PI3Kγ inhibitor peptide for treatment of respiratory system diseases
10730921 · 2020-08-04
Assignee
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
C07K2319/10
CHEMISTRY; METALLURGY
International classification
C07K5/00
CHEMISTRY; METALLURGY
C07K7/00
CHEMISTRY; METALLURGY
C07K14/00
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
C07K17/00
CHEMISTRY; METALLURGY
A61K38/04
HUMAN NECESSITIES
C07K4/00
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
Abstract
Fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1 and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of PI3K, and ii) a peptide having the ability to penetrate a cell.
Claims
1. A method for treating respiratory diseases comprising administering to a patient in need thereof (a) at least one fusion peptide and (b) at least one potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) and/or at least one corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) in an amount sufficient to carry out said treatment, wherein the fusion peptide comprises: i) the amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ I D No.: I and having the ability of the sequence SEQ ID No.: I to inhibit the kinase-independent function of PI3K, and ii) a peptide having the ability to penetrate a cell.
2. The method for treating respiratory diseases according to claim 1, wherein the peptide having the ability to penetrate a cell is selected from the sequences specified in SEQ ID No.: 3 to 12.
3. The method for treating respiratory diseases according to claim 1, wherein the peptide having the ability to penetrate a cell is conjugated to C-terminus or N-terminus of SEQ ID No.: 1 or its homologs.
4. The method for treating respiratory diseases according to claim 1, wherein the potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) is selected from VX-770 (N-(2,4-Di-tert-butyl-5-hydroxyphenyl)-1, 4-dihydro-4-ossoquinolin-3-carboxamide) and VX-532 (4-Methyl-2-(5-phenyl-1H-pyrazol-3-yl)phenol).
5. The method for treating respiratory diseases according to claim 1, wherein the corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) is selected from VX-809 (3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid) and VX-661 ((R)-1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide).
6. The method according to claim 1, wherein the respiratory disease is a bronco-obstructive disease.
7. The method according to claim 6, wherein the respiratory disease is allergic asthma, cystic fibrosis, or chronic obstructive pulmonary disease.
8. The method according to claim 1, wherein the fusion peptide is in a form suitable for administration by inhalation.
9. The method according to claim 1, wherein the fusion peptide and the potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) are administered sequentially, simultaneously or separately.
10. The method according to claim 1, wherein the fusion peptide and the corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) are administered sequentially, simultaneously or separately.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The invention will now be described in detail, purely by way of illustrative and non-limiting example, with reference to the attached figures, wherein:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DETAILED DESCRIPTION OF THE INVENTION
(9) The invention will now be described in detail, purely by way of illustrative and non-limiting example, with reference to the single drawing in which an extraction system under pressure usable for the purposes of implementing the method described herein is schematically represented.
(10) In the following description, numerous specific details are presented to provide a thorough understanding of the embodiments. The embodiments may be implemented in practice without one or more of the specific details, or with other methods, components, materials, etc. In other cases, well-known structures, materials, or operations are not shown or described in detail to avoid obscuring certain aspects of the embodiments.
(11) Throughout the present specification, the reference to one embodiment or embodiment means that a specific feature, structure, or characteristic described in connection with the embodiment is included in at least one embodiment. Therefore, the appearance of expressions in a certain embodiment or in an embodiment in various sites throughout the present specification does not necessarily always refer to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments.
(12) The titles used here serve merely for convenience and do not interpret the object or meaning of the embodiments.
(13) One embodiment of the present description relates to a fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1, and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of PI3K, and
(14) ii) a peptide having the ability to penetrate a cell, for use as a medicament, in particular for treating respiratory diseases.
(15) A different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR), as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis.
(16) The use of a product comprising a fusion peptide as defined above, a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) and a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) as a combined preparation for sequential, simultaneous or separate use is particularly suitable for treating patients with cystic fibrosis who carry the AF508 mutation of CFTR.
(17) The present description concerns the production and the therapeutic applications of a fusion peptide permeable to cell membranes, which inhibits the interaction between PI3K and the activator of PDE, PKA. The fusion peptide of the present description reduces the activity of specific PDE, enhancing the signaling of the .sub.2-AR/cAMP signal transduction pathway and producing cAMP-mediated pro-relaxing effects, both in smooth muscle cells of human airways and in vivo, in a preclinical model of allergic asthma. Furthermore, the fusion peptide with PI3K inhibitory activity enhances the same signaling pathway in epithelial cells of the respiratory tract and stimulates the cAMP-dependent opening of the wild type CFTR channel (whose nucleotide and amino acid sequences are available in the GenBank sequence database as access numbers NM_000492.3 and NP_000483.3, respectively) and of CFTR with the F508 mutation (the sequence of this mutation is available in the GenBank sequence database as access number S64640.1), which is the main cause of cystic fibrosis.
(18) Overall, the results shown here demonstrate the possibility of using the fusion peptide or homologs thereof, having the ability to inhibit PI3K, as a local therapy by inhalation, for treating respiratory diseases such as allergic asthma and cystic fibrosis.
(19) Although in the last decade numerous inhibitors of the kinase activity of PI3K have been developed, many of which are currently in clinical development for treating neoplastic diseases, there are no methods that allow selective interference with the kinase-independent activity, or rather with the PKA- or AKAP-anchoring protein, of the enzyme.
(20) It has been previously shown that a peptide which comprises the binding site of PI3K to PKA, consisting of residues 126-150 of human PI3K, displaces the interaction between the two proteins and reduces the activity of the PI3K-bound PDE, PDE3B, in in vitro interaction studies (1).
(21) The present description shows, in a completely unexpected way, that the PI3K 126-150 peptide (SEQ ID No.: 1-KATHRSPGQIHLVQRHPPSEESQAF) conjugated to a peptide permeable to cell membranes, such as, for example, the Penetratin 1 of Antennapedia (SEQ ID No.: 3) (3), can be used as an inhibitor of the kinase-independent function of PI3K in vivo. The PI3K inhibitory fusion peptide penetrates smooth muscle cells of the airways and enhances the .sub.2-AR/cAMP signaling pathway. In particular, the data show that the fusion peptide increases cAMP levels and limits airway hyperresponsiveness in a preclinical model of allergic asthma and that it efficiently reaches the lower respiratory tract when administered locally by the intra-tracheal route. These data therefore demonstrate the clinical use of a PI3K inhibitory fusion peptide in aerosol therapy for treating respiratory diseases.
(22) The current inhalation therapy for bronco-obstructive diseases is based on the use of .sub.2-AR agonists such as salbutamol and formoterol and of PDE4 inhibitors, such as Roflumilast, which was recently approved for treating chronic obstructive pulmonary disease (COPD).
(23) Although acute treatment with -AR agonists produces evident clinical benefits, chronic or repeated exposure to these drugs may result in a significant reduction and/or complete loss of their effectiveness in asthmatic patients, due to the agonist-dependent desensitization of membrane -ARs.
(24) The present description provides a solution to this problem and proposes the use of an inhibitory peptide that affects the activity of the enzyme PI3K and, as such, does not act directly on the stimulation of .sub.2-AR, but enhances the cascade of downstream signaling events. In this way, a PI3K inhibitory peptide offers the unique opportunity to modulate .sub.2-AR-dependent cAMP domains, ensuring broncho-relaxing effects similar to those mediated by .sub.2-AR agonists, without inducing receptor inactivation.
(25) The data provided herein demonstrate that inhibiting the PKA-anchoring function of PI3K only reduces the PDE activity in cells expressing PI3K (PI3K.sup.+/+), but not in cells lacking the enzyme (PI3K.sup./), thus indicating that the fusion peptide of the present description inhibits the PDEs exclusively regulated by PI3K.
(26) The PI3K inhibitory peptide therefore represents a unique tool that ensures isoform-selective inhibition of PDEs and allows limiting the major side effects that are associated with non-selective inhibitors of PDE4, such as Roflumilast, arising mainly from inhibition of isoforms that are not expressed in the respiratory system.
(27) Although PDE4 inhibitors are characterized by important pro-relaxant effects in isolated cells, they are not optimal bronchodilators in vivo, where they mainly exert anti-inflammatory functions.
(28) The results provided herein demonstrate that the fusion peptide with the ability to inhibit the kinase-independent function of PI3K, subject of the present description, has a strong bronchodilator function in vivo, in healthy animals and in a pre-clinical model of allergic asthma. These effects can be explained by the ability of the peptide to interfere with the catalytic activity of multiple PDE isoforms, not only including PDE4, but also PDE3.
(29) In agreement with the present data, it has been shown that inhibiting PDE3 and PDE4 can be additive or synergistic. In particular, PDE4 and PDE3 inhibitors are ineffective if used alone, but act synergistically in inhibiting smooth muscle contraction. Therefore, inhibiting the kinase-independent activity of PI3K provides a unique tool to simultaneously inhibit specific isoforms of PDE3 and PDE4, in particular those critically involved in regulating the contractility of the bronchial smooth muscle.
(30) Since PDE3 and PDE4 are not only expressed in the airways, but also in the myocardium and the central nervous system, systemic inhibition of even selected isoenzymes can cause major side effects. In particular, the inhibition of PDE3 and PDE4 in vivo may have pro-arrhythmogenic, pro-emetic and pro-anorexigenic effects.
(31) The present description shows that the fusion peptide having the ability to inhibit the kinase-independent activity of PI3K is therapeutically effective, and that an aerosol formulation of the PI3K inhibitory peptide is distributed efficiently in the lower respiratory tract. Furthermore, the use of a peptide molecule provides a broader therapeutic effect/side effect profile compared to small molecules, such as PDE inhibitors, which can diffuse rapidly to other tissues outside of the respiratory system.
(32) The data provided herein demonstrate that a fluorescent version of the PI3K inhibitory peptide accumulates in the trachea and lungs following intra-tracheal administration, without reaching the myocardium and the brain.
(33) On the basis of these data, it is therefore possible to conclude that an inhalation therapy based on a peptide, permeable to cell membranes, which selectively inhibits the kinase-independent activity of the PI3K enzyme, is highly effective. This therapeutic approach can be used for treating different respiratory diseases, from asthma to cystic fibrosis, where agents able to increase intracellular cAMP downstream of .sub.2-ARs are necessary.
(34) The results presented here demonstrate that the PI3K inhibitory peptide not only increases cAMP levels in smooth muscle, but also in the epithelial compartment of the airways, thus opening up the possibility of exploiting this compound to also stimulate the cAMP-mediated opening of the CFTR channel, which is defective in patients with cystic fibrosis.
(35) The data provided here also show that inhibition of PI3K acts synergistically with a known, clinically advanced, CFTR potentiator, VX-770, by increasing the conductance of one of the most common mutated forms of CFTR in cystic fibrosis. These data demonstrate, for the first time, the ability of a PI3K-inhibiting molecule to increase the activity of a known CFTR potentiator, VX-770, which is known to stimulate the conductance of different mutant forms of CFTR, with the exception of the most common mutant in cystic fibrosis, F508.
(36) The fusion peptide of the present description may therefore be used in combination with a potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR), as a combined preparation for the sequential, simultaneous or separate use in treating respiratory diseases characterized by a defective cAMP-mediated opening of CFTR, such as in patients with cystic fibrosis.
(37) The combined use of a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR), and a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR), together with the fusion peptide of the present description, is particularly suitable for treating cystic fibrosis patients carrying the F508 CFTR mutation, to whom administration of a CFTR corrector is necessary to allow the expression of mutant CFTR at the membrane.
(38) Potentiators of the cystic fibrosis transmembrane conductance regulator (CFTR), which can be advantageously used in combination with the fusion peptide of the present description are, for example: Ivacaftor or VX-770 (N-(2,4-Di-tert-butyl-5-hydroxyphenyl)-1,4-dihydro-4-ossoquinoline-3-carboxamide) and VX-532 (4-Methyl-2-(5-phenyl-1H-pyrazol-3-yl)-phenol).
(39) Correctors of the cystic fibrosis transmembrane conductance regulator (CFTR), which can be advantageously used in combination with the fusion peptide of the present description and with a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) are for example: VX-809 (3-(6-(1-(2,2-difluorobenzo[d][1,3]dioxol-5yl)cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid) and VX-661 ((R)-1-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide).
(40) Overall, this study demonstrates the therapeutic potential of a fusion peptide that selectively inhibits the kinase-independent activity of PI3K.
(41) The molecule can be used for treating respiratory diseases, including allergic asthma, where drugs designed to increase intracellular levels of cAMP and to promote relaxation of bronchial smooth muscle are highly desirable.
(42) In addition, this compound can be applied to patients with cystic fibrosis where agents that elevate cAMP concentrations are key tools to stimulate cAMP-mediated opening of defective CFTR.
(43) Furthermore, peptide-mediated inhibition of PI3K can be applied to all pathological conditions characterized by a hypo-functional CFTR, including COPD, where the exposure to cigarette smoke has been demonstrated to alter the activity of CFTR.
(44) Finally, through the functional block of PDE4, the fusion peptide of the present description having the ability to inhibit PI3K is capable of exerting important anti-inflammatory actions. The experimental evidence reported here demonstrates that the peptide indeed limits the peribronchial inflammation associated with allergic asthma. It is therefore evident that inhibiting the kinase-independent activity of PI3K can provide multiple independent therapeutic benefits in treating respiratory diseases, acting at the same time as a bronchodilator, CFTR potentiator and anti-inflammatory agent.
(45) Below, the invention will be described in detail, by way of non-limiting example, with reference to a fusion peptide having the sequence shown in SEQ ID NO.: 2 (hereinafter also referred to as Trojan peptide derived from PI3K), comprising the amino acid sequence SEQ ID No.: 1 and a peptide penetrating the cell corresponding to the Penetratin 1 of Antennapedia (SEQ ID No.: 3, described in (3)).
(46) It is clear that the scope of this description is not in any way limited to the specific sequence of the fusion peptide of SEQ ID No.: 2, since the fusion peptide of the present description can comprise i) sequences having a homology with SEQ ID No.: 1 of at least 90% and having the ability of SEQ ID No.: 1 to inhibit the kinase-independent function of PI3K and ii) sequences of a peptide penetrating the cell, for example, selected from the polypeptide HIV-TAT, Antennapedia homeodomain peptides, also known as penetrating peptides or pAntp, R7 peptide, KALA peptide, buforin 2, MAP, transportan, transportan 10, pVEC, or MPG peptide. The sequences corresponding to the polypeptides penetrating the cells mentioned above are shown in
(47) Moreover, in producing the Trojan peptide derived from PI3K, the peptide having the ability to penetrate the cell was fused to the N-terminus of SEQ ID No.: 1. It is, however, possible to produce a fusion peptide that falls within the scope of the present description by creating a fusion of the peptide having the ability to penetrate the cell at the C-terminus of the SEQ ID No.: 1.
(48) Materials and Methods
(49) Determining the ability of a peptide homologous to SEQ ID No.: 1 to inhibit the kinase-independent function of PI3K
(50) To determine the ability of a homolog peptide, having at least 90% identity with SEQ ID No.: 1, to inhibit the function of AKAP of PI3K, a previously-described competition assay was used (1). The homolog peptide was re-suspended in phosphate-buffered saline solution (PBS) to a final concentration of 50 M or 250 M. HEK293 cells (ATCC Number: CRL-1573) were transfected, using the calcium phosphate method, with a construct made of the expression vector pcDNA3.1 (Life Technologies, Carlsbad, Calif., USA; product code V790-20), in which human PI3K cDNA was cloned (SEQ ID No.: 13) using the restriction enzymes BamHI and XbaI (New England Biolabs, Ipswich, Mass., USA). The pcDNA3.1-PI3K construct is freely available from Dr. Emilio Hirsch at the University of Turin, Turin, ITALY.
(51) At 48 hours following transfection, cells were lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, Ind.) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate). After 30 min of incubation on ice, lysates were centrifuged at 13000 rpm for 10 min at 4 C. and the supernatant was incubated with the peptide for 30 minutes at room temperature. After incubation, the regulatory subunit of PKA (PKA RII) was immunoprecipitated by incubating the protein extract with 30 L of a 1:1 mixture of Protein A and Sepharose (Amersham Biosciences, Buckinghamshire, UK) and an anti-PKA RII C20 antibody (Santa Cruz Biotechnology Inc., Dallas, Tex., USA; product code: sc-908) for 2 h at 4 C., with shaking. Immune complexes were washed extensively with lysis buffer and the association of PI3K with PKA RII was analyzed by Western blot analysis using a monoclonal anti-PI3K antibody (freely available from Dr. Emilio Hirsch at the University of Turin, Turin, Italy).
(52) Animals
(53) Knock-out mice for PI3K (PI3K.sup./) and knock-in mice expressing a catalytically-inactive form of PI3K (PI3K.sup.KD/KD) were generated as previously described (4, 5). Mutant mice were crossed with animals of a C57B1/6J genetic background for 15 generations and C57B1/6J mice were used as controls (PI3K.sup.+/+). For studies of airway hyperresponsiveness in asthmatic and healthy mice, BALB/C female mice were used. For all experiments, animals between the ages of 8 and 12 weeks were used. Mice were maintained in groups, with free access to food (standard diet) and water, in a controlled system which provides a cycle of 12 hours of light and 12 hours of darkness. Animals were used according to the guidelines and institutional regulations on animal welfare, approved by the local Animal Ethics Committee.
(54) Cell Culture and Transfection
(55) Human bronchial smooth muscle cells (hBSMCs) were purchased from Lonza (CC-2576, Lonza Walkersville, Inc. USA), grown in Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, Calif.), and supplemented with 10% fetal bovine serum (FBS) and 5 mM penicillin/streptomycin (Gibco, Carlsbad, Calif.). Cells up to passage 15 were used for experiments.
(56) Human bronchial smooth muscle cells (hBSMCs) were transfected with a plasmid encoding the FRET probe for cAMP, ICUE3 (described in the U.S. Pat. No. 8,236,523 B2) (2), by electroporation with a Nucleofector device (AMAXA, Gaithersburg, Md.), according to the manufacturer's protocol. Briefly, 110.sup.6 cells were re-suspended in 100 L of nucleofection solution (VPI-1004, AMAXA, Gaithersburg, Md.), mixed with 1 g of pcDNA3-ICUE3 (described in U.S. Pat. No. 8,236,523 B2), and subjected to electroporation in a nucleofection apparatus of Amaxa Biosystems (Program A-033). Live cell imaging experiments were performed at 24 hours after transfection.
(57) Human airway epithelial cell lines expressing a wild-type CFTR (NuLi-1) or with the F508 mutation (CuFi-1) were purchased from ATCC (NuLi-1 product code: ATCC CRL-4011; CuFi-1 product code: ATCC CRL-4013). Cells were cultured in Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, Calif.) supplemented with 10% fetal bovine serum (FBS), 30 g/mL of penicillin, 100 g/mL of streptomycin and 300 g/mL hygromycin B (Gibco, Carlsbad, Calif.).
(58) Protein Extraction and Immunoprecipitation
(59) For protein extraction from murine tracheal smooth muscle cells (mTSMCs) and human bronchial smooth muscle cells (hBSMCs), cells were treated with the indicated drugs/peptides and immediately lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, Ind.) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate). After 30 min of incubation on ice, lysates were centrifuged at 13000 rpm for 10 mm at 4 C. and used for either Western blotting or subjected to immunoprecipitation and measurements of phosphodiesterase activity.
(60) For immunoprecipitation assays, protein extracts were pre-incubated with 30 L of a 1:1 mixture of protein A or G and sepharose (Amersham Biosciences, Buckinghamshire, UK) and subsequently incubated with 20 L of a 1:1 mixture of protein A or G and sepharose and 1 mg of primary antibody for each mg of protein, for 2 hours at 4 C. Immune complexes were washed extensively with lysis buffer and used for Western blotting or subjected to measurements of phosphodiesterase activity.
(61) FRET Imaging and Analysis
(62) Measurements of cAMP levels were performed on human bronchial smooth muscle cells (hBSMCs) that express the FRET probe ICUE3, as described previously (2). Briefly, cells were maintained in a K.sup.4-Ringer solution containing (in mmol/L) 121.6 NaCl, 5.4 KCl, 1.8 MgCl.sub.2, 1.8 CaCl.sub.2/4 NaHCO.sub.3, 0.8 NaH.sub.2PO.sub.4, 5 D-glucose, 5 sodium pyruvate, 10 HEPES, at pH 7.4. FRET recordings were carried out before and after adding 100 nmol/L of isoproterenol (Iso) and 100 nmol/L of CGP-20712A (CGP), using a SP5 Leica TCS system (Leica Microsystems Inc., Buffalo Grove, Ill., USA) with an argon laser and with a 63 immersion lens. To excite CFP and YFP, 458 and 514 nm wavelengths were used, respectively. Images were acquired every 4 seconds without any media line, at a scanning speed of 400 MHz and a resolution of 512512 pixels. FRET efficiency was calculated using the Method 3 provided by the Leica wizard application for FRET imaging and sensitized emission, according to which: E.sub.A(i)=B/A, where E.sub.A(i) is the apparent FRET efficiency; A and B are the intensities of the CFP channel and FRET, respectively. For imaging in hBSMCs treated with peptides, cells expressing the FRET indicator ICUE3 were pre-incubated with 50 M of the Trojan peptide derived from PI3K (SEQ ID No.: 2-RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF) or the P1 control peptide (SEQ ID No.: 3-RQIKIWFQNRRMKWKK) for 30 minutes prior to treatment with Iso and CGP.
(63) Phosphodiesterase Activity Assay
(64) Phosphodiesterase activity in immunoprecipitates was measured according to the two-step method of Thompson and Appleman, as previously described (2), with minor modifications. Briefly, immunoprecipitates were assayed in a total volume of 200 L of reaction mixture containing 40 mmol/L Tris-HCl (pH 8.0), 1 mmol/L MgCl.sub.2, 1.4 mmol/L 2-mercapto-ethanol and 0.1 pCi of [.sup.3H] cAMP (Amersham Bioscience, Buckinghamshire, UK) for 40 min at 33 C. To stop the reaction, samples were boiled at 95 C. for 3 min. The reaction product 5-AMP was then hydrolyzed by incubation of the mixture with 50 g of snake venom from Crotalus Atrox for 15 min at 37 C. (Sigma-Aldrich, St. Louis, Mo.). The resulting adenosine was separated by anion exchange chromatography with 400 L of a suspension of Dowex resin AG1-X8 (Bio-Rad, Segrate, Milan, Italy), water and 100% ethanol in equal parts. The amount of radiolabeled adenosine in the supernatant was quantified by scintillation counting (Ultima Gold liquid scintillation from Perkin Elmer, Waltham, Mass.).
(65) Isolation of Mouse Tracheal Smooth Muscle Cells
(66) Murine tracheal smooth muscle cells were cultured from explants of trachea using previously described methods with modifications. The entire trachea between the larynx and bronchi was removed and placed in a sterile Petri dish containing Hanks's balanced salt solution at room temperature and a 2 concentration of antibiotic-antimycotic (Gibco, Carlsbad, Calif., product code: 15240-062). Using a dissecting microscope, the additional surrounding tissue was removed, the tracheal segment was divided longitudinally and cut into squares of 2-3 mm in size. All the segments of a single trachea were then placed with the inner face towards the bottom of a 60 mm sterile cell culture plate. After adherence of the explants to the plate, 2.5 ml of Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, Calif.), supplemented with 20% fetal bovine serum was added to cover the explants. Explants were incubated at 37 C. in a humidified atmosphere with 95% air and 5% CO.sub.2. Three days after plating, the concentrations of FBS and antibiotic-antimycotic were reduced to 10% and 1, respectively. Tracheal segments were removed when cells became locally confluent. Once the 60 mm plate became confluent, cells were detached by trypsinization and transferred to a single 60 mm plate. Tracheal smooth muscle cells were further subdivided for several passages in a 1:2 ratio. More than 90% of these cells were smooth muscle cells, as determined by immunofluorescence performed with an antibody specific for smooth muscle actin. All experiments were performed on confluent cells at passage 3.
(67) Measurements of Calcium Transients
(68) hBSMCs were loaded with the calcium indicator Indo-1-AM (2 M, Invitrogen, Carlsbad, Calif.) at 37 C. for 40 minutes in the presence of P1 control peptide, Trojan peptide derived from PI3K or vehicle. Cells were washed with a Tyrode solution containing (in mmol/L): 5 HEPES, 154 NaCl, 4 KCl, 2 CaCl.sub.2, 1 MgCl.sub.2, 5.5 D-glucose, at pH 7.35 and placed on an inverted microscope. Cells were kept in Tyrode solution and treated with a KCl depolarizing solution containing (in mmol/L): 5 HEPES, 118 NaCl, 40 KCl, 2 CaCl.sub.2, 1 MgCl.sub.2, 5.5 D-glucose, at pH 7.35. Calcium transients were analyzed as the ratio of fluorescence signals measured at 400 nm and 490 nm following excitation of Indo-1-AM-loaded cells at 350 nm. Experiments were recorded and analyzed with Igor Software, using the functions added by Jason Rothman (Neuromatic, www.thinkrandom.com).
(69) Measurements of Chloride Currents in the Ussing Chamber
(70) To measure chloride currents in normal and F508 primary human bronchial epithelial cells, cells were cultured on 1.12 cm.sup.2 Snapwell inserts. Filters were mounted in Ussing chambers, and a chloride gradient was applied by incubating the cells in a basolateral high-chloride buffer containing (in mmol/L): 140 NaCl, 5 KCl, 0.36 K.sub.2HPO.sub.4, 0.44 KH.sub.2PO.sub.4, 1.3 CaCl.sub.2, 0.5 MgCl.sub.2, 4.2 NaHCO.sub.3, 10 HEPES, and 10 glucose, at pH 7.4 and an apical low-chloride buffer containing (in mmol/L): 133.3 Na-gluconate, 5 K-gluconate, 2.5 NaCl, 0.36 K.sub.2HPO.sub.4, 0.44 KH.sub.2PO.sub.4, 5.7 CaCl.sub.2, 0.5 MgCl.sub.2, 4.2 NaHCO.sub.3, 10 HEPES, and 10 mannitol, at pH 7.4. Buffers were aerated with a mixture of 95% O.sub.2 and 5% CO.sub.2 and the temperature was maintained at 37 C. during the experiment. Cultures were maintained at a voltage of 0 mV using an EVC4000 Multichannel V/I Clamp (World Precision Instruments, Sarasota, Fla., USA). After a stabilization period of 30 minutes, drugs were added at specific times, while the current was continuously recorded.
(71) cAMP Extraction and Quantification
(72) Lungs and trachea were explanted from animals following euthanasia, pulverized in liquid nitrogen and used for cold extraction of cAMP with 6% trichloroacetic acid. Samples were sonicated for 10 seconds and centrifuged at 13000 rpm at 4 C. for 15 minutes. Supernatants were washed four times with five volumes of diethyl ether saturated with water and lyophilized. cAMP content was detected with an Amersham cAMP BioTrak Enzymeimmunoassay System (GE Healthcare Life Sciences, Pittsburgh, USA, product code: RPN225), according to the manufacturer's protocol.
(73) Analysis of the Transduction Efficiency of the Trojan Peptide Derived from PI3K In Vivo
(74) hBSMCs were incubated with the Trojan peptide derived from PI3K (SEQ ID No.: 2) conjugated to fluorescein (50 M) or vehicle for 30 minutes, fixed with 4% paraformaldehyde (PFA) for 10 minutes and permeabilized with phosphate-buffered saline (PBS)+0.5% Triton (Sigma-Aldrich, St. Louis, Mo.) for 5 minutes at room temperature. Cells were then incubated with PBS containing 3% bovine serum albumin (BSA, Sigma-Aldrich, St. Louis, Mo.) and phalloidin-Alexa 488 (1:1000, Thermo Fisher Scientific, Waltham, Mass., USA) for 30 minutes and mounted on microscope slides with ProLong Antifade Reagent (Thermo Fisher Scientific, Waltham, Mass., USA). Red (actin) and FITC (peptide) fluorescence images were acquired with a Zeiss Observer-Z1, equipped with an Apotome module (Carl Zeiss, Oberkochen, Germany).
(75) Wild-type BALB/C mice were injected by the intra-tracheal route with 1.5 g of the Trojan peptide derived from PI3K conjugated to fluorescein or vehicle, in a final volume of 70 L of PBS. After 30 minutes, animals were anesthetized, the trachea and lungs were insufflated with PBS, extracted and frozen in OCT. Cryosections of 10 microns were obtained with a Leica CM1850 cryostat (Leica Microsystems GmbH/Wetzlar, Germany) and fluorescence was acquired with a Zeiss Observer-Z1, equipped with an Apotome module (Carl Zeiss, Oberkochen, Germany).
(76) Immunization with Ovalbumin
(77) Ovalbumin (100 g) (OVA, Sigma-Aldrich, St. Louis, Mo.), complexed with aluminum potassium sulfate (1 mg, alum) was administered intraperitoneally (i.p.) on days 1 and 14, and intra-nasally (i.n.) (50 g OVA in 50 l PBS) on days 14, 25, 26, and 27. Control mice received i.p. injections of alum and i.n. injections of PBS only Airway hyperreactivity induced by inhaled methacholine was measured at 24 hours after the final dose of OVA (Day 28).
(78) Measurement of Airway Reactivity
(79) Method 1. Mice sensitized to ovalbumin were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotoraized, and connected to a FlexiVent ventilator for small animals (SCIREQ, Montreal, Quebec, Canada). To induce airway constriction, mice were exposed to increasing concentrations of aerosolized methacholine (10.sup.9 to 10.sup.4 M, final concentration).
(80) Method 2: Mice sensitized to ovalbumin were treated, by intra-tracheal instillation, with 70 L of phosphate-buffered saline solution (PBS) containing vehicle or 150 g of the Trojan peptide derived from PI3K or equimolar amounts of PI control peptide. Airway hyperresponsiveness was assessed at 30 minutes after the treatment according to a previously published protocol (6). Briefly, mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and ventilated with a positive end-inspiratory pressure of 10 cm H.sub.2O, positive end-expiratory pressure (PEEP) of 3 cm H.sub.2O, respiratory rate of 90 breaths/min in ambient air. The airway opening pressure (Pao), proximal to the endotracheal tube, and the pressure inside the chamber were measured with pressure transducers (Special Instruments, Digima Clic; Nordlingen, Germany). Gas flow was measured with a pneumotachograph (Special Instruments, Digima Clic; Nordlingen, Germany). Tidal volume was calculated as the integral of the flow signal. Variables of mechanical ventilation were recorded using the ICU-Lab software (KleisTEK Advanced Electronic Systems, Bari, Italy). Airway hyperreactivity was assessed as a change in tidal volume after treatment with 500 mg/kg of methacholine administered intravenously.
(81) Analysis of Airway Inflammation in Asthmatic Mice
(82) Wild-type BALB/C mice were treated, by intra-tracheal instillation, with 25 g of the Trojan peptide derived from PI3K or equimolar amounts of PI control peptide, in a final volume of 70 L of phosphate-buffered saline (PBS), before each intranasal administration of ovalbumin (days 14, 25, 26, and 27 of the protocol of immunization with ovalbumin). At 24 hours after the final injection (day 28), mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.) and the tracheas incised and cannulated. The airways were washed with 2.5 ml of phosphate-buffered saline solution (PBS). The total number of cells in the bronchoalveolar lavage (BAL) was determined with a Neubauer hemocytometer. A volume of 50 L of BAL was centrifuged onto cytospin glass slides at 400 rpm at room temperature for 5 minutes and stained with a Diff-Quick system (LabAids, Ronkonkoma, USA). A total of 100 cells per slide were counted and classified as neutrophils, macrophages, lymphocytes and eosinophils on the basis of morphological criteria. Erythrocytes and epithelial cells were ignored and the results were expressed as cells/ml.
(83) To assess the peribronchial inflammation, the lungs of a group of animals that had not been subjected to bronchoalveolar lavage were explanted, fixed in a solution of 4% paraformaldehyde (PFA) for 24 hours at 4 C. and embedded in paraffin. Slices that were 5 m-thick, deparaffinized, stained with a hematoxylin-eosin solution (Bio-Optica, Milano, Italy), dehydrated and mounted with glass coverslips. The extent of peribronchial inflammation was classified as follows: 0normal; 1few inflammatory cells; 3a thick ring of inflammatory cells.
(84) To evaluate the presence of goblet cells, lung slices were stained with periodic acid-Schiff's reagent (PAS) (Bio-Optica, Milano, Italy) and the percentage of PAS-positive cells was calculated by counting the number of PAS-positive epithelial cells and total epithelial cells.
(85) Antibodies, Reagents and Plasmids
(86) PDE4B and PDE4D were immunoprecipitated as described previously (2), using polyclonal rabbit antibodies freely available from Dr. Marco Conti at the University of California San Francisco, San Francisco, Calif., USA. Commercial antibodies specific for PDE4B and PDE4D can be purchased from Abeam (Abeam, Cambridge, Ma., USA): anti-PDE4B product code: ab14611; anti-PDE4D product code: ab14614. Rabbit polyclonal antibodies against Ca.sub.v1.2 and phospho-Ca.sub.v1.2 are freely available from Dr. William A. Catterall at the University of Washington, Seattle, Wash., USA.
(87) The antibody that recognizes substrates phosphorylated by PKA (P-PKA substrate) was purchased from Cell Signaling Technology (Danvers, Mass., USA; product code: #9621) and the antibody against CFTR clone M3A7 from Millipore (Billerica, Mass., USA; product code: 05-583).
(88) ICUE3-pcDNA3 was described previously (2).
(89) Isoproterenol, CGP-20712A, carbachol, Rolipram, amiloride and forskolin were all purchased from Sigma (Sigma-Aldrich, St. Louis, Mo.). The CFTR corrector VX-809, the CFTR potentiator VX-770 and the CFTR inhibitor 172 were purchased from Selleckchem (Houston, Tex., USA).
(90) The P1 control peptide (SEQ ID No.: 3 RQIKIWFQNRRMKWKK) and the Trojan peptide derived from PI3K (SEQ ID No.: 2 RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF) were synthesized by GenScript (GenScript, Piscataway, N.J., USA) and Chinapeptides (Chinapeptides Co. Ltd., Shanghai, China).
(91) Statistical Analysis
(92) Prism software (GraphPad Software Inc., La Jolla, Calif., USA) was used for statistical analysis. P values were calculated using the Student's t test, one-way or two-way ANOVA followed by Bonferroni test, as appropriate. In all the figures, graphs represent the mean valuestandard error of at least 3 independent experiments.
(93) Results
(94) A Trojan Peptide Derived from PI3K Enhances .sub.2-AR/cAMP Signaling in Bronchial Smooth Muscle Cells
(95) Strategies to increase cAMP levels downstream of .sub.2-ARs in bronchial smooth muscle are of great interest for treating respiratory diseases. To explore the therapeutic potential of inhibiting PI3K-dependent .sub.2-AR-cAMP signaling, a peptide inhibitor of the kinase-independent activity of PI3K, the sequence of which is shown in SEQ ID No.: 2, was designed. A previous study indicates that a peptide comprising the 126-150 residues of human PI3K (SEQ ID No.: 1) inhibits PKA anchoring and decreases the activity of PI3K-bound phosphodiesterase 3B in vitro (1). To inhibit the PKA anchoring activity of PI3K in vivo, an inhibitory fusion peptide permeable to cell membranes was obtained by binding the 126-150 domain of human PI3K (SEQ ID No.: 1) with the Trojan peptide of Antennapedia Penetratin 1 (SEQ ID No.: 3
(96) Since cAMP is known to induce a decrease of intracellular levels of Ca.sup.2+ and, as a consequence, to promote smooth muscle relaxation, the ability of the PI3K inhibitory Trojan peptide to modify Ca.sup.2+ concentrations in hBSMCs was analyzed. The maximum peak of Ca.sup.2+ transients induced by the muscarinic agonist carbachol was significantly lower in hBSMCs pre-treated with the PI3K inhibitor compared to cells exposed to vehicle or to P1 control peptide (
(97) Overall, these data indicate that a Trojan peptide that inhibits the PKA anchoring function of PI3K constitutes a novel method for inhibiting selected PDEs and enhancing cAMP signaling downstream of .sub.2-ARs, in smooth muscle cells.
(98) A Trojan Peptide Derived from PI3K Limits Airway Hyperresponsiveness in Healthy and Asthmatic Mice
(99) To determine the transduction efficiency of the PI3K inhibitory peptide in vivo in the airways, a fluorescein (FITC)-labelled form of the peptide was instilled by the intra-tracheal route in BALB/C wild-type mice. FITC fluorescence was detected in the trachea and lungs, but not in the brain or in the myocardium, at 30 minutes after administration (
(100) Taken together, these data demonstrate the ability of the Trojan peptide derived from PI3K to increase cAMP levels in vivo in the airways and to function as a bronchodilator.
(101) A Trojan Peptide Derived from PI3K Increases cAMP Levels and Enhances the Conductance of CFTR in Bronchial Epithelial Cells Expressing Wild-Type or a F508 Mutant CFTR
(102) Subsequently, the ability of the PI3K inhibitory Trojan peptide to increase cAMP levels not only in smooth muscle cells, but also in epithelial cells of the airways, was examined. For this purpose, we analyzed cAMP-mediated phosphorylation of the cystic fibrosis transmembrane conductance regulator (CFTR), the main chloride (Cl.sup.) channel in the epithelium of the respiratory tract, the activation of which is cAMP-dependent. CFTR phosphorylation was significantly higher in normal human bronchial epithelial cells (Nuli-1) treated with the Trojan peptide derived from PI3K, compared to control cells exposed to vehicle or to P1 control peptide (
(103) To examine whether increased CFTR phosphorylation correlates with higher Cl.sup. conductance, measurements of Cl.sup. currents were performed in Ussing chambers in NuLi-1 cells expressing wild-type CFTR. CFTR-dependent currents increased significantly following the application of the Trojan peptide derived from PI3K, while the P1 control peptide did not change the conductance (
(104) Molecules with CFTR potentiator activity are required to stimulate the opening of the defective CFTR in the treatment of cystic fibrosis (CF). To determine if the Trojan peptide derived from PI3K is able to correct the defective Cl.sup. conductance of the mutant CFTR, CFTR-dependent currents were measured in bronchial epithelial cells expressing the mutant CFTR F508-CFTR (CuFi-1). PI3K inhibition synergistically increased the activity of the known CFTR potentiator, VX-770, resulting in an increase of the CFTR currents by about 5-fold more than the basal activity (
(105) Overall, these data reveal a novel function for the PI3K inhibitory peptide as a CFTR potentiator, which promotes cAMP-dependent opening of the wild-type channel and the mutant CFTR(F508-CFTR).
(106) A PI3K-Derived Trojan Peptide Limits Lung Inflammation in Asthmatic Mice
(107) It is well known that an increase of cAMP in leukocytes promotes an anti-inflammatory response. Therefore, the ability of the PI3K-derived Trojan peptide to increase cAMP concentrations in this cell type and, therefore, to limit the inflammation associated with chronic respiratory diseases, was evaluated. Mice pre-treated with the P1 control peptide before each intranasal injection of ovalbumin showed an increase in peribronchial inflammation (
(108) Overall, this experimental evidence demonstrates the ability of the Trojan peptide derived from PI3K to selectively inhibit the neutrophilia associated with chronic respiratory diseases, and therefore to function as an anti-inflammatory drug.
REFERENCES
(109) 1. A. Perino et al., Mol Cell 42, 84 (Apr. 8, 2011). 2. A. Ghigo et al., Circulation 126, 2073 (Oct. 23, 2012). 3. M. Della Peruta, C. Giagulli, C. Laudanna, A. Scarpa, C. Sorio, Mol Cancer 9, 61 (2010). 4. E. Hirsch et al., Science 287, 1049 (Feb. 11, 2000). 5. E. Patrucco et al., Cell 118, 375 (Aug. 6, 2004). 6. V. Fanelli et al., Intensive Care Med 36, 1935 (November, 2010).