Thermostable Cas9 nucleases

10731142 ยท 2020-08-04

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to the field of genetic engineering and more particularly to nucleic acid editing and genome modification. The present invention provides an isolated Cas protein or polypeptide fragment thereof having an amino acid sequence of SEQ ID NO: 1 or a sequence of at least 77% identity therewith, wherein the Cas protein or polypeptide is capable of DNA cleavage at a temperature in the range 50 C. and 100 C. inclusive. The invention further provides isolated nucleic acid molecules encoding said Cas9 nucleases, expression vectors and host cells. The Cas9 nucleases disclosed herein provide novel tools for genetic engineering at elevated temperatures and are of particular value in the genetic manipulation of thermophilic organisms; particularly microorganisms.

Claims

1. A ribonucleoprotein complex comprising a Cas protein having an amino acid sequence of SEQ ID NO: 1 or a sequence of at least 92% identity therewith, and comprising at least one targeting RNA molecule which recognizes a sequence in a target polynucleotide to be cleaved, wherein the targeting RNA molecule is a single guide RNA (sgRNA), further wherein the targeting RNA molecule is a single guide RNA (sgRNA) comprising a CRISPR RNA (crRNA) and a trans-activating small RNA (tracrRNA) linked by a synthetic loop.

2. A ribonucleoprotein complex as claimed in claim 1, wherein the length of the crRNA molecule is in the range 35-135 nucleotide residues.

3. A ribonucleoprotein complex as claimed in claim 1, wherein the target sequence is 31 or 32 nucleotide residues in length.

4. A ribonucleoprotein complex as claimed in claim 1, wherein the Cas protein is fused or linked to at least one functional moiety.

5. A ribonucleoprotein complex as claimed in claim 1, wherein the at least one functional moiety is selected from the group consisting of: (a) fused or linked to the N-terminus of the Cas protein, and (b) fused or linked to the C-terminus of the Cas protein; and further wherein the at least one functional moiety is a protein selected from the group consisting of: a DNA binding protein, a DNA structuring protein, a reporter protein, a ligand binding protein, a signal peptide, a subcellular localization sequence, and an affinity purification tag.

6. A ribonucleoprotein complex as claimed in claim 4, wherein the native activity of the Cas9 nuclease is inactivated and the Cas protein is linked to at least one functional moiety.

7. A ribonucleoprotein complex as claimed in claim 4, wherein the at least one functional moiety is selected from the group consisting of: a) a nuclease domain; and b) a marker protein.

8. An expression vector comprising a nucleotide sequence encoding a Cas protein having an amino acid sequence of SEQ ID NO: 1 or a sequence of at least 92% identity therewith, wherein the Cas encoding nucleotide sequence is covalently linked to a heterologous promoter sequence.

9. The expression vector as claimed in claim 8, further comprising at least one nucleic acid sequence encoding an amino acid sequence which upon translation is fused with the Cas protein; wherein the at least one nucleic acid sequence fused to the nucleic acid molecule encoding the Cas protein, encodes a protein selected from the group consisting of a DNA binding protein, a DNA structuring protein, a reporter protein, a ligand binding protein, a signal peptide, a subcellular localization sequence, and an affinity purification tag.

10. An expression vector as claimed in claim 8, further comprising a nucleotide sequence encoding at least one targeting RNA molecule.

11. A method of modifying a target nucleic acid comprising contacting the nucleic acid with a ribonucleoprotein complex as claimed in claim 1.

12. A method of modifying a target nucleic acid in a cell, comprising transforming, transfecting or transducing the cell with an expression vector of claim 10.

13. A method of modifying a target nucleic acid as claimed in claim 11, wherein the method is carried out at a temperature between 20 C. and 100 C.

14. A method of modifying a target nucleic acid as claimed in claim 13, wherein the method is carried out at a temperature at or above 60 C.

15. A method as claimed in claim 11 wherein the cell is a prokaryotic cell.

16. A method as claimed in claim 11 wherein the cell is a eukaryotic cell.

17. An isolated host cell transformed by a method as claimed in claim 11.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) The invention will now be described in detail with reference to a specific embodiment and with reference to the accompanying drawings, in which:

(2) FIG. 1 shows a Neighbour-Joining tree of Cas9 protein sequences. All sequences having a sequence similarity above 40% with strain T12 based on pBLAST or PSI-BLAST were included, as well as currently well-characterized sequences (S. pyogenes, S. thermophiles and A. naeslundii), as well as all currently identified thermophilic sequences also when these were below 40% identity. For all thermophilic sequences, the percentage identity to T12 is indicated after the strain name. Gene identifier (gi) numbers are indicated before the species name. Legend: Closed circles: thermophilic (optimum above 60 C.) Cas9 sequences, closed squares: thermotolerant (optimum <50 C.) Cas9 sequences, open triangle: Cas9 sequence currently most used for genome editing purposes from mesophilic origin; no sign: mesophilic Cas9. Values at the nodes represent 1000-replicate bootstrap values; scale bar represents estimated amino acid substitutions per site.

(3) FIG. 2 shows a Neighbour-Joining tree of Cas9 gene sequences. Identity at the gene level was extremely poor; sequences from the same organisms as those used for the protein alignment were used for the gene alignment. Gene identifier (gi) numbers are indicated before the species name. Legend: Closed circles: thermophilic (optimum above 60 C.) Cas9 sequences, closed squares: thermotolerant (optimum <50 C.) Cas9 sequences, open triangle: Cas9 sequence currently most used for genome editing purposes from mesophilic origin; no sign: mesophilic Cas9. Values at the nodes represent 1000-replicate bootstrap values.

(4) FIG. 3 shows a protein sequence alignment for T12-Cas9 (SEQ ID NO: 1) (Type II-C) with well-characterized Type II-C (A. naeslundiilana; SEQ ID NO: 8) and Type II-A (S. pyogeneslpyo; SEQ ID NO: 9 and S. thermophilus) Cas9 sequences. Important active site residues are well conserved and indicated with black arrows. Protein domains as described for Ana-Cas9 and Pyo-Cas9 (Jinek, et al., 2014, Science 343: 1247997) are indicated with shaded boxes and similarly coloured letters. The PAM recognition domain has been determined for the S. pyogenes Type II-A system but not for any Type II-C system and is therefore only indicated in the S. pyogenes sequence.

(5) FIG. 4 shows protein architecture of A. naeslundii Cas9 (Cas9-Ana) (Jinek et al., 2014). T12-Cas9 belongs to the same Type II-C CRISPR system and active site residues could be identified.

(6) FIG. 5 shows a comparison of crRNA-guided targeting of complementary dsDNA. Base pairing is indicated with dashed lines. RNA is depicted in black, DNA in grey. Base pairing between crRNA spacer and target protospacer is indicated with thick black dashed line, base pairing between DNA strands and between RNA strands is indicated with thick grey dashed lines. The 5 end of the crRNA is indicated. Note that PAM (small white box) in Type I resides downstream of target strand (protospacer), whereas in Type II it resides at the other end on the displaced strand. Likewise, the seed (the predicted sequence of the guide where base pairing with target DNA strand starts, and where no mismatches are allowed) is located close to the PAM, and as such differs in types I and II (Van der Oost, 2014 ibid.). Panel A shows a schematic of a Type I Cascade system of E. coli. crRNA has internal spacer (grey box, 31-32 nt that allows for target recognition), flanked bt a 8 nt 5 handle and a 29 nt 3 handle that consists of a stem-loop structure (hairpin) (Jore 2011 ibid.). Panel B shows a schematic of a Type II Cas9 system of S. pyogenes. crRNA basepairs with tracrRNA, that allows for processing by RNaseIII (opposite black triangles). Additionally, the 5 end of the crRNA is trimmed by an RNase (black triangle), typically resulting in a 20 nt spacer. Note that a synthetic loop may be introduced to link the crRNA and tracrRNA, resulting in a single guide RNA (sgRNA) (Jinek et al., 2012 ibid.).

(7) Below are polynucleotide and amino acid sequences of Cas proteins used in accordance with the invention.

(8) TABLE-US-00001 GeobacillusthermodenitrificansT12Cas9protein AAsequence [SEQIDNO:1] MKYKIGLDIGITSIGWAVINLDIPRIEDLGVRIFDRAENPKTGESLALPR RLARSARRRLRRRKHRLERIRRLFVREGILTKEELNKLFEKKHEIDVWQL RVEALDRKLNNDELARILLHLAKRRGFRSNRKSERTNKENSTMLKHIEEN QSILSSYRTVAEMVVKDPKFSLHKRNKEDNYTNTVARDDLEREIKLIFAK QREYGNIVCTEAFEHEYISIWASQRPFASKDDIEKKVGFCTFEPKEKRAP KATYTFQSFTVWEHINKLRLVSPGGIRALTDDERRLIYKQAFHKNKITFH DVRTLLNLPDDTRFKGLLYDRNTTLKENEKVRFLELGAYHKIRKAIDSVY GKGAAKSFRPIDFDTFGYALTMFKDDTDIRSYLRNEYEQNGKRMENLADK VYDEELIEELLNLSFSKFGHLSLKALRNILPYMEQGEVYSTACERAGYTF TGPKKKQKTVLLPNIPPIANPVVMRALTQARKVVNAIIKKYGSPVSIHIE LARELSQSFDERRKMQKEQEGNRKKNETAIRQLVEYGLTLNPTGLDIVKF KLWSEQNGKCAYSLQPIEIERLLEPGYTEVDHVIPYSRSLDDSYTNKVLV LTKENREKGNRTPAEYLGLGSERWQQFETFVLTNKQFSKKKRDRLLRLHY DENEENEFKNRNLNDTRYISRFLANFIREHLKFADSDDKQKVYTVNGRIT AHLRSRWNFNKNREESNLHHAVDAAIVACTTPSDIARVTAFYQRREQNKE LSKKTDPQFPQPWPHFADELQARLSKNPKESIKALNLGNYDNEKLESLQP VFVSRMPKRSITGAAHQETLRRYIGIDERSGKIQTVVKKKLSEIQLDKTG HFPMYGKESDPRTYEAIRQRLLEHNNDPKKAFQEPLYKPKKNGELGPIIR TIKIIDTTNQVIPLNDGKTVAYNSNIVRVDVFEKDGKYYCVPIYTIDMMK GILPNKAIEPNKPYSEWKEMTEDYTFRFSLYPNDLIRIEFPREKTIKTAV GEEIKIKDLFAYYQTIDSSNGGLSLVSHDNNFSLRSIGSRTLKRFEKYQV DVLGNIYKVRGEKRVGVASSSHSKAGETIRPL* GeobacillusthermodenitrificansT12Cas9DNA Sequence [SEQIDNO:7] ATGAAGTATAAAATCGGTCTTGATATCGGCATTACGTCTATCGGTTGGGC TGTCATTAATTTGGACATTCCTCGCATCGAAGATTTAGGTGTCCGCATTT TTGACAGAGCGGAAAACCCGAAAACCGGGGAGTCACTAGCTCTTCCACGT CGCCTCGCCCGCTCCGCCCGACGTCGTCTGCGGCGTCGCAAACATCGACT GGAGCGCATTCGCCGCCTGTTCGTCCGCGAAGGAATTTTAACGAAGGAAG AGCTGAACAAGCTGTTTGAAAAAAAGCACGAAATCGACGTCTGGCAGCTT CGTGTTGAAGCACTGGATCGAAAACTAAATAACGATGAATTAGCCCGCAT CCTTCTTCATCTGGCTAAACGGCGTGGATTTAGATCCAACCGCAAGAGTG AGCGCACCAACAAAGAAAACAGTACGATGCTCAAACATATTGAAGAAAAC CAATCCATTCTTTCAAGTTACCGAACGGTTGCAGAAATGGTTGTCAAGGA TCCGAAATTTTCCCTGCACAAGCGTAATAAAGAGGATAATTACACCAACA CTGTTGCCCGCGACGATCTTGAACGGGAAATCAAACTGATTTTCGCCAAA CAGCGCGAATATGGGAACATCGTTTGCACAGAAGCATTTGAACACGAGTA TATTTCCATTTGGGCATCGCAACGCCCTTTTGCTTCTAAGGATGATATCG AGAAAAAAGTCGGTTTCTGTACGTTTGAGCCTAAAGAAAAACGCGCGCCA AAAGCAACATACACATTCCAGTCCTTCACCGTCTGGGAACATATTAACAA ACTTCGTCTTGTCTCCCCGGGAGGCATCCGGGCACTAACCGATGATGAAC GTCGTCTTATATACAAGCAAGCATTTCATAAAAATAAAATCACCTTCCAT GATGTTCGAACATTGCTTAACTTGCCTGACGACACCCGTTTTAAAGGTCT TTTATATGACCGAAACACCACGCTGAAGGAAAATGAGAAAGTTCGCTTCC TTGAACTCGGCGCCTATCATAAAATACGGAAAGCGATCGACAGCGTCTAT GGCAAAGGAGCAGCAAAATCATTTCGTCCGATTGATTTTGATACATTTGG CTACGCATTAACGATGTTTAAAGACGACACCGACATTCGCAGTTACTTGC GAAACGAATACGAACAAAATGGAAAACGAATGGAAAATCTAGCGGATAAA GTCTATGATGAAGAATTGATTGAAGAACTTTTAAACTTATCGTTTTCTAA GTTTGGTCATCTATCCCTTAAAGCGCTTCGCAACATCCTTCCATATATGG AACAAGGCGAAGTCTACTCAACCGCTTGTGAACGAGCAGGATATACATTT ACAGGGCCAAAGAAAAAACAGAAAACGGTATTGCTGCCGAACATTCCGCC GATCGCCAATCCGGTCGTCATGCGCGCACTGACACAGGCACGCAAAGTGG TCAATGCCATTATCAAAAAGTACGGCTCACCGGTCTCCATCCATATCGAA CTGGCCCGGGAACTATCACAATCCTTTGATGAACGACGTAAAATGCAGAA AGAACAGGAAGGAAACCGAAAGAAAAACGAAACTGCCATTCGCCAACTTG TTGAATATGGGCTGACGCTCAATCCAACTGGGCTTGACATTGTGAAATTC AAACTATGGAGCGAACAAAACGGAAAATGTGCCTATTCACTCCAACCGAT CGAAATCGAGCGGTTGCTCGAACCAGGCTATACAGAAGTCGACCATGTGA TTCCATACAGCCGAAGCTTGGACGATAGCTATACCAATAAAGTTCTTGTG TTGACAAAGGAGAACCGTGAAAAAGGAAACCGCACCCCAGCTGAATATTT AGGATTAGGCTCAGAACGTTGGCAACAGTTCGAGACGTTTGTCTTGACAA ATAAGCAGTTTTCGAAAAAGAAGCGGGATCGACTCCTTCGGCTTCATTAC GATGAAAACGAAGAAAATGAGTTTAAAAATCGTAATCTAAATGATACCCG TTATATCTCACGCTTCTTGGCTAACTTTATTCGCGAACATCTCAAATTCG CCGACAGCGATGACAAACAAAAAGTATACACGGTCAACGGCCGTATTACC GCCCATTTACGCAGCCGTTGGAATTTTAACAAAAACCGGGAAGAATCGAA TTTGCATCATGCCGTCGATGCTGCCATCGTCGCCTGCACAACGCCGAGCG ATATCGCCCGAGTCACCGCCTTCTATCAACGGCGCGAACAAAACAAAGAA CTGTCCAAAAAGACGGATCCGCAGTTTCCGCAGCCTTGGCCGCACTTTGC TGATGAACTGCAGGCGCGTTTATCAAAAAATCCAAAGGAGAGTATAAAAG CTCTCAATCTTGGAAATTATGATAACGAGAAACTCGAATCGTTGCAGCCG GTTTTTGTCTCCCGAATGCCGAAGCGGAGCATAACAGGAGCGGCTCATCA AGAAACATTGCGGCGTTATATCGGCATCGACGAACGGAGCGGAAAAATAC AGACGGTCGTCAAAAAGAAACTATCCGAGATCCAACTGGATAAAACAGGT CATTTCCCAATGTACGGGAAAGAAAGCGATCCAAGGACATATGAAGCCAT TCGCCAACGGTTGCTTGAACATAACAATGACCCAAAAAAGGCGTTTCAAG AGCCTCTGTATAAACCGAAGAAGAACGGAGAACTAGGTCCTATCATCCGA ACAATCAAAATCATCGATACGACAAATCAAGTTATTCCGCTCAACGATGG CAAAACAGTCGCCTACAACAGCAACATCGTGCGGGTCGACGTCTTTGAGA AAGATGGCAAATATTATTGTGTCCCTATCTATACAATAGATATGATGAAA GGGATCTTGCCAAACAAGGCGATCGAGCCGAACAAACCGTACTCTGAGTG GAAGGAAATGACGGAGGACTATACATTCCGATTCAGTCTATACCCAAATG ATCTTATCCGTATCGAATTTCCCCGAGAAAAAACAATAAAGACTGCTGTG GGGGAAGAAATCAAAATTAAGGATCTGTTCGCCTATTATCAAACCATCGA CTCCTCCAATGGAGGGTTAAGTTTGGTTAGCCATGATAACAACTTTTCGC TCCGCAGCATCGGTTCAAGAACCCTCAAACGATTCGAGAAATACCAAGTA GATGTGCTAGGCAACATCTACAAAGTGAGAGGGGAAAAGAGAGTTGGGGT GGCGTCATCTTCTCATTCGAAAGCCGGGGAAACTATCCGTCCGTTATAA

DETAILED DESCRIPTION

Example 1: Isolation of G. thermodenitrificans

(9) G. thermodenitrificans was surprisingly discovered during a search of a library of 500 isolates for a thermophile capable of degrading lignocellulosic substrates under anaerobic conditions. At first a library of 500 isolates was established which, after several selection rounds by isolation on cellulose and xylan, was trimmed down to 110 isolates. This library of 110 isolates consisted solely of Geobacillus isolates with G. thermodenitrificans representing 79% of the library.

(10) The isolated G. thermodenitrificans strain has been named T12.

Example 2: Defining the Essential Consensus Sequences for Cas9 in Geobacillus thermodenitrificans

(11) The following database searches and alignments were performed:

(12) pBLAST and nBLAST were performed on the in-house BLAST server, in which either the protein or gene sequence of G. thermodenitrificans T12 was used as query sequence. This database was last updated May 2014 and therefore does not contain the most recently added Geobacillus genomes, but normal online BLAST was not used to prevent publication of the T12 sequence. See Appendix 1 for the results of the in-house pBLAST in Excel format, the most relevant sequences of this (sequence identities greater than 40% are included in FIG. 1).

(13) To include more recent sequence data, the sequence of Geobacillus MAS1 (most closely related to T12 Cas9) was used to perform a PSI-BLAST on the NCBI website (Johnson et al., 2008 Nucleic Acids Res. 36 (Web Server issue): W5-9). Two consecutive rounds of PSI-BLAST were performed, in which only sequences that met the following criteria were used for the next round: minimum sequence coverage of 96% in the first round and 97% in the second and third round, minimum identity 40%, only one strain per species.

(14) The sequences resulting from the PSI-BLAST, as well as the sequences with more than 40% identity to T12 from the internal server pBLAST that did not appear in the PSI-BLAST were aligned together with currently well-characterized mesophilic sequences and all currently identified thermophilic sequences also if these were more distantly related, from which a Neighbour-Joining tree was constructed (see FIG. 1). Alignment was performed in Mega6 using ClustalW, after which a tree was constructed using the Neighbour-Joining method and bootstrap analysis was performed using 1000 replicates.

(15) When BLASTn was performed using Geobacillus sp. MAS1 as the query sequence, only Geobacillus sp. JF8 Cas9 was identified with 88% identity, indicating very little homology at the gene level. FIG. 2 is a Neighbour-Joining tree of Clustal-aligned Cas9 gene sequences.

(16) Protein sequences of G. thermodenitrificans T12, A. naeslundii and S. pyogenes were further analyzed for protein domain homology (see FIG. 3) by aligning them in CloneManager using BLOSUM62 with default settings.

Example 3: Identifying Core Amino Acid Motifs which are Essential for the Function of CAS9 and Those which Confer Thermostability in Thermophilic Cas9 Nucleases

(17) Percentages identity of the above described aligned protein sequences are provided in FIG. 1. T12-Cas9 belongs to Type II-C. The best-studied and recently crystalized structure of a Type II-C system is from Actinomyces naeslundii (Jinek et al., 2014, Science 343: 1247997). This protein sequence shows only 20% identity to T12-Cas9 but can be used to estimate highly conserved residues. Two well-characterized Type II-A systems (S. pyogenes and S. thermophilus) were also included in the analyses (Jinek et al., 2014, Science 343: 1247997; Nishimasu et al., 2014, Cell 156: 935-949). Alignments of these four protein sequences are shown in FIG. 3; FIG. 4 shows the protein architecture as determined for A. naeslundii (Ana-Cas9) (Jinek et al., 2014, Science 343: 1247997). The length of Cas9 from t12 and Actinomyces naeslundii is highly similar (A. naeslundii 1101 aa, T12 1082 aa) and T12 is expected to have similar protein architecture but this remains to be determined, as the overall sequence identity to cas9-Ana is only 20%. All active side residues described by Jinek et al. (Jinek et al., 2014, Science 343: 1247997) in Cas9 from A. naeslundii and S. pyogenes could be identified in T12-Cas9 (see FIG. 3). The PAM-binding domain has been determined for the S. pyogenes Type II-A system but not for any Type II-C system and is therefore only indicated in the S. pyogenes sequence. Moreover, the PAM-recognition site varies strongly, not only between CRISPR systems but also between species containing the same system. For more information on the PAM please see question 4 and future planning.

Example 4: Determination of the PAM Sequence of G. thermodenitrificans T12 Cas9

(18) It has been established that the prokaryotic CRISPR systems serve their hosts as adaptive immune systems (Jinek et al., 2012, Science 337: 816-821) and can be used for quick and effective genetic engineering (Mali et al., 2013, Nat Methods 10: 957-963.).

(19) Cas9 proteins function as sequence-specific nucleases for the type II CRISPR systems (Makarova et al., 2011, Nat Rev Micro 9: 467-477). Small crRNA molecules, which consist of a spacer (target) linked to a repetition region, are the transcription and processing products of a CRISPR loci. Spacers naturally originate from the genome of bacteriophages and mobile genetic elements, but they can also be designed to target a specific nucleotide sequence during a genetic engineering process (Bikard et al., 2013, Nucleic Acids Research 41: 7429-7437). The crRNA molecules are employed by the Cas9 as guides for the identification of their DNA targets. The spacer region is identical to the targeted for cleavage DNA region, the protospacer (Brouns et al., 2012, Science 337: 808-809). A PAM (Protospacer Adjacent Motif), next to the protospacer, is required for the recognition of the target by the Cas9 (Jinek et al., 2012, Science 337: 816-821).

Example 5: Target Generation with Randomized PAM

(20) Two different spacers from the CRISPR II loci of the G. thermodenitrificans T12 strain were amplified by PCR using the G. thermodenitrificans T12 genomic DNA as template. Two pairs of degenerate primers were used for the amplification of each spacer:

(21) Firstly, a pair that cause the introduction of six random nucleotides upstream of the protospacer fragment were used, leading to the production of a pool of protospacers with randomized PAM sequences.

(22) Secondly, a pair that cause the introduction of six random nucleotides downstream of the protospacer fragment were used, leading to the production of a pool of protospacers with randomized PAM sequences.

(23) The produced fragments were ligated to the pNW33n vector, producing 4 pools of protospacer constructs, with all the possible 4096 different combinations of 6-nucleotide long PAMs each. The assembled DNA was used for the transformation of G. thermodenitrificans T12 cells. The cells were plated on chloramphenicol selection and more than 210.sup.6 cells from each protospacer pool will be pooled. The plasmid DNA was extracted from the pools, the target region will be PCR amplified and the products sent for deep sequencing. The PAMs with the fewest reads will be considered active and the process will be repeated only with pNW33n constructs that contain spacers with these PAMs. Reduced transformation efficiency of the G. thermodenitrificans T12 will confirm the activity of the PAMs.

Example 6. Functional Temperature Ranges for Geobacillus thermodenitrificans Cas9

(24) No temperature range experiments have been conducted to date on any publically available Cas9 protein. The Cas9 proteins used in research all have a mesophilic origin with a maximum growth temperature of 45 C. for the host organism Streptococcus pyogenes (ATCC_700294).

(25) Here the range of temperatures within which Cas9 from Geobacillus thermodenitrificans is stable and functional and further the temperature at which its activity is optimal was experimentally determined. Furthermore, the functional and preferred temperatures ranges for Cas9 nucleases from other Geobacillus species were also determined.

(26) Temperature ranges of Geobacillus thermodenitrificans T12 Cas9 nucleases have been determined in vitro by using a single guide RNA (sgRNA). The sgRNA consists of the endogenous bacterial crRNA and tracrRNA into a single chimeric transcript and has been created by making use of the pT7 cloning vector containing the crRNA:tracrRNA backbone, preceded by a 20 basepair (bp) target sequence (Jao et al., 2013, PNAS 110: 13904-13909). The target sequence starts with the 20 bp target and ends with the T12 PAM sequence (derived from Example 4). The desired single targeting sgRNA has been generated by in vitro transcription from a T7 promoter after linearizing the plasmid. The standard cloning vector pUC19 has been used as a target in our in vitro activity assays. A target site (20 nt+PAM) in the plasmid has been constructed by two complementary oligos which have been annealed and ligated into the sgRNA cloning vector. The produced sgRNA was incubated together with the Cas9 nuclease of T12 at temperatures ranging from 20 C. to 100 C. Cas9 cleavage activity has been assayed by agarose gel electrophoreses.

(27) The organism isolated and characterised here (T12) has an optimum growth temperature of 65 C. which also represents the optimal temperature for its Cas9 protein. The temperature range in which it is active would be from 20 C. to 100 C., in particular 20 C. to 80 C.

(28) The optimal temperature range of Cas9 from Geobacillus species is much higher than that of Cas9 proteins which have been characterised to date. Similarly the upper extent of the range in which it retains nuclease activity is much higher than that of known Cas9 proteins. A higher optimal temperature and functional range provides a significant advantage in genetic engineering at high temperatures and therefore in editing the genomes of thermophilic organisms, which have utility in a range of industrial, agricultural and pharmaceutical processes conducted at elevated temperatures.