /// 16758 electronic annotation from electronic // transferase annotation activity, transferring hexosyl groups // inferred from electronic annotation ydhV ydhV Hypothetical protein ydhV /// predicted 6118 // electron transport // 16491 // oxidoreductase inferred from electronic oxidoreductase annotation activity // inferred from electronic annotation /// 16730 // oxidoreductase activity, acting on iron-sulfur proteins as donors // inferred from electronic annotation putP putP Sodium/proline symporter /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter proline:sodium symporter from electronic annotation inferred from activity // inferred /// 6811 // ion transport // electronic annotation from electronic inferred from electronic /// 16021 // integral annotation /// 5298 annotation /// 6814 // sodium to membrane // // proline:sodium ion transport // inferred from inferred from symporter activity // electronic annotation /// electronic annotation inferred from 6865 // amino acid transport electronic // inferred from electronic annotation /// 15171 annotation // amino acid transporter activity // inferred from electronic annotation /// 15293 // sympo yiaL yiaL Hypothetical protein yiaL queA queA S-adenosylmethionine:tRNA 8616 // queuosine 3824 // catalytic ribosyltransferase-isomerase biosynthesis // inferred from activity // inferred electronic annotation from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation /// 16853 // isomerase activity // inferred from electronic annotation yhaH yhaH Hypothetical protein yhaH /// predicted 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation cobU cobU adenosylcobinamide kinase /// 6779 // porphyrin 166 // nucleotide adenosylcobinamide biosynthesis // inferred from binding // inferred kinase/adenosylcobinamide-phosphate electronic annotation /// from electronic guanylyltransferase 9236 // cobalamin annotation /// 3824 biosynthesis // inferred from // catalytic activity // electronic annotation inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 5525 // GTP binding // inferred from electronic annotation 23-12A0 yadQ yadQ chloride channel protein 6810 // transport // inferred 16020 // membrane // 5247 // voltage- from electronic annotation inferred from gated chloride /// 6811 // ion transport // electronic annotation channel activity // inferred from electronic /// 16021 // integral inferred from annotation /// 6821 // to membrane // electronic chloride transport // inferred inferred from annotation /// 15297 from electronic annotation electronic annotation // antiporter activity // inferred from electronic annotation /// 31404 // chloride ion binding // inferred from electronic annotation yciQ yciQ predicted inner membrane protein tauB tauB Taurine transport ATP-binding protein 6810 // transport // inferred 16020 // membrane // 166 // nucleotide tauB /// taurine transporter subunit from electronic annotation inferred from binding // inferred electronic annotation from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 15411 // taurine- transporting ATPase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation yagG yagG CP4-6 prophage; predicted sugar 6810 // transport // inferred 16020 // membrane // 5215 // transporter transporter from electronic annotation inferred from activity // inferred /// 6814 // sodium ion electronic annotation from electronic transport // inferred from /// 16021 // integral annotation /// 15293 electronic annotation to membrane // // symporter activity inferred from // inferred from electronic annotation electronic annotation lipA lipA lipoyl synthase 9107 // lipoate biosynthesis 3824 // catalytic // inferred from electronic activity // inferred annotation from electronic annotation /// 5506 // iron ion binding // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation /// 16783 // sulfurtransferase activity // inferred from electronic annotation yhcO yhcO Hypothetical protein yhcO /// predicted barnase inhibitor maoC maoC fused aldehyde dehydrogenase/enoyl-CoA 8152 // metabolism // 16491 // hydratase inferred from electronic oxidoreductase annotation activity // inferred from electronic annotation nfrB nfrB Bacteriophage N4 adsorption protein B /// 6810 // transport // inferred 16020 // membrane // 5524 // ATP binding bacteriophage N4 receptor, inner from electronic annotation inferred from // inferred from membrane subunit /// 9597 // detection of virus electronic annotation electronic // inferred from electronic /// 16021 // integral annotation annotation /// 46718 // entry to membrane // of virus into host cell // inferred from inferred from electronic electronic annotation annotation yajR yajR Hypothetical transport protein yajR /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter predicted transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation trkH trkH Trk system potassium uptake protein trkH 6810 // transport // inferred 16020 // membrane // 8324 // cation /// potassium transporter from electronic annotation inferred from transporter activity /// 6811 // ion transport // electronic annotation // inferred from inferred from electronic /// 16021 // integral electronic annotation /// 6812 // cation to membrane // annotation /// 30955 transport // inferred from inferred from // potassium ion electronic annotation /// electronic annotation binding // inferred 6813 // potassium ion from electronic transport // inferred from annotation electronic a exuR exuR Exu regulon transcriptional regulator /// 6350 // transcription // 5622 // intracellular 3677 // DNA DNA-binding transcriptional repressor inferred from electronic // inferred from binding // inferred annotation /// 6355 // electronic annotation from electronic regulation of transcription, annotation /// 3700 DNA-dependent // inferred // transcription from electronic annotation factor activity // inferred from electronic annotation glnQ glnQ glutamine ABC transporter ATP-binding 6810 // transport // inferred 16020 // membrane // 166 // nucleotide component /// glutamine ABC transporter from electronic annotation inferred from binding // inferred ATP-binding protein /// 6865 // amino acid electronic annotation from electronic transport // inferred from annotation /// 5524 electronic annotation // ATP binding // inferred from electronic annotation /// 15171 // amino acid transporter activity // inferred from electronic annotation /// 16887 // ATPase activity // inferred from electronic annotation r yafJ yafJ Hypothetical protein yafJ /// predicted 8152 // metabolism // 16740 // transferase amidotransfease inferred from electronic activity // inferred annotation from electronic annotation ydeF ydeF /// Hypothetical protein ydeE /// predicted 6810 // transport // inferred 16020 // membrane // 5215 // transporter ydeE transporter from electronic annotation inferred from activity // inferred electronic annotation from electronic /// 16021 // integral annotation to membrane // inferred from electronic annotation yejF yejF Hypothetical ABC transporter ATP- 6810 // transport // inferred 16020 // membrane // 166 // nucleotide binding protein yejF /// fused predicted from electronic annotation inferred from binding // inferred oligopeptide transporter subunits of ABC /// 6857 // oligopeptide electronic annotation from electronic superfamilly: ATP-binding components transport // inferred from annotation /// 5524 electronic annotation /// // ATP binding // 15031 // protein transport // inferred from inferred from electronic electronic annotation annotation /// 16887 // ATPase activity // inferred from electronic annotation /// 17111 // nucleoside- triphosphatase activity // inferred from electronic annotation yheU yheU hypothetical protein greA greA transcription elongation factor GreA 6350 // transcription // 3677 // DNA inferred from electronic binding // inferred annotation /// 6355 // from electronic regulation of transcription, annotation /// 3711 DNA-dependent // inferred // transcriptional from electronic annotation elongation regulator activity // inferred from electronic annotation yagM yagM CP4-6 prophage; predicted protein allP allP /// Putative allantoin permease /// predicted 6144 // purine base 16020 // membrane // 15205 // nucleobase ybbW allantoin transporter metabolism // inferred from inferred from transporter activity electronic annotation /// electronic annotation // inferred from 6810 // transport // inferred /// 16021 // integral electronic from electronic annotation to membrane // annotation /// 15931 // nucleobase, inferred from nucleoside, nucleotide and electronic annotation nucleic acid transport // inferred from electronic annotation yghK yghK Glycolate permease glcA /// glycolate 6810 // transport // inferred 16020 // membrane // 15129 // lactate transporter from electronic annotation inferred from transporter activity /// 15727 // lactate transport electronic annotation // inferred from // inferred from electronic /// 16021 // integral electronic annotation to membrane // annotation inferred from electronic annotation yjfP yjfP Hypothetical protein yjfP /// predicted 16787 // hydrolase hydrolase activity // inferred from electronic annotation 409#5 yfcP Hypothetical fimbrial-like protein yfcP 7155 // cell adhesion 9289 // fimbrium precursor yefI yefI /// lipopolysaccharide biosynthesis protein 9058 // biosynthesis // 16740 // transferase wbbK inferred from electronic activity // inferred annotation /// 9103 // from electronic lipopolysaccharide annotation biosynthesis // inferred from electronic annotation ydbD ydbD hypothetical protein 214#3 yhiN yhiN Hypothetical protein yhiN /// predicted 6118 // electron transport // 16491 // oxidoreductase with FAD/NAD(P)- inferred from electronic oxidoreductase binding domain annotation activity // inferred from electronic annotation mutT mutT Mutator mutT protein /// nucleoside 6260 // DNA replication // 287 // magnesium triphosphate pyrophosphohydrolase, inferred from electronic ion binding // marked preference for dGTP annotation /// 6281 // DNA inferred from repair // inferred from electronic electronic annotation /// annotation /// 4452 6974 // response to DNA // isopentenyl- damage stimulus // inferred phosphate delta- from electronic annotation isomerase activity // /// 8299 // isoprenoid inferred from biosynthesis // inferred from electronic electronic annotation annotation /// 8413 // 8-oxo-7,8- dihydroguanine triphosphatase activity // inferred from electroni virK virK hypothetical protein ompC ompC Outer membrane protein C precursor 6810 // transport // inferred 16020 // membrane // 5215 // transporter from electronic annotation inferred from activity // inferred /// 6811 // ion transport // electronic annotation from electronic inferred from electronic /// 16021 // integral annotation /// 15288 annotation /// 9597 // to membrane // // porin activity // detection of virus // inferred inferred from inferred from from electronic annotation electronic annotation electronic /// 46718 // entry of virus /// 19867 // outer annotation into host cell // inferred from membrane // inferred electronic annotation from electronic annotation yghT yghT Hypothetical ATP-binding protein yghT /// 166 // nucleotide predicted protein with nucleoside binding // inferred triphosphate hydrolase domain from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation yohG yohG Putative channel/filament proteins /// 6810 // transport // inferred 16020 // membrane // 5215 // transporter predicted outer membrane protein from electronic annotation inferred from activity // inferred /// 46677 // response to electronic annotation from electronic antibiotic // inferred from /// 19867 // outer annotation /// 8289 electronic annotation membrane // inferred // lipid binding // from electronic inferred from annotation electronic annotation ebgA ebgA Evolved beta-galactosidase alpha-subunit 5975 // carbohydrate 9341 // beta- 3824 // catalytic metabolism // inferred from galactosidase activity // inferred electronic annotation complex // inferred from electronic from electronic annotation /// 4553 annotation // hydrolase activity, hydrolyzing O- glycosyl compounds // inferred from electronic annotation /// 4565 // beta-galactosidase activity // inferred from electronic annotation /// 16 yjfF yjfF Hypothetical ABC transporter permease 6810 // transport // inferred 16020 // membrane // 5215 // transporter protein yjfF from electronic annotation inferred from activity // inferred electronic annotation from electronic annotation 452#13 ygcH hypothetical protein yphG yphG Hypothetical protein yphG 5488 // binding // inferred from electronic annotation ynaJ ynaJ Hypothetical protein ynaJ /// predicted 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation sucD sucD succinyl-CoA synthetase alpha subunit /// 6099 // tricarboxylic acid 166 // nucleotide succinyl-CoA synthetase subunit alpha cycle // inferred from binding // inferred electronic annotation /// from electronic 8152 // metabolism // annotation /// 3824 inferred from electronic // catalytic activity // annotation inferred from electronic annotation /// 4775 // succinate-CoA ligase (ADP- forming) activity // inferred from electronic annotation /// 5524 // ATP binding/ prtC prtC hypothetical protein yhdT yhdT Hypothetical protein yhdT /// conserved 16020 // membrane // inner membrane protein inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation (yhiW) yhiW Hypothetical transcriptional regulator 6350 // transcription // 5622 // intracellular 3677 // DNA yhiW inferred from electronic // inferred from binding // inferred annotation /// 6355 // electronic annotation from electronic regulation of transcription, annotation /// 3700 DNA-dependent // inferred // transcription from electronic annotation factor activity // /// 45449 // regulation of inferred from transcription // inferred from electronic electronic annotation annotation /// 43565 // sequence-specific DNA binding // inferred from electronic annotation 610#6.1

(101) TABLE-US-00009 TABLE 3 SAM ANALYSIS OF CROHN'S DISEASE (CD) VERSUS ULCERATIVE COLITIS (UC) (see FIG. 3B) SPOT PROTEIN NAME GO BP GO CC GO MF 51 Highly immunogenic proteins in UC secF secF protein export protein SecF 6605 // protein targeting // 9276 // cell wall 8565 // protein inferred from electronic (sensu transporter activity // annotation /// 6810 // Proteobacteria) // inferred from transport // inferred from inferred from electronic annotation electronic annotation /// electronic /// 15450 // protein 6886 // intracellular annotation /// translocase activity // protein transport // inferred 15627 // type II inferred from from electronic annotation protein secretion electronic annotation /// 15031 // protein system complex // transport // inferred from inferred from electronic annotation electronic annotation /// 16020 // membrane // inferred from electronic annotation /// 16021 // integral 427#1 yfgF Hypothetical protein yfgF /// predicted inner membrane 16020 // membrane protein /// 16021 // integral to membrane yojI yojI Hypothetical ABC transporter ATP-binding protein yojI /// 6810 // transport // inferred 16020 // membrane 166 // nucleotide fused predicted multidrug transport subunits of ABC from electronic annotation // inferred from binding // inferred superfamily: membrane component/ATP-binding component /// 15833 // peptide electronic from electronic transport // inferred from annotation /// annotation /// 5524 // electronic annotation /// 16021 // integral to ATP binding // 46677 // response to membrane // inferred from antibiotic // inferred from inferred from electronic annotation electronic annotation electronic /// 15197 // peptide annotation transporter activity // inferred from electronic annotation /// 16887 // ATPase activity // inferred from emrY emrY Multidrug resistance protein Y /// predicted multidrug 6810 // transport // inferred 16020 // membrane 5215 // transporter efflux system from electronic annotation // inferred from activity // inferred /// 6306 // DNA electronic from electronic methylation // inferred annotation /// annotation /// 3677 // from electronic annotation 16021 // integral to DNA binding // membrane // inferred from inferred from electronic annotation electronic annotation trkG trkG Rac prophage; potassium transporter subunit 6810 // transport // inferred 16020 // membrane 8324 // cation from electronic annotation // inferred from transporter activity // /// 6811 // ion transport // electronic inferred from inferred from electronic annotation /// electronic annotation annotation /// 6812 // 16021 // integral to /// 30955 // potassium cation transport // inferred membrane // ion binding // from electronic annotation inferred from inferred from /// 6813 // potassium ion electronic electronic annotation transport // inferred from annotation electronic a yhiN yhiN Hypothetical protein yhiN /// predicted oxidoreductase 6118 // electron transport // 16491 // 23-12A0 with FAD/NAD(P)-binding domain inferred from electronic oxidoreductase annotation activity // inferred from electronic annotation ydaA ydaA /// uspE Protein ydaA /// stress-induced protein 6950 // response to stress // inferred from electronic annotation nagE nagE PTS system, N-acetylglucosamine-specific IIABC 6810 // transport // inferred 16020 // membrane 5351 // sugar porter component from electronic annotation // inferred from activity // inferred /// 9401 // electronic from electronic phosphoenolpyruvate- annotation /// annotation /// 8982 // dependent sugar 16021 // integral to protein-N(PI)- phosphotransferase system membrane // phosphohistidine- // inferred from electronic inferred from sugar annotation electronic phosphotransferase annotation /// activity // inferred 19866 // organelle from electronic inner membrane // annotation inferred from electronic annotation ydhV ydhV Hypothetical protein ydhV /// predicted oxidoreductase 6118 // electron transport // 16491 // inferred from electronic oxidoreductase annotation activity // inferred from electronic annotation /// 16730 // oxidoreductase activity, acting on iron-sulfur proteins as donors // inferred from electronic annotation maoC maoC fused aldehyde dehydrogenase/enoyl-CoA hydratase 8152 // metabolism // 16491 // inferred from electronic oxidoreductase annotation activity // inferred from electronic annotation yaiM yaiM /// frmB Hypothetical protein yaiM /// predicted esterase 4759 // serine esterase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation /// 4091 // carboxylesterase activity // inferred from electronic annotation yeiO yeiO /// setB Sugar efflux transporter B /// lactose/glucose 6810 // transport // inferred 16020 // membrane 5215 // transporter efflux system from electronic annotation // inferred from activity // inferred /// 8643 // carbohydrate electronic from electronic transport // inferred from annotation /// annotation /// 5351 // electronic annotation 16021 // integral to sugar porter activity membrane // // inferred from inferred from electronic annotation electronic /// 15542 // sugar annotation efflux transporter activity // inferred from electronic annotation yphD yphD predicted sugar transporter subunit: 6810 // transport // inferred 16020 // membrane 5215 // transporter membrane component of ABC superfamily from electronic annotation // inferred from activity // inferred electronic from electronic annotation /// annotation 16021 // integral to membrane // inferred from electronic annotation narI narI Respiratory nitrate reductase 1 gamma 6118 // electron transport // 9325 // nitrate 5506 // iron ion chain /// nitrate reductase 1, gamma inferred from electronic reductase complex binding // inferred (cytochrome b(NR)) subunit annotation /// 6810 // // inferred from from electronic transport // inferred from electronic annotation /// 8940 // electronic annotation /// annotation /// nitrate reductase 42128 // nitrate 16020 // membrane activity // inferred assimilation // inferred // inferred from from electronic from electronic annotation electronic annotation /// 16491 annotation /// // oxidoreductase 16021 // integral to activity // inferred membrane // from electronic inferred from annotation /// 46872 electronic // metal ion binding // annotation inf ycbM ycbM /// ssuC Putative aliphatic sulfonates transport permease 6810 // transport // inferred 16020 // membrane 5215 // transporter protein ssuC /// alkanesulfonate transporter subunit from electronic annotation // inferred from activity // inferred electronic from electronic annotation /// annotation 16021 // integral to membrane // inferred from electronic annotation yafJ yafJ Hypothetical protein yafJ /// predicted 8152 // metabolism // 16740 // transferase amidotransfease inferred from electronic activity // inferred annotation from electronic annotation lueO lueO hypothetical protein ybbC ybbC hypothetical protein (yeeF) yeeF Hypothetical transport protein yeeF /// predicted 6810 // transport // inferred 16020 // membrane 5279 // amino acid- amino-acid transporter from electronic annotation // inferred from polyamine /// 6865 // amino acid electronic transporter activity // transport // inferred from annotation /// inferred from electronic annotation 16021 // integral to electronic annotation membrane // /// 15171 // amino inferred from acid transporter electronic activity // inferred annotation from electronic annotation mhpF mhpF acetaldehyde dehydrogenase 6520 // amino acid 5737 // cytoplasm // 8774 // acetaldehyde metabolism // inferred inferred from dehydrogenase from electronic annotation electronic (acetylating) activity /// 15976 // carbon annotation // inferred from utilization // inferred from electronic annotation electronic annotation /// /// 16491 // 19439 // aromatic oxidoreductase compound catabolism // activity // inferred inferred from electronic from electronic annotation annotation /// 16620 // oxidoreductase activity, acting on the aldehyde or oxo group of donor rfaB rfaB UDP-D-galactose:(glucosyl)lipopolysaccharide- 9058 // biosynthesis // 16740 // transferase 1,6-D-galactosyltransferase inferred from electronic activity // inferred annotation /// 9103 // from electronic lipopolysaccharide annotation /// 16757 biosynthesis // inferred // transferase activity, from electronic annotation transferring glycosyl groups // inferred from electronic annotation yciD yciD /// ompW Outer membrane protein W precursor /// outer membrane 16020 // membrane protein W // inferred from electronic annotation /// 19867 // outer membrane // inferred from electronic annotation dinI dinI DNA-damage-inducible protein I /// DNA damage-inducible 6281 // DNA repair // protein I inferred from electronic annotation /// 6974 // response to DNA damage stimulus // inferred from electronic annotation /// 9432 // SOS response // inferred from electronic annotation yjgT yjgT /// idnT Gnt-II system L-idonate transporter /// L- 6810 // transport // inferred 16020 // membrane 5351 // sugar porter idonate and D-gluconate transporter from electronic annotation // inferred from activity // inferred /// 15725 // gluconate electronic from electronic transport // inferred from annotation /// annotation /// 15128 electronic annotation /// 16021 // integral to // gluconate 19521 // D-gluconate membrane // transporter activity // metabolism // inferred inferred from inferred from from electronic annotation electronic electronic annotation annotation yjiJ yjiJ Hypothetical protein yjiJ /// predicted inner membrane 16020 // membrane protein // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation fsr fsr Fosmidomycin resistance protein /// predicted fosmidomycin 6810 // transport // inferred 16020 // membrane 5215 // transporter efflux system from electronic annotation // inferred from activity // inferred /// 46677 // response to electronic from electronic antibiotic // inferred from annotation /// annotation electronic annotation 16021 // integral to membrane // inferred from electronic annotation nac nac Nitrogen assimilation Regulatory protein nac /// DNA-binding 6350 // transcription // 3677 // DNA binding transcriptional dual regulator of nitrogen assimilation inferred from electronic // inferred from annotation /// 6355 // electronic annotation regulation of transcription, /// 3700 // DNA-dependent // inferred transcription factor from electronic annotation activity // inferred /// 42128 // nitrate from electronic assimilation // inferred annotation from electronic annotation msbA msbA Probable transport ATP-binding protein msbA /// fused 6810 // transport // inferred 9276 // cell wall 166 // nucleotide lipid transporter subunits of ABC superfamily: membrane from electronic annotation (sensu binding // inferred component/ATP-binding component /// 6869 // lipid transport // Proteobacteria) // from electronic inferred from electronic inferred from annotation /// 5524 // annotation electronic ATP binding // annotation /// inferred from 16020 // membrane electronic annotation // inferred from /// 16887 // ATPase electronic activity // inferred annotation /// from electronic 16021 // integral to annotation /// 17111 membrane // // nucleoside- inferred from triphosphatase electronic activity // inferred annotation modC modC Molybdenum transport ATP-binding protein modC /// molybdate 6810 // transport // inferred 9276 // cell wall 166 // nucleotide transporter subunit from electronic annotation (sensu binding // inferred /// 15689 // molybdate ion Proteobacteria) // from electronic transport // inferred from inferred from annotation /// 5524 // electronic annotation electronic ATP binding // annotation /// inferred from 16020 // membrane electronic annotation // inferred from /// 15098 // electronic molybdate ion annotation transporter activity // inferred from electronic annotation /// 15412 // molybdate- transporting ATPa kch kch Putative potassium channel protein /// voltage-gated potassium channel 6810 // transport // inferred 16020 // membrane 5216 // ion channel from electronic annotation // inferred from activity // inferred /// 6811 // ion transport // electronic from electronic inferred from electronic annotation /// annotation annotation /// 6813 // 16021 // integral to potassium ion transport // membrane // inferred from electronic inferred from annotation electronic annotation prtC prtC hypothetical protein yjfH yjfH /// rlmB Hypothetical tRNA/rRNA 6364 // rRNA processing // 3723 // RNA binding methyltransferase yjfH /// 23S rRNA (Gm2251)-methyltransferase inferred from electronic // inferred from annotation /// 6396 // RNA electronic annotation processing // inferred from /// 8168 // electronic annotation /// methyltransferase 9451 // RNA modification activity // inferred // inferred from electronic from electronic annotation annotation /// 8173 // RNA methyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // glnD glnD PII uridylyl-transferase 6807 // nitrogen compound 3824 // catalytic metabolism // inferred activity // inferred from electronic annotation from electronic /// 8152 // metabolism // annotation /// 8773 // inferred from electronic [protein-PII] annotation /// 9399 // uridylyltransferase nitrogen fixation // inferred activity // inferred from electronic annotation from electronic annotation /// 16597 // amino acid binding // inferred from electronic annotation /// 16740 // transferase yhjC yhjC Hypothetical transcriptional regulator 6350 // transcription // 3677 // DNA binding yhjC /// predicted DNA-binding transcriptional regulator inferred from electronic // inferred from annotation /// 6355 // electronic annotation regulation of transcription, /// 3700 // DNA-dependent // inferred transcription factor from electronic annotation activity // inferred from electronic annotation prpE prpE predicted propionyl-CoA synthetase with ATPase domain 8152 // metabolism // 3824 // catalytic inferred from electronic activity // inferred annotation /// 19629 // from electronic propionate catabolism, 2- annotation /// 16874 methylcitrate cycle // // ligase activity // inferred from electronic inferred from annotation electronic annotation /// 50218 // propionate-CoA ligase activity // inferred from electronic annotation 279#6 ddpC D-ala-D-ala transporter subunit 6810 // transport 16020 // membrane 5215 // transporter /// 16021 // integral activity to membrane ygjR ygjR Hypothetical oxidoreductase ygjR /// predicted NAD(P)-binding 6118 // electron transport // 16020 // membrane 16491 // dehydrogenase inferred from electronic // inferred from oxidoreductase annotation /// 8152 // electronic activity // inferred metabolism // inferred annotation /// from electronic from electronic annotation 16021 // integral to annotation membrane // inferred from electronic annotation ppx ppx Exopolyphosphatase 16020 // membrane 287 // magnesium ion // inferred from binding // inferred electronic from electronic annotation annotation /// 4309 // exopolyphosphatase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation yefI yefI /// wbbK lipopolysaccharide biosynthesis protein 9058 // biosynthesis // 16740 // transferase inferred from electronic activity // inferred annotation /// 9103 // from electronic lipopolysaccharide annotation biosynthesis // inferred from electronic annotation mesJ mesJ Putative cell cycle protein mesJ 8033 // tRNA processing // 166 // nucleotide inferred from electronic binding // inferred annotation /// 16549 // from electronic tRNA editing // inferred annotation /// 5524 // from electronic annotation ATP binding // inferred from electronic annotation /// 16874 // ligase activity // inferred from electronic annotation /// 16879 // ligase activity, forming carbon- nitrogen bonds secY/prlA secY /// prlA preprotein translocase SecY /// protein translocase subunit SecY 6605 // protein targeting // 16020 // membrane 15450 // protein inferred from electronic // inferred from translocase activity // annotation /// 6810 // electronic inferred from transport // inferred from annotation /// electronic annotation electronic annotation /// 16021 // integral to 9306 // protein secretion // membrane // inferred from electronic inferred from annotation /// 15031 // electronic protein transport // inferred annotation from electronic annotation yejA yejA Hypothetical protein yejA precursor /// predicted oligopeptide transporter 6810 // transport // inferred 5215 // transporter subunit from electronic annotation activity // inferred from electronic annotation dgkA dgkA Diacylglycerol kinase 8654 // phospholipid 16020 // membrane 4143 // diacylglycerol biosynthesis // inferred // inferred from kinase activity // from electronic annotation electronic inferred from annotation /// electronic annotation 16021 // integral to /// 16301 // kinase membrane // activity // inferred inferred from from electronic electronic annotation /// 16740 annotation // transferase activity // inferred from electronic annotation ygcE ygcE Hypothetical sugar kinase ygcE 5975 // carbohydrate 16301 // kinase metabolism // inferred activity // inferred from electronic annotation from electronic annotation focA focA F1C major fimbrial subunit precursor 7155 // cell adhesion // 9289 // fimbrium // inferred from electronic inferred from annotation electronic annotation (rtn) rtn Rtn protein ydbD ydbD hypothetical protein 211#11 ygfQ ygfQ predicted transporter 6810 // transport // inferred 16020 // membrane 166 // nucleotide from electronic annotation // inferred from binding // inferred electronic from electronic annotation annotation /// 5215 // transporter activity // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation folK folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 9396 // folic acid and 3848 // 2-amino-4- pyrophosphokinase derivative biosynthesis // hydroxy-6- inferred from electronic hydroxymethyldihydropteridine annotation diphosphokinase activity // inferred from electronic annotation /// 16301 // kinase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic ann 137 Highly immunogenic response proteins in CD frvX frvX predicted endo-1,4-beta- 16787 // glucanase hydrolase activity // inferred from electronic annotation LDR-D 416#1 sugE sugE SugE protein 6810 // transport // inferred from 16020 // membrane // inferred electronic annotation from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation dinD dinD DNA-damage-inducible protein fecB fecB KpLE2 phage-like element; iron-dicitrate transporter subunit 6810 // transport // inferred from 42597 // periplasmic space // 5381 // iron electronic annotation /// 6811 // inferred from electronic ion transporter ion transport // inferred from annotation activity // electronic annotation /// 6826 // inferred from iron ion transport // inferred from electronic electronic annotation /// 6827 // annotation /// high affinity iron ion transport // 5506 // iron inferred from electronic annotation ion binding // inferred from electronic annotation fliA fliA flagellar biosynthesis sigma factor FliA /// flagellar 6350 // transcription // inferred 3677 // DNA biosynthesis sigma factor from electronic annotation /// 6352 binding // // transcription initiation // inferred inferred from from electronic annotation /// 6355 electronic // regulation of transcription, annotation /// DNA-dependent // inferred from 3700 // electronic annotation transcription factor activity // inferred from electronic annotation /// 3899 // DNA- directed RNA polymerase activity // inferred from electronic annotation /// 16740 // transferase ac yjhA yjhA Hypothetical protein yjhA precursor /// N-acetylnuraminic 6810 // transport // inferred from 16020 // membrane // inferred 5351 // sugar acid outer membrane channel protein electronic annotation /// 6811 // from electronic annotation /// porter activity ion transport // inferred from 16021 // integral to // inferred electronic annotation membrane // inferred from from electronic annotation /// electronic 19867 // outer membrane // annotation /// inferred from electronic 15288 // porin annotation activity // inferred from electronic annotation (thiS) thiS sulfur carrier protein ThiS 6790 // sulfur metabolism // inferred from electronic annotation mcrD mcrD /// yjiV hypothetical protein ygbA ygbA Hypothetical protein ygbA /// hypothetical protein LDR-ABC slyD slyD FKBP-type peptidyl-prolyl cis-trans isomerase slyD /// FKBP- 6457 // protein folding // inferred 5515 // type peptidyl prolyl cis-trans isomerase (rotamase) from electronic annotation protein binding // inferred from physical interaction /// 3755 // peptidyl- prolyl cis- trans isomerase activity // inferred from electronic annotation /// 5507 // copper ion binding // inferred from electronic annotation /// 8270 // zinc ion bindin yliG yliG Hypothetical protein yliG /// predicted SAM-dependent 3824 // methyltransferase catalytic activity // inferred from electronic annotation /// 5506 // iron ion binding // inferred from electronic annotation /// 46872 // metal ion binding // inferred from electronic annotation /// 51536 // iron- sulfur cluster binding // inferre yfiD yfiD Protein yfiD /// pyruvate formate lyase subunit 8152 // metabolism // inferred 3824 // from electronic annotation catalytic activity // inferred from electronic annotation ycfF ycfF /// hinT HIT-like protein ycfF /// purine nucleoside phosphoramidase metJ metJ transcriptional repressor protein 6350 // transcription // inferred 3677 // DNA MetJ from electronic annotation /// 6355 binding // // regulation of transcription, inferred from DNA-dependent // inferred from electronic electronic annotation /// 6555 // annotation /// methionine metabolism // inferred 3700 // from electronic annotation /// 8652 transcription // amino acid bios factor activity // inferred from electronic annotation /// 16564 // transcriptional repressor activity // inferred from electronic annotation yicC yicC Protein yicC fecR fecR KpLE2 phage-like element; transmembrane signal 6810 // transport // inferred from 42597 // periplasmic space // 5506 // iron transducer for ferric citrate transport electronic annotation /// 6811 // inferred from electronic ion binding // ion transport // inferred from annotation inferred from electronic annotation /// 6826 // electronic iron ion transport // inferred from annotation electronic annotation /// 50896 // response to stimulus // inferred from electronic a rpsR rpsR 30S ribosomal protein S18 6412 // protein biosynthesis // 5622 // intracellular // 3723 // RNA inferred from electronic annotation inferred from electronic binding // annotation /// 5840 // inferred from ribosome // inferred from electronic electronic annotation /// annotation /// 30529 // ribonucleoprotein 3735 // complex // inferred from structural electronic annotation constituent of ribosome // inferred from electronic annotation /// 19843 // rRNA binding // inferred from electronic annotation ycgN ycgN hypothetical protein 448#2 norV pseudo /// anaerobic nitric oxide reductase flavorubredoxin 6118 // electron transport /// 6810 5506 // iron // transport ion binding /// 10181 // FMN binding /// 16491 // oxidoreductase activity /// 46872 // metal ion binding rbsB rbsB D-ribose-binding periplasmic protein precursor /// D-ribose 6810 // transport // inferred from 42597 // periplasmic space // 5351 // sugar transporter subunit electronic annotation /// 6935 // inferred from electronic porter activity chemotaxis // inferred from annotation // inferred electronic annotation from electronic annotation /// 15407 // monosaccharide- transporting ATPase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inferred from electronic annotation argB argB acetylglutamate kinase 6526 // arginine biosynthesis // 5737 // cytoplasm // inferred 166 // inferred from electronic annotation from electronic annotation nucleotide /// 8652 // amino acid biosynthesis binding // // inferred from electronic inferred from annotation /// 9085 // lysine electronic biosynthesis // inferred from annotation /// electronic annotation 3991 // acetylglutamate kinase activity // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 16301 // kinase activity // inferred fro hoxK hoxK hypothetical protein yfhD yfhD Hypothetical protein yfhD /// predicted transglycosylase 6810 // transport // inferred from 30288 // periplasmic space 5215 // electronic annotation (sensu Proteobacteria) // transporter inferred from electronic activity // annotation inferred from electronic annotation yjgF yjgF Protein yjgF fadB fadB 3-hydroxyacyl-CoA dehydrogenase /// fused 3- 6629 // lipid metabolism // inferred 16507 // fatty acid beta- 3824 // hydroxybutyryl-CoA epimerase/delta(3)-cis-delta(2)- from electronic annotation /// 6631 oxidation multienzyme catalytic trans-enoyl-CoA isomerase/enoyl-CoA // fatty acid metabolism // inferred complex // inferred from activity // hydratase/3-hydroxyacyl-CoA dehydrogenase from electronic annotation /// 8152 electronic annotation inferred from // metabolism // inferred from electronic electronic annotation /// 9062 // annotation /// fatty acid catabolism // inferred 3857 // 3- from elect hydroxyacyl- CoA dehydrogenase activity // inferred from electronic annotation /// 4165 // dodecenoyl- CoA delta- isomerase activity // inferred from electronic annotation /// 43 (phnE) phnE membrane channel protein 6810 // transport // inferred from 5887 // integral to plasma 5215 // component of Pn transporter electronic annotation /// 15716 // membrane // inferred from transporter phosphonate transport // inferred electronic annotation /// activity // from electronic annotation 16020 // membrane // inferred inferred from from electronic annotation /// electronic 16021 // integral to annotation /// membrane // inferred from 15604 // electronic annotation phosphonate transporter activity // inferred from electronic annotation gabD gabD Succinate-semialdehyde 8152 // metabolism // inferred 9013 // dehydrogenase [NADP+] /// succinate-semialdehyde from electronic annotation succinate- dehydrogenase I, NADP-dependent semialdehyde dehydrogenase [NAD(P)+] activity // inferred from electronic annotation /// 16491 // oxidoreductase activity // inferred from electronic annotation /// 16620 // oxidoreductase activity, acting on the aldehyde or oxo group of rbfA rbfA ribosome-binding factor A 6364 // rRNA processing // inferred from electronic annotation rpsL rpsL 30S ribosomal protein S12 6412 // protein biosynthesis // 5622 // intracellular // 49 // tRNA inferred from electronic annotation inferred from electronic binding // /// 46677 // response to antibiotic // annotation /// 5840 // inferred from inferred from electronic annotation ribosome // inferred from electronic electronic annotation /// annotation /// 15935 // small ribosomal 3676 // subunit // inferred from nucleic acid electronic annotation /// binding // 30529 // ribonucleoprotein inferred from complex // inferred from electronic electronic annotation annotation /// 3723 // RNA binding // inferred from electronic annotation /// 3735 // structural constituent of ribosome // inferred fro yjbL yjbL hypothetical protein nuoE nuoE ATP synthase subunit E /// NADH dehydrogenase subunit E 6120 // mitochondrial electron 5506 // iron transport, NADH to ubiquinone // ion binding // inferred from electronic annotation inferred from electronic annotation /// 8137 // NADH dehydrogenase (ubiquinone) activity // inferred from electronic annotation /// 16491 // oxidoreductase activity // inferred from electronic annotation /// 46872 // metal ion (gntU) gntU Low-affinity gluconate transport permease protein, 6810 // transport // inferred from 16020 // membrane // inferred 5351 // sugar interrupted /// gluconate transporter, low affinity GNT 1 electronic annotation /// 15725 // from electronic annotation /// porter activity system gluconate transport // inferred 16021 // integral to // inferred from electronic annotation /// membrane // inferred from from 19521 // D-gluconate metabolism electronic annotation electronic // inferred from electronic annotation /// annotation 15128 // gluconate transporter activity // inferred from electronic annotation rplP rplP 50S ribosomal protein L16 6412 // protein biosynthesis // 5622 // intracellular // 49 // tRNA inferred from electronic annotation inferred from electronic binding // annotation /// 5840 // inferred from ribosome // inferred from electronic electronic annotation /// annotation /// 30529 // ribonucleoprotein 3723 // RNA complex // inferred from binding // electronic annotation inferred from electronic annotation /// 3735 // structural constituent of ribosome // inferred from electronic annotation /// 19843 // rRNA binding // inferred from elect ubiG ubiG 3-demethylubiquinone-9 3-methyltransferase 6744 // ubiquinone biosynthesis // 5515 // inferred from electronic annotation protein binding // inferred from physical interaction /// 8168 // methyltransferase activity // inferred from electronic annotation /// 8425 // 2- polyprenyl-6- methoxy-1,4- benzoquinone methyltransferase activity // inferred from electronic annotati phnG phnG PhnG protein /// carbon-phosphorus lyase complex 15716 // phosphonate transport // subunit inferred from electronic annotation /// 19634 // phosphonate metabolism // inferred from electronic annotation mviN mviN Virulence factor mviN homolog /// predicted inner membrane 9405 // pathogenesis // inferred 16020 // membrane // inferred protein from electronic annotation from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation ydfA ydfA Hypothetical protein ydfB /// Hypothetical protein ydfA /// Qin prophage; predicted protein rpmJ rpmJ 50S ribosomal protein L36 6412 // protein biosynthesis // 5622 // intracellular // 3735 // inferred from electronic annotation inferred from electronic structural annotation /// 5840 // constituent of ribosome // inferred from ribosome // electronic annotation /// inferred from 30529 // ribonucleoprotein electronic complex // inferred from annotation electronic annotation yihD yihD Protein yihD /// hypothetical protein ydfR ydfR Hypothetical protein ydfR baiF baiF hypothetical protein ygbO ygbO tRNA pseudouridine synthase D 8033 // tRNA processing // 4730 // inferred from electronic annotation pseudouridylate /// 31119 // tRNA pseudouridine synthase synthesis // inferred from activity // electronic annotation inferred from electronic annotation /// 16439 // tRNA- pseudouridine synthase activity // inferred from electronic annotation /// 16853 // isomerase activity // inferred from electronic annotation yfeC yfeC Hypothetical protein yfeC /// predicted DNA-binding transcriptional regulator basS basS Sensor protein basS/pmrB /// 160 // two-component signal 16020 // membrane // inferred 155 // two- sensory histidine kinase in two-component regulatory system transduction system from electronic annotation /// component with BasR (phosphorelay) // inferred from 16021 // integral to sensor activity electronic annotation /// 6468 // membrane // inferred from // inferred protein amino acid electronic annotation from phosphorylation // inferred from electronic electronic annotation /// 7165 // annotation /// signal transduction // inferred from 4871 // signal electronic annotation transducer activity // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 16301 // kinase activity // inferr hisS hisS histidyl-tRNA synthetase 6412 // protein biosynthesis // 5737 // cytoplasm // inferred 166 // inferred from electronic annotation from electronic annotation nucleotide /// 6418 // tRNA aminoacylation binding // for protein translation // inferred inferred from from electronic annotation /// 6427 electronic // histidyl-tRNA aminoacylation // annotation /// inferred from electronic annotation 4812 // aminoacyl- tRNA ligase activity // inferred from electronic annotation /// 4821 // histidine- tRNA ligase activity // inferred from electronic annotation /// 5524 // ATP binding // rpiB rpiB ribose-5-phosphate isomerase B 5975 // carbohydrate metabolism // 5515 // inferred from electronic annotation protein /// 6098 // pentose-phosphate shunt binding // // inferred from electronic inferred from annotation physical interaction /// 4751 // ribose- 5-phosphate isomerase activity // inferred from electronic annotation /// 16853 // isomerase activity // inferred from electronic annotation yhcJ yhcJ /// nanE Hypothetical protein yhcJ /// predicted N-acetylmannosamine-6-P 5975 // carbohydrate metabolism // 5515 // epimerase inferred from electronic annotation protein /// 6051 // N-acetylmannosamine binding // metabolism // inferred from inferred from electronic annotation physical interaction /// 16853 // isomerase activity // inferred from electronic annotation /// 16857 // racemase and epimerase activity, acting on carbohydrates and derivatives // inferred from electronic annotati atpB atpB ATP synthase subunit A /// F0F1 ATP synthase subunit A 6810 // transport // inferred from 16020 // membrane // inferred 15078 // electronic annotation /// 6811 // from electronic annotation /// hydrogen ion ion transport // inferred from 16021 // integral to transporter electronic annotation /// 15992 // membrane // inferred from activity // proton transport // inferred from electronic annotation /// inferred from electronic annotation 16469 // proton-transporting electronic two-sector ATPase complex annotation /// // inferred from electronic 16820 // annotation /// 45263 // hydrolase proton-transpo activity, acting on acid anhydrides, catalyzing transmembrane movement of substances // inferred from electronic annotation /// 16787 // hydrolase act yijF yijF Hypothetical protein yijF precursor /// hypothetical protein clpX clpX ATP-dependent protease ATP- 6457 // protein folding // inferred 166 // binding subunit from electronic annotation /// nucleotide 15031 // protein transport // binding // inferred from electronic annotation inferred from /// 19538 // protein metabolism // electronic inferred from electronic annotation annotation /// /// 6986 // response to unfolded 5515 // protein // inferre protein binding // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation /// 8270 // zinc ion binding // inferred from electronic ann aspA aspA Aspartate ammonia-lyase 6531 // aspartate metabolism // 5515 // inferred from electronic annotation protein binding // inferred from physical interaction /// 3824 // catalytic activity // inferred from electronic annotation /// 8797 // aspartate ammonia- lyase activity // inferred from electronic annotation /// 16829 // lyase activity // inferred yigK yigK /// rhtB Homoserine/homoserine lactone 6810 // transport // inferred from 16020 // membrane // inferred 5293 // lysine efflux protein /// neutral amino- electronic annotation /// 6865 // from electronic annotation /// permease acid efflux system amino acid transport // inferred 16021 // integral to activity // from electronic annotation membrane // inferred from inferred from electronic annotation electronic annotation yjhO yjhO /// sgcX KpLE2 phage-like element; 16787 // predicted endoglucanase with Zn-dependent exopeptidase hydrolase domain activity // inferred from electronic annotation cysD cysD sulfate adenylyltransferase 103 // sulfate assimilation // 4781 // sulfate subunit 2 inferred from electronic annotation adenylyltransferase /// 8152 // metabolism // inferred (ATP) from electronic annotation /// 8652 activity // // amino acid biosynthesis // inferred from inferred from electronic annotation electronic /// 19344 // cysteine biosynthesis // annotation /// inferred from electronic annotation 16740 // transferase activity // inferred from electronic annotation /// 16779 // nucleotidyltransferase activity // inferred from electronic annotation yjbR yjbR Protein yjbR /// hypothetical protein yiiF yiiF hypothetical protein cysW cysW sulfate/thiosulfate transporter 6810 // transport // inferred from 9276 // cell wall (sensu 5215 // subunit electronic annotation /// 8272 // Proteobacteria) // inferred transporter sulfate transport // inferred from from electronic annotation /// activity // electronic annotation 16020 // membrane // inferred inferred from from electronic annotation /// electronic 16021 // integral to annotation /// membrane // inferred from 15116 // electronic annotation sulfate transporter activity // inferred from electronic annotation /// 15563 // uptake permease activity // inferred from electronic annotation 221#15 rpsG rpsG 30S ribosomal protein S7 6412 // protein biosynthesis // 5622 // intracellular // 49 // tRNA inferred from electronic annotation inferred from electronic binding // annotation /// 5840 // inferred from ribosome // inferred from electronic electronic annotation /// annotation /// 15935 // small ribosomal 3723 // RNA subunit // inferred from binding // electronic annotation /// inferred from 30529 // ribonucleoprotein electronic complex // inferred from annotation /// electronic annotation 3735 // structural constituent of ribosome // inferred from electronic annotation /// 19843 // rRNA binding // inferred from elect yhfR yhfR /// frlR predicted DNA-binding 6350 // transcription // inferred 5622 // intracellular // 5515 // transcriptional regulator from electronic annotation /// 6355 inferred from electronic protein // regulation of transcription, annotation binding // DNA-dependent // inferred from inferred from electronic annotation /// 45449 // physical regulation of transcription // interaction /// inferred from electronic annotation 3677 // DNA binding // inferred from electronic annotation /// 3700 // transcription factor activity // inferred from electronic annotation /// 30528 // transcription regulator activity // flxA flxA Qin prophage; predicted protein agaZ agaZ /// kbaZ Putative tagatose 6-phosphate 19402 // galactitol metabolism // 9024 // kinase agaZ /// tagatose 6-phosphate aldolase 1, kbaZ subunit inferred from electronic annotation tagatose-6- phosphate kinase activity // inferred from electronic annotation /// 16301 // kinase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation (ycfA) tfaE e14 prophage; predicted tail fiber assembly protein yhfV yhfV Phosphotriesterase homology 9056 // catabolism // inferred from 8270 // zinc protein electronic annotation ion binding // inferred from electronic annotation /// 16788 // hydrolase activity, acting on ester bonds // inferred from electronic annotation yieJ yieJ /// cbrC hypothetical protein yjbQ yjbQ Hypothetical protein yjbQ /// hypothetical protein ptsN ptsN Nitrogen regulatory IIA protein /// sugar-specific enzyme IIA 6810 // transport // inferred from 5351 // sugar component of PTS electronic annotation /// 9401 // porter activity phosphoenolpyruvate-dependent // inferred sugar phosphotransferase system // from inferred from electronic annotation electronic annotation /// 8982 // protein-N(PI)- phosphohistidine- sugar phosphotransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotati ygbD ygbD nitric oxide reductase 6118 // electron transport // 15036 // inferred from electronic annotation disulfide oxidoreductase activity // inferred from electronic annotation /// 16491 // oxidoreductase activity // inferred from electronic annotation /// 16731 // oxidoreductase activity, acting on iron-sulfur proteins as donors, NAD or NADP as ac fimB fimB Type 1 fimbriae Regulatory 6310 // DNA recombination // 9289 // fimbrium // inferred 3677 // DNA protein fimB /// tyrosine recombinase/inversion of on/off inferred from electronic annotation from electronic annotation binding // regulator of fimA /// 6313 // transposition, DNA- inferred from mediated // inferred from electronic electronic annotation /// 6350 // annotation transcription // inferred from electronic annotation /// 6355 // regulation of transcription, DNA-d lasT lasT /// yjtD Hypothetical tRNA/rRNA 6396 // RNA processing // inferred 3723 // RNA methyltransferase lasT /// predicted rRNA methyltransferase from electronic annotation binding // inferred from electronic annotation /// 8168 // methyltransferase activity // inferred from electronic annotation /// 8173 // RNA methyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // ivbL ivbL IlvBN operon leader peptide /// 8652 // amino acid biosynthesis // ilvB operon leader peptide inferred from electronic annotation /// 9082 // branched chain family amino acid biosynthesis // inferred from electronic annotation gst gst Glutathione S-transferase /// glutathionine S-transferase 4364 // glutathione transferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation phbA phbA hypothetical protein phnM phnM PhnM protein 16787 // hydrolase activity // inferred from electronic annotation yhgI yhgI /// gntY Protein yhgI /// predicted gluconate transport associated protein trmD trmD tRNA (guanine-N(1)-)- 6400 // tRNA modification // 3723 // RNA methyltransferase inferred from electronic annotation binding // /// 8033 // tRNA processing // inferred from inferred from electronic annotation electronic annotation /// 8168 // methyltransferase activity // inferred from electronic annotation /// 8175 // tRNA methyltransferase activity // inferred from electronic annotation /// 9019 // tRNA (guanine-N1-)- meth grxA grxA Glutaredoxin 1 /// glutaredoxin 6118 // electron transport // 5515 // 1, redox coenzyme for inferred from electronic annotation protein ribonucleotide reductase /// 6810 // transport // inferred binding // (RNR1a) from electronic annotation /// 9263 inferred from // deoxyribonucleotide physical biosynthesis // inferred from interaction /// electronic annotation /// 45454 // 9055 // cell redox homeostasis // infer electron carrier activity // inferred from electronic annotation /// 15035 // protein disulfide oxidoreductase activity // inferred from electronic annotation gcpE gcpE /// ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase /// 4- 8299 // isoprenoid biosynthesis // 5506 // iron hydroxy-3-methylbut-2-en-1-yl diphosphate synthase inferred from electronic annotation ion binding // /// 16114 // terpenoid biosynthesis inferred from // inferred from electronic electronic annotation annotation /// 16491 // oxidoreductase activity // inferred from electronic annotation /// 16728 // oxidoreductase activity, acting on CH2 groups, disulfide as acceptor // inferred from electronic annot ycdB ycdB hypothetical protein yfiC yfiC Hypothetical protein yfiC /// predicted S-adenosyl-L- 8168 // methionine-dependent methyltransferase methyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation (rcsC) rcsC Sensor protein rcsC /// hybrid 160 // two-component signal 16020 // membrane // inferred 155 // two- sensory kinase in two- transduction system from electronic annotation /// component component regulatory system with RcsB and YojN (phosphorelay) // inferred from 16021 // integral to sensor activity electronic annotation /// 6355 // membrane // inferred from // inferred regulation of transcription, DNA- electronic annotation /// from dependent // inferred from 30113 // capsule (sensu electronic electronic annotation /// 6468 // Bacteria) // inferred from annotation /// protein amino acid electronic annotation 156 // two- phosphorylation // inferred from component electronic annotation response regulator activity // inferred from electronic annotation /// 4871 // signal transducer activity // inferred from electronic annotation /// 5524 yedF yedF Hypothetical protein yedF /// hypothetical protein yfjI yfjI CP4-57 prophage; predicted protein yhdN yhdN Hypothetical protein yhdN /// hypothetical protein phnB phnB PhnB protein /// hypothetical protein (yfjV) yfjV CP4-57 prophage; predicted 46685 // response to arsenic // 16020 // membrane // inferred 15105 // protein inferred from electronic annotation from electronic annotation /// arsenite 16021 // integral to transporter membrane // inferred from activity // electronic annotation inferred from electronic annotation ydhL ydhL Hypothetical protein ydhL precursor yhaN yhaN hypothetical protein /// 16020 // membrane // inferred hypothetical protein from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation slyA slyA transcriptional regulator SlyA 6350 // transcription // inferred 5622 // intracellular // 3677 // DNA from electronic annotation /// 6355 inferred from electronic binding // // regulation of transcription, annotation inferred from DNA-dependent // inferred from electronic electronic annotation /// 9405 // annotation /// pathogenesis // inferred from 3700 // electronic annotation transcription factor activity // inferred from electronic annotation 411#4 yfdK Hypothetical protein yfdK 633#5 folP folP Dihydropteroate synthase /// 9396 // folic acid and derivative 4156 // 7,8-dihydropteroate synthase biosynthesis // inferred from dihydropteroate electronic annotation /// 46656 // synthase folic acid biosynthesis // inferred activity // from electronic annotation /// inferred from 46677 // response to antibiotic // electronic inferred from electronic annotation annotation /// 16740 // transferase activity // inferred from electronic annotation 336#6 glvB glvB arbutin specific enzyme IIB 6810 // transport // inferred from 16020 // membrane // inferred 5351 // sugar component of PTS electronic annotation /// 9401 // from electronic annotation /// porter activity phosphoenolpyruvate-dependent 16021 // integral to // inferred sugar phosphotransferase system // membrane // inferred from from inferred from electronic annotation electronic annotation electronic annotation /// 8982 // protein-N(PI)- phosphohistidine- sugar phosphotransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotati hflX hflX GTP-binding protein hflX /// 7264 // small GTPase mediated 5622 // intracellular // 166 // predicted GTPase signal transduction // inferred from inferred from electronic nucleotide electronic annotation annotation binding // inferred from electronic annotation /// 5525 // GTP binding // inferred from electronic annotation /// 8233 // peptidase activity // inferred from electronic annotation hemX hemX Putative uroporphyrin-III C- 6779 // porphyrin biosynthesis // 16020 // membrane // inferred 4851 // methyltransferase /// predicted uroporphyrinogen III methylase inferred from electronic annotation from electronic annotation /// uroporphyrin- 16021 // integral to III C- membrane // inferred from methyltransferase electronic annotation activity // inferred from electronic annotation /// 8168 // methyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation yceD yceD Hypothetical protein yceD /// hypothetical protein ptpS ptpS /// ygcM Putative 6-pyruvoyl tetrahydrobiopterin synthase /// 6729 // tetrahydrobiopterin 3874 // 6- 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) biosynthesis // inferred from pyruvoyltetra electronic annotation hydropterin synthase activity // inferred from electronic annotation /// 8270 // zinc ion binding // inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation /// 46872 // metal ion bindi ibpB ibpB 16 kDa heat shock protein B /// heat shock chaperone 6457 // protein folding // inferred 5515 // from electronic annotation /// 6986 protein // response to unfolded protein // binding // inferred from electronic annotation inferred from /// 50821 // protein stabilization // physical inferred from electronic annotation interaction /// 51082 // unfolded protein binding // inferred from electronic annotation ecnB ecnB Putative toxin of osmotically 9636 // response to toxin // 16020 // membrane // inferred regulated toxin-antitoxin system inferred from electronic annotation from electronic annotation associated with programmed cell death /// entericidin B membrane lipoprotein aceB aceB malate synthase 6097 // glyoxylate cycle // inferred 4474 // malate from electronic annotation /// 6099 synthase // tricarboxylic acid cycle // activity // inferred from electronic annotation inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation yehR yehR Hypothetical lipoprotein yehR precursor /// hypothetical protein 16020 // membrane // inferred from electronic annotation hsdM hsdM DNA methylase M 6306 // DNA methylation // 5515 // inferred from electronic annotation protein /// 9307 // DNA restriction- binding // modification system // inferred inferred from from electronic annotation physical interaction /// 3677 // DNA binding // inferred from electronic annotation /// 8168 // methyltransferase activity // inferred from electronic annotation /// 8170 // N- methyltransferase activity // inferred yrbB yrbB Hypothetical protein yrbB /// hypothetical protein hypC hypC Hydrogenase isoenzyme 3676 // formation protein hypC /// nucleic acid protein required for maturation binding // of hydrogenases 1 and 3 inferred from electronic annotation vacJ vacJ VacJ lipoprotein precursor /// predicted lipoprotein 16020 // membrane // inferred from electronic annotation /// 19867 // outer membrane // inferred from electronic annotation 405#2 ydfD ydfD Hypothetical protein ydfD rpsK rpsK 30S ribosomal protein S11 6412 // protein biosynthesis // 5622 // intracellular // 3723 // RNA inferred from electronic annotation inferred from electronic binding // annotation /// 5840 // inferred from ribosome // inferred from electronic electronic annotation /// annotation /// 30529 // ribonucleoprotein 3735 // complex // inferred from structural electronic annotation constituent of ribosome // inferred from electronic annotation /// 19843 // rRNA binding // inferred from electronic annotation yieF yieF Hypothetical protein yieF /// 16491 // chromate reductase, Class I, oxidoreductase flavoprotein activity // inferred from electronic annotation sixA slp Outer membrane protein slp 16020 // membrane // inferred precursor /// outer membrane lipoprotein from electronic annotation /// 19867 // outer membrane // inferred from electronic annotation yijD yijD Hypothetical protein yijD /// conserved inner membrane 16020 // membrane // inferred protein from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation fliS fliS flagellar protein FliS 9296 // flagellum biogenesis // 9288 // flagellum (sensu inferred from electronic annotation Bacteria) // inferred from electronic annotation /// 19861 // flagellum // inferred from electronic annotation hycA hycA Formate hydrogenlyase 6350 // transcription // inferred 16829 // lyase Regulatory protein hycA /// from electronic annotation /// 6355 activity // regulator of the transcriptional // regulation of transcription, inferred from regulator FhlA DNA-dependent // inferred from electronic electronic annotation annotation wcaA wcaA Putative colanic acid biosynthesis glycosyl 9103 // lipopolysaccharide 16740 // transferase wcaA /// predicted glycosyl transferase biosynthesis // inferred from transferase electronic annotation activity // inferred from electronic annotation yhaC yhaC hypothetical protein 348#4 yoeE hypothetical protein yjhF yjhF KpLE2 phage-like element; 6810 // transport // inferred from 16020 // membrane // inferred 15128 // predicted transporter electronic annotation /// 15725 // from electronic annotation /// gluconate gluconate transport // inferred 16021 // integral to transporter from electronic annotation membrane // inferred from activity // electronic annotation inferred from electronic annotation recN recN DNA repair protein recN /// recombination and repair protein 6281 // DNA repair // inferred 5694 // chromosome // 5515 // from electronic annotation /// 6310 inferred from electronic protein // DNA recombination // inferred annotation /// 16020 // binding // from electronic annotation /// 6974 membrane // inferred from inferred from // response to DNA damage electronic annotation physical stimulus // inferred from electronic interaction /// annotation /// 51276 // 166 // chromosome organization and nucleotide biog binding // inferred from electronic annotation /// 5524 // ATP binding // inferred from electronic annotation lldR lldR Putative L-lactate dehydrogenase operon 6350 // transcription // inferred 5622 // intracellular // 3677 // DNA Regulatory protein from electronic annotation /// 6355 inferred from electronic binding // // regulation of transcription, annotation inferred from DNA-dependent // inferred from electronic electronic annotation annotation /// 3700 // transcription factor activity // inferred from electronic annotation yihA yihA GTP-binding protein 917 // barrier septum formation // 5622 // intracellular // 166 // inferred from electronic annotation inferred from electronic nucleotide /// 7049 // cell cycle // inferred annotation binding // from electronic annotation /// inferred from 51301 // cell division // inferred electronic from electronic annotation annotation /// 5525 // GTP binding // inferred from electronic annotation ydiL ydiL Hypothetical protein ydiL /// hypothetical protein tdcB tdcB threonine dehydratase 6520 // amino acid metabolism // 3824 // inferred from electronic annotation catalytic /// 8152 // metabolism // inferred activity // from electronic annotation inferred from electronic annotation /// 4794 // threonine ammonia- lyase activity // inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation umuD umuD UmuD protein /// DNA polymerase V, subunit D 6280 // mutagenesis // inferred 3677 // DNA from electronic annotation /// 6281 binding // // DNA repair // inferred from inferred from electronic annotation /// 6508 // electronic proteolysis // inferred from annotation /// electronic annotation /// 6974 // 4252 // serine- response to DNA damage stimulus type // inferred from electronic endopeptidase annotation activity // inferred from electronic annotation /// 8233 // peptidase activity // inferred from electronic annotation /// 8236 // serine- type peptidase activi rplQ rplQ 50S ribosomal protein L17 6412 // protein biosynthesis // 5622 // intracellular // 3735 // inferred from electronic annotation inferred from electronic structural annotation /// 5840 // constituent of ribosome // inferred from ribosome // electronic annotation /// inferred from 30529 // ribonucleoprotein electronic complex // inferred from annotation electronic annotation yjbI yjbI hypothetical protein infC infC Translation initiation factor IF-3 6412 // protein biosynthesis // 3743 // inferred from electronic annotation translation /// 6413 // translational initiation // initiation inferred from electronic annotation factor activity /// 6417 // regulation of protein // inferred biosynthesis // inferred from from electronic annotation /// 6445 // electronic regulation of annotation /// 3723 // RNA binding // inferred from electronic annotation aroF aroF 3-deoxy-7-phosphoheptulonate synthase /// 3-deoxy-D-arabino- 8652 // amino acid biosynthesis // 3849 // 3- heptulosonate-7-phosphate synthase, tyrosine-repressible inferred from electronic annotation deoxy-7- /// 9058 // biosynthesis // inferred phosphoheptulonate from electronic annotation /// 9073 synthase // aromatic amino acid family activity // biosynthesis // inferred from inferred from electronic annotation electronic annotation /// 16740 // transferase activity // inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation yjiA yjiA Hypothetical protein yjiA /// predicted GTPase 166 // nucleotide binding // inferred from electronic annotation /// 5525 // GTP binding // inferred from electronic annotation yohL yohL Hypothetical protein yohL /// hypothetical protein ftn ftn Ferritin 1 /// ferritin iron storage 6826 // iron ion transport // 4322 // protein (cytoplasmic) inferred from electronic annotation ferroxidase /// 6879 // iron ion homeostasis // activity // inferred from electronic annotation inferred from electronic annotation /// 5488 // binding // inferred from electronic annotation /// 5506 // iron ion binding // inferred from electronic annotation /// 8199 // ferric iron binding // inferred from electronic cysM cysM Cysteine synthase B /// cysteine synthase B (O-acetylserine 6535 // cysteine biosynthesis from 3824 // sulfhydrolase B) serine // inferred from electronic catalytic annotation /// 8152 // metabolism activity // // inferred from electronic inferred from annotation /// 8652 // amino acid electronic biosynthesis // inferred from annotation /// electronic annotation /// 19344 // 4124 // cysteine biosynthesis // cysteine synthase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation /// 16787 // hydrolase activity // inf aroK aroK shikimate kinase I 8652 // amino acid biosynthesis // 166 // inferred from electronic annotation nucleotide /// 9073 // aromatic amino acid binding // family biosynthesis // inferred inferred from from electronic annotation /// electronic 16089 // aromatic amino acid annotation /// family biosynthesis, shikimate 287 // pathway // inferred from electronic magnesium annotation ion binding // inferred from electronic annotation /// 4765 // shikimate kinase activity // inferred from electronic annotation /// 5524 // ATP binding // inferred from eno eno phosphopyruvate hydratase 6096 // glycolysis // inferred from 15 // phosphopyruvate 287 // electronic annotation hydratase complex // inferred magnesium from electronic annotation ion binding // inferred from electronic annotation /// 4634 // phosphopyruvate hydratase activity // inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation /// 46872 // metal ion binding //

(102) TABLE-US-00010 TABLE 4 SAM ANALYSIS OF HEALTHY CONTROLS (HC) VERSUS ULCERATIVE COLITIS (UC) (see FIG. 3C) SPOT PROTEIN NAME GO BP 6 Highly immunogenic proteins in UC era era GTP-binding protein Era 50875 // cellular physiological process // inferred from electronic annotation purK purK phosphoribosylaminoimidazole 6164 // purine nucleotide carboxylase biosynthesis // inferred from electronic annotation /// 6189 // de novo IMP biosynthesis // inferred from electronic annotation cadA cadA Lysine decarboxylase, inducible 6520 // amino acid /// lysine decarboxylase 1 metabolism // inferred from electronic annotation nrfF nrfF Formate-dependent nitrite reductase complex nrfF subunit precursor /// heme lyase (NrfEFG) for insertion of heme into c552, subunit NrfF murA murA UDP-N-acetylglucosamine 1- 7049 // cell cycle // carboxyvinyltransferase inferred from electronic annotation /// 8360 // regulation of cell shape // inferred from electronic annotation /// 9252 // tpiA tpiA triosephosphate isomerase peptidoglycan biosynthesis // inferred from electronic annotation /// 19277 // UDP-N- acetylgalactosamine bios 6094 // gluconeogenesis // inferred from electronic annotation /// 6096 // glycolysis // inferred from electronic annotation /// 6098 // pentose-phosphate shunt // inferred from electronic annotation /// 6633 // fatty acid biosynthesis // inferred from electronic annotation 27 Highly immunogenic proteins in HC yphA yphA Hypothetical protein yphA /// predicted inner membrane protein pssR pssR /// yifA /// hdfR transcriptional regulator 6350 // transcription // inferred HdfR /// transcriptional from electronic annotation /// regulator HdfR 6355 // regulation of transcription, DNA-dependent // inferred from electronic annotation /// 45892 // negative regulation of transcription, DNA-dependent // inferred from electronic annotat yhdN yhdN Hypothetical protein yhdN /// hypothetical protein rplO rplO 50S ribosomal protein L15 6412 // protein biosynthesis // inferred from electronic annotation 420#7 ypeA putative acetyltransferase yehK yehK hypothetical protein yihG yihG Hypothetical protein yihG /// 8152 // metabolism // inferred predicted endonuclease from electronic annotation sucB sucB dihydrolipoamide 6099 // tricarboxylic acid cycle acetyltransferase // inferred from electronic annotation /// 8152 // metabolism // inferred from electronic annotation yggH yggH tRNA (guanine-N(7)-)- 6400 // tRNA modification // methyltransferase /// inferred from electronic tRNA(m7G46)- annotation /// 8033 // tRNA methyltransferase processing // inferred from electronic annotation rpsK rpsK 30S ribosomal protein S11 6412 // protein biosynthesis // inferred from electronic annotation fadA fadA acetyl-CoA acetyltransferase 6629 // lipid metabolism // inferred from electronic annotation /// 6631 // fatty acid metabolism // inferred from electronic annotation /// 16042 // lipid catabolism // inferred from electronic annotation ydfO ydfO Hypothetical protein ydfO /// Qin prophage; predicted protein yjhA yjhA Hypothetical protein yjhA 6810 // transport // inferred precursor /// N- from electronic annotation /// acetylnuraminic acid outer 6811 // ion transport // inferred membrane channel protein from electronic annotation yheU yheU hypothetical protein rpsL rpsL 30S ribosomal protein S12 6412 // protein biosynthesis // inferred from electronic annotation /// 46677 // response to antibiotic // inferred from electronic annotation yibQ yibQ Hypothetical protein yibQ precursor /// predicted polysaccharide deacetylase ycfF ycfF /// hinT HIT-like protein ycfF /// purine nucleoside phosphoramidase yzgL yzgL hypothetical protein yjfY yjfY hypothetical protein 316#4 rsxA hypothetical protein yneC yneC hypothetical protein yneG yneG Hypothetical protein yneG /// hypothetical protein fabH fabH 3-oxoacyl-(acyl carrier 6633 // fatty acid biosynthesis // protein) synthase inferred from electronic ribonuclease activity annotation /// 8610 // lipid biosynthesis // inferred from electronic annotation menG menG regulator protein RraA sixA slp Outer membrane protein slp precursor /// outer membrane lipoprotein yhdM yhdM /// zntR zinc-responsive 6350 // transcription // inferred transcriptional regulator from electronic annotation /// 6355 // regulation of transcription, DNA-dependent // inferred from electronic annotation ptsH ptsH Phosphocarrier protein HPr 6810 // transport // inferred /// phosphohistidinoprotein- from electronic annotation /// hexose phosphotransferase 9401 // phosphoenolpyruvate- component of PTS system dependent sugar (Hpr) phosphotransferase system // inferred from electronic annotation SPOT GO CC GO MF 6 Highly immunogenic proteins in UC era 5622 // intracellular // inferred 166 // nucleotide binding // inferred from electronic annotation /// from electronic annotation /// 3676 // 16020 // membrane // inferred nucleic acid binding // inferred from from electronic annotation electronic annotation /// 3723 // RNA binding // inferred from electronic annotation /// 5525 // GTP binding // inferred from electronic annotation purK 9320 // 166 // nucleotide binding // inferred phosphoribosylaminoimidazole from electronic annotation /// 3824 // carboxylase complex // inferred catalytic activity // inferred from from electronic annotation electronic annotation /// 4638 // phosphoribosylaminoimidazole carboxylase activity // inferred from electronic annotation /// 5524 // ATP bin cadA 5737 // cytoplasm // inferred 5515 // protein binding // inferred from electronic annotation from physical interaction /// 3824 // catalytic activity // inferred from electronic annotation /// 8923 // lysine decarboxylase activity // inferred from electronic annotation /// 16829 // lyase activity // inferred from electronic annotation nrfF 42597 // periplasmic space // 5506 // iron ion binding // inferred inferred from electronic from electronic annotation /// 46872 annotation // metal ion binding // inferred from electronic annotation murA 5618 // cell wall // inferred from 8760 // UDP-N-acetylglucosamine electronic annotation 1-carboxyvinyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation tpiA 4807 // triose-phosphate isomerase activity // inferred from electronic annotation /// 16853 // isomerase activity // inferred from electronic annotation 27 Highly immunogenic proteins in HC yphA 16020 // membrane // inferred from electronic annotation /// 16021 // integral to membrane // inferred from electronic annotation pssR 3677 // DNA binding // inferred from electronic annotation /// 3700 // transcription factor activity // inferred from electronic annotation yhdN rplO 5622 // intracellular // 3723 // RNA binding // inferred from electronic inferred from electronic annotation /// 5840 // annotation /// 3735 // ribosome // inferred from structural constituent of electronic annotation /// ribosome // inferred from 15934 // large ribosomal electronic annotation /// subunit // inferred from 19843 // rRNA binding // electronic annotation /// inferred from electronic 30529 // ribonucleoprotein annotation complex // inferred from electronic annotation 420#7 8080 // N-acetyltransferase activity /// 8415 // acyltransferase activity /// 16740 // transferase activity /// 16747 // transferase activity, transferring groups other than amino-acyl groups yehK yihG 16020 // membrane // 8415 // acyltransferase inferred from electronic activity // inferred from annotation /// 16021 // electronic annotation /// integral to membrane // 16740 // transferase activity // inferred from electronic inferred from electronic annotation annotation /// 4519 // endonuclease activity // inferred from electronic annotation sucB 45252 // oxoglutarate 4149 // dihydrolipoyllysine- dehydrogenase complex // residue succinyltransferase inferred from electronic activity // inferred from annotation electronic annotation /// 5515 // protein binding // inferred from electronic annotation /// 8415 // acyltransferase activity // inferred from electronic annotation /// 1674 yggH 8168 // methyltransferase activity // inferred from electronic annotation /// 8176 // tRNA (guanine-N7-)- methyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation rpsK 5622 // intracellular // 3723 // RNA binding // inferred from electronic inferred from electronic annotation /// 5840 // annotation /// 3735 // ribosome // inferred from structural constituent of electronic annotation /// ribosome // inferred from 30529 // ribonucleoprotein electronic annotation /// complex // inferred from 19843 // rRNA binding // electronic annotation inferred from electronic annotation fadA 3988 // acetyl-CoA C- acyltransferase activity // inferred from electronic annotation /// 8415 // acyltransferase activity // inferred from electronic annotation /// 16740 // transferase activity // inferred from electronic annotation ydfO yjhA 16020 // membrane // 5351 // sugar porter activity // inferred from electronic inferred from electronic annotation /// 16021 // annotation /// 15288 // porin integral to membrane // activity // inferred from inferred from electronic electronic annotation annotation /// 19867 // outer membrane // inferred from electronic annotation yheU rpsL 5622 // intracellular // 49 // tRNA binding // inferred inferred from electronic from electronic annotation /// annotation /// 5840 // 3676 // nucleic acid binding // ribosome // inferred from inferred from electronic electronic annotation /// annotation /// 3723 // RNA 15935 // small ribosomal binding // inferred from subunit // inferred from electronic annotation /// 3735 electronic annotation /// // structural constituent of 30529 // ribonucleoprotein ribosome // inferred fro complex // inferred from el yibQ ycfF yzgL yjfY 316#4 yneC yneG fabH 3824 // catalytic activity // inferred from electronic annotation /// 4315 // 3- oxoacyl-[acyl-carrier protein] synthase activity // inferred from electronic annotation /// 8415 // acyltransferase activity // inferred from electronic annotation /// 16740 / menG sixA 16020 // membrane // inferred from electronic annotation /// 19867 // outer membrane // inferred from electronic annotation yhdM 5622 // intracellular // 3677 // DNA binding // inferred from electronic inferred from electronic annotation annotation /// 3700 // transcription factor activity // inferred from electronic annotation /// 8270 // zinc ion binding // inferred from electronic annotation /// 46872 // metal ion binding // inferred from ptsH 5515 // protein binding // inferred from physical interaction /// 5351 // sugar porter activity // inferred from electronic annotation
As shown in the Venn diagram in FIG. 3D, the immunogenic responses to 417 proteins were found to be different between healthy control and Crohn's Disease or ulcerative colitis. Of these 417 proteins, 169 proteins were identified as highly immunogenic in healthy control, 186 proteins are highly immunogenic in Crohn's Disease and only 19 in ulcerative colitis. 44 proteins were highly immunogenic in both healthy control and inflammatory bowel disease (Crohn's Disease or ulcerative colitis). Among these 44 proteins, six overlap between healthy control and Crohn's Disease and 38 overlap between healthy control and ulcerative colitis. A full list of the immunogenic E. coli proteins in FIG. 3D can be found in Table 5.

(103) TABLE-US-00011 TABLE 5 List of differentially immunogenic proteins among Healthy Control (HC), Crohn's Disease (CD) and ulcerative colitis (UC), as illustrated in FIG. 3A PROTEIN SPOT HC CD UC Legend rpsK Highly immunogenic rpsL sixA ycfF yhdN yjhA era (yeeF) 211#11 23-12A0 279#6 427#1 dgkA dinI emrY focA folK fsr glnD kch maoC msbA nac nagE narI ppx prtC rfaB secF secY/prlA trkG yafJ yaiM ybbC ycbM ydaA ydbD ydhV yefI yeiO ygjR yhiN yjgT yojI yphD (yhcP) (yhhT) (yhiW) 16-3B0 214#3 233#6 273#6 280#1 316#4 321#3 323#1 331#2 356#7 406#7 409#5 411#1 420#7 452#13 610#6.1 aceF allP ansP aqpZ atoE brnQ celD cobU codB cybB cydB cydC dgt dnaQ ebgA emrB emrD exuR fabH fabZ fadA fepD flhD glnQ glpF gppA greA hemY JW0438 JW1949 lipA lpxC malX malZ menG mrdB murG mutT narU nfrB nrfE ompC oppC oppF pbuX pheP phsE pnuC potC pssR ptsH putP queA rfaL rffG rocE rplO sdhD secB sfsA slyX sucB sucD tauB thiL trkH udk uidB virK yaaH yabK yadQ yaeG yagG yagM yaiV yajR ybaN ybdS ybfB ybfC ybgE ybhA ybhL ybhM ybhN ybhR ycaD yccY ycdG yciQ yciR yciS ydcD yddH ydeF ydeZ ydfO ydjS ydjZ yeaS yehK yehY yejF yfiY ygeD ygfF yggH yghK yghT ygjQ yhaH yhaO yhbX yhcO yhdM yhdT yheG yheU yhfU yhhL yhhS yhiP yhiQ yhjX yiaL yiaQ yibL yibQ yicO yidY yifE yigF yihG yjeM yjfF yjfP yjfY yjhB ymdD ynaJ yneC yneG ynjC yoaA yohG yphA yphG yqcE yzgL (gntU) (phnE) (rcsC) (thiS) (ycfA) (yfjV) 221#15 267#6 304#1 319#17 336#6 348#4 405#2 411#4 416#1 430#8 445#15 448#2 633#5 aceB agaZ aidA argB argC aroF aroK aspA atpB baiF basS cedA citB citG clpX cysD cysJ cysM cysW dgxA dicC dinD ecnB eno fadB fba fdhE fecB fecR fimB fimC fliA fliS flxA folP frvX ftn fumB gabD galR gcpE glvB grxA grxC gst hemX hflX hisS hofH hoxK hsdM hycA hycF hypC ibpB infC ivbL lasT LDR-ABC LDR-D lldR mcrD metB metJ mltB mviN narY nuoE phbA phnB phnG phnM ppdB ptpS ptsN purM radC rbfA rbsB recN rffD rpiB rplP rplQ rplT rpmJ rpsG rpsR selD slyA slyD ssi6 sugE tdcB thiF torA trmD ubiG umuD vacJ wcaA ybbA ybbQ ycbF ycdB yceD ycgN ydfA ydfD ydfR ydhL ydiL yedF yehR yejG yejO yfeC yfhD yfiC yfiD yfjI yfjQ ygbA ygbD ygbO ygcQ ygeW ygfY yhaA yhaC yhaN yhcI yhcJ yhfR yhfV yhgH yhgI yicC yieF yieJ yigK yihA yihD yihK yiiF yijD yijF yjaI yjbI yjbL yjbQ yjbR yjcS yjeB yjeJ yjgF yjhC yjhE yjhF yjhO yjiA yliG ymfE yohL yphC yrbB (rtn) cadA lueO mesJ mhpF modC murA nrfF prpE purK tpiA yciD yejA ygcE ygfQ yhjC yjfH yjiJ Legend Highly immunogenic
This demonstrates that ulcerative colitis and healthy control subjects share more common immunogenic profiles than Crohn's Disease and healthy control. In general, these results indicate that much of the global immunogenic profiles of sera samples were systematically correlated with either healthy controls or IBD phenotypes and that sample class can be distinguished based on the sample's immunogenic profile.

Example 3: Protein Functional Enrichment Analysis

(104) To delineate the immunogenic signatures of the healthy controls and IBD subtypes the differentially immunogenic proteins were assigned to functional groups based on classification by Gene Ontology (www.geneontology.org). Functional grouping of the 417 proteins were assigned by querying EcoCyc (http://ecocyc.org/) and KEGG (www.genome.ad.jp/kegg) databases, as well as cross-checked with Affymetrix E. coli Genome Array annotation file (www.affymetrix.com). 338 of these 417 proteins were assigned to at least one gene ontology (GO) term, and 78 hypothetical proteins have unknown annotations. The enrichment analysis was focussed on five GO cellular component terms (membrane, cell wall, intracellular, macromolecular complex, periplasmic space and cell projection). To assess whether the selected differentially immunogenic proteins were enriched in one of the GO terms, the hypergeometric statistical test was used to compute the probability of the number of proteins in each cellular component appearing by chance within the proteins highly immunogenic in healthy control (169), Crohn's Disease (185) and ulcerative colitis (18). FIG. 4 summarizes the enrichment analysis of these proteins that are immunogenic in healthy control and Crohn's Disease or ulcerative colitis. Antibodies against membrane proteins are highly enriched in healthy control samples (p<0.0001). Interestingly, antibodies against intracelluar and macromolecular complex proteins are highly enriched in Crohn's Disease samples (p<0.05), while those against cell wall proteins are highly enriched in ulcerative colitis samples (p<0.05). Although 12% proteins that were found to be highly immunogenic in Crohn's Disease samples were located in periplasmic space, their enrichment was not statistically significant (p=0.064) for this IBD subtype. Proteins located in cell projection term are not enriched in either healthy controls or IBD subtypes.

Example 4: Machine Learning Analysis

(105) Next, optimal classifiers were constructed from the immunogenic response profiles to differentiate healthy control from the IBD subtypes (Crohn's Disease and ulcerative colitis), as well as to differentiate Crohn's Disease from ulcerative colitis. Upon successful construction of these classifiers, the classification rules may result in the discovery of new robust biomarkers. k-TSP, a novel machine learning method was employed to discover simple decision rules classifiers from the immunogenic response profiles. The three top scoring pairs were identified as classifiers to differentiate healthy control samples from Crohn's Disease samples as follows:

(106) 1. If a subject sample shows greater immunogenic reactivity to era than to ybaN then the subject is identified as likely having Crohn's Disease, or else as UC.

(107) 2. If a subject sample shows greater immunogenic reactivity to yhgN than to focA then the subject is identified as likely having Crohn's Disease or as a healthy control; and

(108) 3. If a subject sample shows greater immunogenic reactivity to gabT than ycdG then the subject is identified as likely having Crohn's Disease (see representative examples of actual images of immuno-reactive protein spots in FIG. 2). If all three pairs identify the subject as having Crohn's disease then the sample is classified as a Crohn's Disease sample. FIG. 5A depicts the protein spot ratios for this classifier that separate the data between the two phenotypes where yellow represents a vote for Crohn's Disease and blue represents a vote for healthy control. Using the k-TSP classifier, 36 out of 39 healthy control and 62 out of 64 Crohn's Disease samples are correctly classified, with an estimated ten-fold cross-validation accuracy of 864% (p<0.01). For distinguishing healthy control from ulcerative colitis samples, the k-TSP algorithm identifies eleven feature pairs (FIG. 5B) with an estimated ten-fold crossvalidation accuracy of 665% (p<0.04). A single feature pair of k-TSP classifier was identified for differentiating Chrohn's disease from ulcerative colitis: If the sample has greater immunogenic reactivity to frvX than to yidX then the subject is identified as having ulcerative colitis as illustrated in FIG. 5C (see representative examples of actual images of immuno-reactive protein spots in FIG. 5D). This classifier has an estimated ten-fold cross-validation accuracy of 802% (p<0.1).

(109) The performance of k-TSP was also compared with SVM and kNN, two other commonly used learning algorithms, for each of the classification problems based on five runs of ten-fold crossvalidation. Table 6 displays the results of ten-fold cross-validation for each of the three classifiers.

(110) TABLE-US-00012 TABLE 6 Estimated ten-fold cross-validation classification rates of IBD using the three described classification methods. The reported rates are given in percentages and are the mean performance on all five runs of ten-fold cross validation the standard deviation. In parenthesis are the numbers of samples in each subtype used for classification. Sp = specificity, Sn = sensitivity, PPV = positive predictive value, NPV = negative predictive value. Healthy control (HC) (39) vs CD (66) Accuracy PPV NPV Method (%) Sp (HC) (%) Sn (CD) (%) (CD) (%) (HC) (%) k-TSP 86 4 81 5 89 3 89 81 SVM 70 2 66 1 73 2 79 59 kNN 63 3 47 7 73 6 70 50 Healthy control (HC) (39) vs UC (29) Accuracy PPV NPV Method (%) Sp (HC) (%) Sn (UC) (%) (UC) (%) (HC) (%) k-TSP 6.6 5 69 5 61 7 59 70 SVM 62 5 58 1 68 12 55 71 kNN 60 6 57 2 64 12 53 68 CD (66) vs UC (29) Accuracy PPV NPV Method (%) Sp (CD) (%) Sn (UC) (%) (CD) (%) (UC) (%) k-TSP 80 2 84 1 70 6 86 66 SVM 78 3 82 2 69 9 86 63 kNN 78 3 78 4 61 2 82 55
As demonstrated in Table 6, based on cross-validation, k-TSP performance meets or exceeds the performance of kNN and SVM for these classification problems. Because the cross-validation structure allowed each classifier to test the same subsets of data as described in the methods section, the performance of the three classifiers can be directly compared and tested for statistical significance by a simple student's t-test. The healthy control vs. CD k-TSP classifier outperformed the other methods in total classification performance (p<0.001). For the remaining two classification problems, the k-TSP classifiers achieved nominally better, but not statistically significant in classification accuracy when compared to SVM and kNN classifiers. From this study, k-TSP was found to perform much better than SVM and kNN in separating healthy control from Crohn's Disease. In addition, the ordering of the expression values within profiles were utilized in the k-TSP decision rules, therefore, the classifier is invariant to data preprocessing (28). FIGS. 6A and 6B show that on their own, the immunogenic responses to era and ybaN (the top scoring pair in the healthy control vs CD k-TSP classifier) do not allow for class separation of the data; no threshold level would clearly separate healthy control from Crohn's Disease. However, the ratio of the two features (top-scoring pair ratio) results in clear separation in the data lending well to classification (FIG. 6C). Similar results are true when scatter plot analysis was done for the other two TSP pairs from the healthy control vs Crohn's Disease classifier (yhgN vs focA and gabT vs ycdG, respectively). This represents an advantage of k-TSP over other learning methods where interpreting the decision rules are easy and can facilitate follow-up study. It is important to note that SAM identified era as the second best individual marker for up regulation in CD, thus it appears that individual markers will not work well for classification and explains why KNN and SVM fail to match the performance of k-TSP as the relative feature levels within samples appear to be much more robust then the absolute feature levels across samples

Example 5: Robustness of the k-TSP Classifiers

(111) To determine that class imbalance did not greatly affect the classification results, an additional analysis was performed where samples were randomly discarded from a class with greater total number of samples in order to equalize the class sizes. 10-fold cross validation was performed as described. The process was then repeated by discarding a different random set of samples.

(112) Table 7 (below) shows the performance of each classifier given class balance in the training set.

(113) TABLE-US-00013 TABLE 7 Permutation statistics for each pair of biomarkers. Top scoring pairs used for each classifier and the percentage of surrogate classifiers in which those pairs appear during 10-fold cross validation (mean standard deviation, p-value). Accuracy (%) k-TSP 10-fold 10-fold CV Estimated Features in % feature Classifier CV Permutation p-value k-TSP classifier appearance HC vs. CD 86 3 50 8 p < 0.01 era > ybaN = CD 90 yhgN > focA = CD 84 gabT > ycdG = CD 64 HC vs. UC 66 5 51 9 p < 0.05 relE > cysE/WcaB = UC 80 pyrI > yigK = UC 42 lnt > yniO = UC 36 ftsE > pssR = UC 36 yhgN > yhfG = UC 20 yafN > dsbB = UC 20 yihI > yabK = UC 26 421#15 > yhdN = UC 24 hisP > rplO = UC 16 cml > nuoM = UC 14 yieC > nuoI = UC 12 UC vs. CD 80 2 52 6 p < 0.01 yidX > frvX = UC 88
These results demonstrate that k-TSP outperforms SVM and kNN in most instances whether or not the class size is balanced, further supporting the data presented in Table 5.

(114) Next, to determine the significance of each classifier, a permutation test was performed by randomly shuffling the class labels while maintaining the same number of samples in each class. 10-fold cross validation is carried out to yield a classification rate for the permutation set. 100 permutations were performed in order to get a null distribution of expected classification rates by chance. The classification rate from the un-permuted data is then compared to the null distribution to determine significance. Table 7 shows the permutation test results for all the classification problems. For the k-TSP classifiers trained to differentiate between healthy control and Crohn's Disease samples as well as Crohn's Disease and ulcerative colitis samples, no permuted set achieved classification rates equal or superior to the original data out of 100 permutations. Thus, these classifiers were estimated to be significant at the p<0.01 level. The k-TSP classifier built to differentiate healthy control and ulcerative colitis had 4/100 permutations achieve rates that matched or exceeded the original classifier, thus this classifier is near the typical significance threshold at p<0.05.

(115) Finally, to gauge the robustness of the classification rules discovered by the k-TSP method, the surrogate classifiers created during the ten-fold cross validation procedure were inspected. Every loop of cross validation creates a separate classifier used to predict the left out sample classes, these are called surrogate classifiers. Thus, for each problem of interest that was performed ten fold cross-validation in Table 7, there were 50 classifiers to inspect (10 for each of the 5 runs). The percentage of the time that the rule from the final k-TSP classifier showed up in the 50 surrogate classifiers was an indicator of the robustness of that rule. Table 7 shows that the pairs that show up in the healthy control vs. Crohn's Disease classifier as well as the ulcerative colitis vs. Crohn's Disease classifier are fairly robust while the pairs in the healthy control vs. ulcerative colitis classifier are not. Along with the permutation testing, this indicates that the healthy control vs. Crohn's Disease and ulcerative colitis vs. Crohn's Disease classifier should perform well in independent testing while the healthy control vs. ulcerative colitis classifier may not.

Example 6: Stratifying Crohn's Disease Subtypes and Risk for Surgery

(116) Certain antibody-based serological biomarkers (such as pANCA and ASCA) have shown promise in risk stratifying patients prior to instituting medical therapy or embarking on surgery. As an example, the presence of pANCA has been associated with the development of acute and chronic pouchitis after colectomy with ileal pouchanal anastamosis. Similarly, the presence of high titers of ASCA has been found to predict the occurrence of pouch complications and a more complicated disease course in Crohn's disease. To evaluate whether the new biomarkers identified can be used to stratify Crohn's Disease and ulcerative colitis subtypes or risk for surgery, the Vienna classification was used to subtype patients with Crohn's Disease into the following behavior subtypes (Table 1): penetrating/fistulizing, stricturing, penetrating/structuring and non-penetrating non-stricturing. Patients with ulcerative colitis were divided into those with left sided disease (inflammation extending no further than the splenic flexure). Pancolitis was considered to be continuous inflammation from the rectum extending beyond the splenic flexure. Due to the small sample sizes for each disease type, k-TSP analysis using the newly identified biomarkers was unable to stratify subtypes of Crohn's Disease or ulcerative colitis, or risk for surgery. When larger sample sizes are available, it is expected that at least those biomarkers listed herein will be useful for identifying subjects in need of surgery. In particular, pairs and sets of biomarkers delineated in Tables 2-5, 7, and FIG. 5 are useful alone or in combination with existing biomarkers to identify subjects that could benefit from surgery.

Example 7: OmpC and fliC, Two of the Known Serological Markers, Performed Poorly

(117) Although anti-OmpC and anti-Cbir (fliC) have been recently considered two new IBD serological biomarkers, these markers were not identified in our screening of the E. coli K12 proteome. Scatter plot (FIG. 7) analysis of E. coli ompC and fliC demonstrates that neither allows for class separation between control vs Crohn's Disease vs ulcerative colitis; no threshold level would clearly separate the data.

(118) Protein microarrays have been demonstrated to be a powerful tool to identify biomarkers. The results reported herein provide the first study to identify serological biomarkers in human autoimmune diseases using a protein chip of whole prokaryotic proteome. The significance of this study is three-fold: First, it presents here the first proof of principle for the feasibility of application of high density protein microarray/chip technology in the discovery of novel serological IBD biomarkers. This study can serve as an example of similar proteomic approaches for hunting serological biomarkers for other immune-related diseases, such as autoimmune disorders. Second, this is the first examination of human immune responses to the entire proteome of a microbial species under normal or any disease condition. It is surprising to learn that human circulating antibodies can recognize more than 400 E. coli proteins (FIG. 3D). Since it has been demonstrated that defective intestinal barrier function plays a central role in the pathogenesis of Crohn's Disease, it is conceivable that in patients with Crohn's Disease commensal bacteria or their products could more readily penetrate intestinal epithelia. Therefore, it is less surprising that 185 of the E. coli proteins were recognized by sera from Crohn's Disease patients (FIG. 3D). However, it remains a mystery why there are a large number (185) of immunogenic E coli proteins that are specific in healthy controls while only 18 immunogenic proteins are found to be specific to ulcerative colitis. Third, this study identified a set of novel serological biomarkers that have >80% overall accuracy and sensitivity in differentiating CD from healthy control or ulcerative colitis.

(119) An intriguing observation in this study is the difference in the immunogenicity of surface/membrane vs intracellular proteins in healthy control vs CD patients. Approximately 85% of the highly immunogenic proteins were either cell wall proteins or membrane proteins in healthy control, compared to only 37% of the top immunogenic proteins in Crohn's Disease patients (FIG. 4, FIG. 5 and Tables 2-5, and 7). Conversely, 30% of top immunogenic proteins in Crohn's Disease patients are intracellular proteins compared to only 7% in healthy control (FIG. 4, FIG. 5 and Tables 2-5, and 7). Furthermore, there is no overlap among the top immunogenic E. coli surface/membrane proteins among the three distinct populations (healthy control, Crohn's Disease and ulcerative colitis, see FIG. 3D). This suggests that the host immunological response to E. coli is drastically different between healthy control and CD patients. The mechanism of having these immunogenic differences is not clear at this moment. It is likely that in immunologically healthy hosts where E. coli are largely confined to the luminal side of the gut due to intestinal epithelial barrier, surface and membrane proteins of E. coli might be theprimary antigens that are more accessible to the immune system, compared to intracellular proteins. In this case, immune system has adapted to the presence of luminal E. coli. In contrast, in Crohn's Disease patients, a disrupted or compromised intestinal barrier may lead to the bacterium or its products crossing the gut luminal barrier. If the whole E. coli invades into the lamina propria, it will mostly likely be lysed by host immune system. Subsequently, E. coli components such as intracellular proteins that wpi;d otherwise not be seen by the intestinal immune system in the lamina propria are presented by antigen-presenting cells (such as macrophages or dendritic cells).

(120) This may dramatically alter the previously adapted immune system that is only used to the luminally exposed E. coli, resulting in an overwhelming production of antibodies against these intracellular E. coli proteins. The consequences of these immune responses include recruitment of various inflammatory immune cells such as neutrophils, dendritic cells, and lymphocytes to lamina propria or between colonic epithelial cells, leading to dysregulated mucosal inflammation. This may also explain why there are only 6 overlapping proteins among 354 top immunogenic proteins recognized by healthy control and Crohn's Disease patients (FIG. 3D).

(121) None of the serum antibody biomarkers that are identified here for discriminating Crohn's Disease from healthy control or ulcerative colitis have been previously described. Although most of the antigens (E. coli proteins) responsible for generation of these marker antibodies have not been well characterized, their identity and function can be predicted based on their sequence information. Among the proteins in the k-TSP classifierera, ybaN, yhgN, focA, gabT and ycdG (FIG. 5A)for discriminating CD from healthy control, era is a GTP binding protein that involves in the binding of GTP and nucleotide of cell cycle and can be found in intracellular membrane. In this study, an increased immunogenic response to era is associated with Crohn's Disease, identified by both SAM and k-TSP analyses. YbaN is predicted as a conserved inner membrane protein with unknown function. YhgN is predicted as an inner six transmembrane domains protein where the C-terminus is located in the periplasm (36). YcdG (also called rutG) is another predicted transmembrane with eleven helices; the C-terminus of the protein is located on the cytoplasmic side of the inner membrane (36). This protein is predicted to be involved in the pyrimidine utilization in E. coli where it may function as a proton-driven uracil uptake system (37). FocA, an inner membrane protein, is a putative formate transporter that may involve in both formate uptake and efflux. Disruption of the focA gene confers resistance to hypophosphite, a toxic formate analogue (38). GabT, 4-aminobutyrate aminotransferase, is a well characterized protein and acts as the initial enzyme of the 4-aminobutyrate (GABA) degradation pathway in E. coli (39). Among the pair of proteins (frvX and yidX) that were identified to be discriminatory between CD and ulcerative colitis, frvX is a important protein in fructose-specific PEP-dependent sugar phosphotransferase system (40); and yidX is a predicted lipoprotein, the function of which is currently unknown.

(122) Like all previously identified serological (antibody) biomarkers, including p-ANCA, ASCA, anti-OmpC, and anti-I2 and anti-Cbir, the pathological or functional consequences of having these newly identified circulating antibodies is unclear.

(123) The newly identified biomarkers by k-TSP analysis have a particular impressive 86% accuracy in differentiating CD from healthy control, with a specificity of 81% and a sensitivity of 89% (Table 6). In addition, k-TSP analysis yields an accuracy of 80% in differentiating CD and ulcerative colitis, with a sensitivity of 84% and specificity of 70% (Table 6). These demonstrate that the sensitivity and specificity of these novel serological markers are comparable to those of combination of the multiple best-characterized IBD biomarkers (ASCA, pANCA, anti-OmpC, and anti-Cbir) (41, 42). More importantly, an identical performance can be achieved by using only the top 3 pairs of E. coli proteins for discriminating healthy controls vs CD, and one top pair of proteins for differentiating CD vs ulcerative colitis (FIGS. 2 &5 and Tables 2 &3).

(124) These data provide a critical feasibility for 1) validation study using additional larger cohorts of IBD patients and controls and 2) future development of novel assay kits for diagnosis of CD and ulcerative colitis. However, it is necessary to point out that our current approach screening E. coli protein array is not suitable for identifying serological biomarkers in differentiating ulcerative colitis from healthy control (only 66% accuracy) (Tables 5 and 6). Importantly, OmpC, an E. coli antigen for one of the widely studied current serological biomarker (anti-OmpC), was not picked up in our screen (FIG. 7A). Similarly, fliC, an E. coli flagellin protein equivalent the Salmonella flagellin (which is the antigen for anti-Cbir, another widely studied anti-bacterial antibody) did not show up in our analysis (FIG. 7A). These data would suggest that anti-OmpC and at least the antibody against E. coli fliC are not robust serological biomarkers for IBD. In conclusion, we have presented here the first demonstration that using protein array to screen circulating disease-specific antibodies is a robust, effective and high throughput approach for discovery of novel biomarkers of IBD. This approach can be readily applied to screen serological biomarkers of various autoimmune diseases and/or even infectious diseases.

(125) The results reported above were obtained using the following methods and materials.

(126) Patients and Serum Acquisition.

(127) Serum was obtained from 134 subjects in accordance with the policy of the Johns Hopkins Hospital Institutional Review Board. Sixty six patients had the diagnosis of Crohn's disease (CD), 29 patients were diagnosed with ulcerative colitis (UC), and 39 subjects were non-IBD healthy controls (HC). The healthy controls and IBD patients were similar in age and sex distribution. The demographic and clinical characteristics of the patients are summarized in Table 1. Clinical information was abstracted from the written and electronic medical records. The diagnosis of CD and ulcerative colitis was established by standard clinical, radiographic, endoscopic and histological criteria. Patients were classified as having CD based on the typical findings of skip lesions, deep linear or serpiginous ulcerations, cobblestoning, multiple noncaseating granulomas, transmural inflammation, small bowel involvement, structuring disease or presence of fistulilizing disease. The diagnosis of ulcerative colitis was considered if the colonic inflammation involved the rectum with or without proximal extension. The inflammation had to be continuous and be limited to the mucosa. There were no patients with proctitis enrolled in this study. The healthy controls consisted of individual undergone colon cancer screening or other non-IBD GI diseases or any other immune diseases. The serum samples were obtained at the time of initial outpatient encounter, at the time of an endoscopy or during hospitalization. The blood was collected into a serum separator tube (Red top tube, BD Vacutainer) and spun down within 60 minutes of collection. Serum was removed, aliquoted, and stored in multiple at 80 C. until assayed.

(128) Fabrication of E. coli Proteome Chips.

(129) To facilitate the analysis of protein function in the bacterial proteomes, we have constructed a protein chip that essentially covers the entire proteome of the E. coli K 12 strain (Chen (2008) Nat. Methods 5, 69-74). Briefly, 4,256 E. coli proteins were first purified using an ORF collection kindly provided by Dr. Mori and colleagues (26). E. coli cells first were grown overnight at 37 C in 2LB media containing 30 g/ml chloramphenicol in a 96-well format and allowed to grow for overnight. The overnight cultures were diluted to a final OD600 of 0.1. After the cells were grown for 3 hrs at 37 C, and protein expression were induced with 1 mM isopropyl -D-thiogalactoside (IPTG) for 3.5 hrs. The liquid cultures were then harvested by centrifuge of 3500 rpm for 5 min at 4 C. The pellets were stored at 80 C. for future protein purification.

(130) To purify the fusion proteins, the frozen cell pellets were re-suspended in phosphate lysis buffer, containing 300 mM NaCl, 20 mM imidazole, CelLytic B, Lysozyme (1 mg/mL), Benzonase (50 units/ml), proteinase inhibitor cocktail, and PMSF (1 mM). Along with Ni-NTA beads, the mixtures were incubated for 1.5 h at 4 C. After mixing, the resin-protein complexes were washed 3 times with Wash buffer I (50 mM NaH2PO4 with 300 mM NaCl, 10% glycerol, 20 mM imidazole, 0.01% Triton X-100, at pH 8) and 3 times with Wash buffer II (50 mM NaH2PO4 with 150 mM NaCl, 25% glycerol, 20 mM imidazole, 0.01% Triton X-100, at pH 8). Finally, the fusion protein was eluted with elution buffer (50 mM NaH2PO4/150 mM NaCl/25% glycerol/250 mM imidazole/0.01% Triton X-100, pH 7.5). All purified proteins were printed in duplicate onto FullMoon slides using a ChipWriter Pro (Bio-Rad) in a humidity-controlled chamber in a cold room (25).

(131) Screen of E. coli Proteome Chip for Anti-E. coli Antibodies.

(132) The entire screening process, except for the washing steps as specified, was done at room temperature. E. coli protein chips stored at 80 C were thawed at room temperature (22 C) and blocked in Superblock Blocking Buffer (Pierce) for one hour. The patient's serum was diluted (1:1000) with blocking buffer in a total volume of 3 ml. The diluted serum was then applied to the chip entirely covering the surface. After 1 hour incubation with gentle shaking on a rocker, the chip was rinsed once with 4 ml of Tris-buffered saline (TBS) with 0.05% Tween 20 (TBS-T). The chip was then soaked in 4 ml TBS-T, placed in a water bath and washed for 10 min at 50 C with gentle horizontal agitation. This washing step was repeated twice. The chip was then cooled to room temperature. After removal of TBS-T, the chip was incubated for 1 h with the secondary antibody, a Cy3-labeled donkey anti-human IgA, G, and M (Jackson ImmunoLab) diluted at 1:400 in 3 mL Superblock Blocking Buffer. The chip was then washed at 50 C in the same fashion as previously stated. After the final wash, the chip was rinsed in sterile water briefly, and quickly spun at 2000 rpm until dry prior to scanning. The chips were scanned with a GenePix array scanner (GenePix Pro 6.0 or GenePix 4200AL, Molecular Devices, PA) at wavelength of 536 nm. To achieve the best signal-to-noise ratio, many washing conditions with different stringencies had been tested, including increase of salt (0.5 or 1 M NaCl), addition of SDS (0.05 or 0.1%), change of washing temperature (22, 37, 40, or 50 C), and/or various combination of conditions described above. The washing condition described here gave best results among all conditions tested.

(133) Protein Array Data Preprocessing.

(134) Each quantified sample array image was exported from Genepix (Molecular Devices, CA) as a text file for preprocessing. The goal of preprocessing is to yield a feature of interest from each protein spot in the array that minimizes technical variability and maximizes the signal of interest. The ratio of the mean signal over the mean background signal for each protein spot was determined to be the best method of preprocessing. This method has the advantage that all features are normalized to their background signals. Thus, if a protein spot signal is artificially high due to an artifact on the slide the ratio will account for it. Furthermore this preprocessing method also normalizes the features across all arrays, as the ratio is a standardized metric. The ratio represents the fold change of the signal above background and can be interpreted as the degree of host serum reactivity to each spotted protein.

(135) Univariate Significance Testing.

(136) Significance Analysis for Microarrays (SAM) (27) was used to determine proteins to which healthy control, CD, and ulcerative colitis groups of samples show a statistically significant immunogenic response. We used stringent criteria in the SAM analysis and only called a protein as significant with at least 1.5 fold change differences between two phenotypes at 0% False Discovery Rate in 500 permutations.

(137) Supervised Learning Algorithms.

(138) To construct the classifier in this study, we employed three supervised learning methods. The algorithms implemented were k-Nearest Neighbors (kNN) (27), Support Vector Machines (SVM), and the k-Top Scoring Pairs Algorithm (k-TSP) (28). The k-TSP was implemented using a publicly available executable program developed at the Institute for Computational Medicine of Johns Hopkins University (Tan (2005) Bioinformatics. 21, 3896-3904). SVM and kNN were implemented using the R statistical programming language, packages: e1071 and class for SVM and kNN, respectively.

(139) Feature Selection.

(140) For kNN and SVM learning methods, SAM was applied to the training set for feature selection before the classifiers were trained on that data. The features selected in SAM were those that were found to be significant with a false discovery rate of zero. The k-TSP algorithm does not require feature reduction as it intrinsically selects the top scoring features. Parameters such as the number of nearest neighbors for kNN and the number of top scoring pairs for k-TSP were selected based on leave one out cross-validation performance on the training set. A script was written in Matlab to perform the cross-validation scheme and call executables for the learning algorithms.

(141) Statistical Analyses.

(142) We used the open source statistical software R to perform the statistical analyses in this study. P-value<0.05 was regarded as significant.

Other Embodiments

(143) From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.

(144) The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or subcombination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.

(145) All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.