CONJUGATED KNOTTIN MINI-PROTEINS CONTAINING NON-NATURAL AMINO ACIDS
20200239531 ยท 2020-07-30
Inventors
Cpc classification
A61K47/64
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
Disclosed are knottin peptides containing non-natural amino acids so that they can be formed by chemical conjugation into two or more knottin monomers. The knottin monomers comprise a non-natural amino acid such as an aminooxy residue within the polypeptide sequence. The exemplified dimers were produced by oxime formation between two aldehyde groups present on a polyether linker and an aminooxy functional group that was site-specifically incorporated the knottin. Knottins variants based on EETI (Ecballium elaterium trypsin inhibitor) and AgRP (Agouti-related protein) were engineered to contain integrin-binding loops. These dimers were shown to have increased binding strength to integrins on U87MG tumor cells, achieving significant increases in inhibition of cell adhesion and proliferation. Also disclosed are knottin monomers comprising an aminooxy residue; these may be conjugated to molecules such as doxorubicin.
Claims
1. A knottin peptide comprising a scaffold portion having a sequence essentially identical to a sequence of EETI-II (SEQ ID NO: 1) or a scaffold portion essentially identical to AgRP (SEQ ID NO: 10); an exogenous binding loop portion within the scaffold portion said binding loop having a sequence which specifically recognizes a target; and a non-natural amino acid comprised in the scaffold portion.
2. The knottin peptide of claim 1 wherein the non-natural amino acid contains a side chain that is either aminooxy, aldehyde, ketone, alkyne, alkene, aryl halide diene or azide.
3. The knottin peptide of claim 1 further comprising a linker molecule and wherein said knottin peptide is part of a dimer wherein monomer knottin peptides are linked by the linker molecule.
4. The knottin peptide of claim 3 wherein monomers have a sequence at least 90% or at least 95% identical to a peptide of SEQ ID NO: 3 (EETI 2.5F_AO); SEQ NO: 13 (2.5F-AO-2); SEQ ID NO: 5 (EETI 2.5D_AO); or SEQ ID NO: 8 (AgRP 7C_AO).
5. The knottin peptide of claim 1 wherein the scaffold portion is from EETI-II; the non-natural amino acid has an aminooxy residue; and said aminooxy residue is at a position that is between residues 15 and 23, or else at a position between residues 27-31, inclusive.
6. The knottin peptide of claim 1 wherein the knottin peptide comprises a scaffold portion from AgRP and the non-natural amino acid has an aminooxy residue between residues 35 and 38, inclusive.
7. The knottin peptide of claim 1 wherein the non-natural amino acid is a single residue that has a side chain aminooxy residue that is 2-amino-3-(2-(aminooxy)acetamido)propanoic acid.
8. The knottin peptide of claim 1 wherein the binding loop portion contains the sequence RGD and is between two adjacent cystines in the peptide.
9. A composition as defined in claim 7 wherein said knottin peptide and a second knottin peptide are bound to each other by a linker molecule.
10. The composition of claim 9 wherein the linker molecule is conjugated to an aminooxy residue incorporated within each knottin peptide.
11. The dimer of claim 10 formed with a linker molecule which is a polyether, alkyl chain, polypeptide, -peptide, or peptoid.
12. A knottin peptide comprising an aminooxy residue, wherein said residue is conjugated to a small molecule, or is conjugated to a molecular linker.
13. The knottin peptide of claim 12 having a sequence at least 90% identical or at least 95% identical to a peptide listed as SEQ ID NO: 3, SEQ ID NO: 5, or SEQ ID NO: 8.
14. The knottin peptide of claim 12 wherein the small molecule is doxorubicin.
15.-27. (canceled)
28. A method of making a knottin-drug conjugate, comprising: conjugating a small molecule drug to a knottin peptide, wherein the knottin peptide comprises a non-natural amino acid comprising a functional group selected from the group consisting of: aldehyde, ketone, alkyne, alkene, aryl halide, diene, azide, and aminooxy, wherein the conjugating comprises conjugating the small molecule drug to the non-natural amino acid via a linker molecule.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
Definitions
[0034] The term scaffold portion or molecular scaffold means a polypeptide or portions thereof having a sequence that is used in combination with a binding loop portion and also having a specific three-dimensional structure, which presents the binding loop portion for optimal target binding. Typically a scaffold portion will be held in place by disulfide linkages between cysteine residues and will be based on a knottin sequence. The binding loop portion is held in place at terminal ends by the molecular scaffold portion. The term molecular scaffold has an art-recognized meaning (in other contexts), which is also intended here. For example, a review by Skerra, Engineered protein scaffolds for molecular recognition, J. Mol. Recognit. 2000; 13:167-187 describes the following scaffolds: single domains of antibodies of the immunoglobulin superfamily, protease inhibitors, helix-bundle proteins, disulfide-knotted peptides and lipocalins. Guidance is given for the selection of an appropriate molecular scaffold.
[0035] The term binding loop portion means a polypeptide having an amino acid sequence of about 9-13 residues. It contains a sequence that is constructed to bind to a target, thereby referred to an engineered loop. It is exogenous to the scaffold portion, which is derived from a knottin. It will further contain a sequence that is engineered to bind to a target, with high affinity, and that the not a knottin native target. For example, a binding loop portion can be created through experimental methods such as directed molecular evolution to bind to a specific ligand. That is, for example, the sequence contains an RGD sequence or the like, flanked by residues that dictate high affinity and specificity. It should be noted that these engineered loops are identified and optimized through combinatorial library screening, or simply grafted entirely from natural binding sequences present within known proteins. The term specifically recognizes a target refers to the presence of the binding loop portion having high affinity for binding to another molecule, such as binding to integrins, as described below. The present recognition involves binding at nanomolar concentrations, as exemplified below.
[0036] The term knottin mini-protein, knottin peptide, or knottin protein is used as accepted in the art and refers to a member of a family of small proteins, typically 25-50 amino acids in length, that bind to various molecular targets, including proteins, sugars and lipids. Their three-dimensional structure is minimally defined by a particular arrangement of three disulfide bonds. This characteristic topology forms a molecular knot in which one disulfide bond passes through a macrocycle formed by the other two intrachain disulfide bridges. Although their secondary structure content is generally low, knottins share a small triple-stranded antiparallel -sheet, which is stabilized by the disulfide bond framework.
[0037] Specific examples of knottins include the trypsin inhibitor EETI-II from Ecballium elaterium seeds, the neuronal N-type Ca.sup.2+ channel blocker -conotoxin from the venom of the predatory cone snail Conus geographus, the Agouti-related protein (See Millhauser et al., Loops and Links: Structural Insights into the Remarkable Function of the Agouti-Related Protein, Ann. N.Y. Acad. Sci., Jun. 1, 2003; 994(1): 27-35), the omega agatoxin family, etc.
[0038] As will be understood from the description below, the knottins referred to herein are modified to contain a non-natural amino acid and an engineered binding loop, e.g. an integrin-binding loop containing the sequence RGD.
[0039] The term amino acid includes both naturally occurring and synthetic amino acids and includes both the D and L form of the acids. More specifically, amino acids contain up to ten carbon atoms. They may contain an additional carboxyl group, and heteroatoms such as nitrogen and sulfur. Preferably the amino acids are and -amino acids. The term -amino acid refers to amino acids in which the amino group is attached to the carbon directly attached to the carboxyl group, which is the -carbon. The term -amino acid refers to amino acids in which the amino group is attached to a carbon one removed from the carboxyl group, which is the -carbon. The amino acids described here are referred to in standard IUPAC single letter nomenclature, with X means in the present sequence listing, AO.
[0040] The non-natural amino acid AO is defined in the exemplified sequences as:
##STR00001##
[0041] The term aminooxy is defined below as RONH2.
[0042] The term EETI means Protein Data Bank Entry (PDB) 2ETI. Its entry in the Knottin database is EETI-II. It has the sequence of SEQ ID NO: 1:
TABLE-US-00001 (SEQIDNO:1) GCPRILMRCKQDSDCLAGCVCGPNGFCG
[0043] The term AgRP means PDB entry 1HYK. Its entry in the Knottin database is SwissProt AGRP_HUMAN, where the full-length sequence of 129 amino acids may be found. It comprises the sequence beginning at amino acid 87. An additional G is added to this construct. It also includes a C105A mutation described in Jackson, et al. 2002 Biochemistry, 41, 7565.
TABLE-US-00002 (SEQIDNO:10) GCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR-KLGTAMNPCSRT
[0044] The dashed portion shows a fragment omitted in the mini version, below. The bold and underlined portion, from loop 4, is replaced by the engineered binding loop, having RGD sequences described below.
[0045] The term includes a miniAgRP, in reference to a truncated AgRP that means PDB entry 1MRO. It is also SwissProt AGRP_HUMAN. It has the sequence, similar to that given above,
TABLE-US-00003 (SEQIDNO:6) GCVRLHESCLGQQVPCCDPAATCYCRFFNAFCYCR
where the italicized A represents an amino acid substitution which eliminates a free cysteine. The bold and underlined portion, from loop 4, is replaced by the below described he RGD sequences in binding portions.
[0046] The term cystine refers to a Cys residue in which the sulfur group is linked to another amino acid though a disulfide linkage; the term cysteine refers to the SH (half cystine) form of the residue. Binding loop portions may be adjacent to cystines, i.e. there are no other intervening cystines in the primary sequence in the binding loop.
[0047] The term non-natural amino acid means an amino acid other than the 20 proteinogenic alpha-amino acids which in nature are the building blocks of all proteins within humans and other eukaryotes, and which are also directly encoded by the universal genetic code. Such non-natural amino acids may be obtained commercially, and may be in a protected or unprotected form. See, for examples, the non-natural amino acid products available from HBCChem, Inc. described at http(colon slash slash) hbcchem-inc.com/unnatural_AA.html.
[0048] The term substantial identity in the context of a peptide indicates that a peptide comprises a sequence with at least 70% sequence identity to a reference sequence, preferably 80%, more preferably 85%, most preferably at least 90% or at least 95% sequence identity to the reference sequence over a specified comparison window, which in this case is either the entire peptide, a molecular scaffold portion, or a binding loop portion (9-11 residues). Preferably, optimal alignment is conducted using the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol., 48:443 453. An indication that two peptide sequences are substantially identical is that one peptide is immunologically reactive with antibodies raised against the second peptide. Another indication for present purposes, that a sequence is substantially identical to a specific sequence explicitly exemplified is that the sequence in question will have an integrin binding affinity at least as high as the reference sequence. Thus, a peptide is substantially identical to a second peptide, for example, where the two peptides differ only by a conservative substitution. Conservative substitutions are well known, and exemplified, e.g., by the PAM 250 scoring matrix. Peptides that are substantially similar share sequences as noted above except that residue positions that are not identical may differ by conservative amino acid changes. As used herein, sequence identity or identity in the context of two nucleic acid or polypeptide sequences makes reference to the residues in the two sequences that are the same when aligned for maximum correspondence over a specified comparison window. When percentage of sequence identity is used in reference to proteins it is recognized that residue positions which are not identical often differ by conservative amino acid substitutions, where amino acid residues are substituted for other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and therefore do not change the functional properties of the molecule. When sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Sequences that differ by such conservative substitutions are said to have sequence similarity or similarity. Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated, e.g., as implemented in the NIH Multiple alignment workshop (http colon:slash slash helixweb.nih.gov/multi-align/). Three-dimensional tools may also be used for sequence comparison.
[0049] As used herein, percentage of sequence identity means the value determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity.
[0050] The term lower alkyl means a straight or branched chain hydrocarbon having from one to twelve carbon atoms, optionally substituted with substituents selected from the group consisting of lower alkyl, lower alkoxy, lower alkylsulfanyl, lower alkylsulfenyl, lower alkylsulfonyl, oxo, mercapto, amino optionally substituted by alkyl, carboxy, carbamoyl optionally substituted by alkyl, aminosulfonyl optionally substituted by alkyl, nitro, or lower perfluoroalkyl, multiple degrees of substitution being allowed. Examples of alkyl as used herein include, but are not limited to, n-butyl, n-pentyl, isobutyl, and isopropyl, and the like.
[0051] The term alkylene means a straight or branched chain divalent hydrocarbon radical having from one to ten carbon atoms, optionally substituted with substituents selected from the group which includes lower alkyl, lower alkoxy, lower alkylsulfanyl, lower alkylsulfenyl, lower alkylsulfonyl, oxo, hydroxy, mercapto, amino optionally substituted by alkyl, carboxy, carbamoyl optionally substituted by alkyl, aminosulfonyl optionally substituted by alkyl, nitro, cyano, halogen and lower perfluoroalkyl, multiple degrees of substitution being allowed. Examples of alkylene as used herein include, but are not limited to, methylene, ethylene, n-propylene, n-butylene, and the like.
[0052] As used herein, the term alkyl refers to a straight or branched chain hydrocarbon having from one to twelve carbon atoms, optionally substituted with substituents selected from the group consisting of lower alkyl, lower alkoxy, lower alkylsulfanyl, lower alkylsulfenyl, lower alkylsulfonyl, oxo, mercapto, amino optionally substituted by alkyl, carboxy, carbamoyl optionally substituted by alkyl, aminosulfonyl optionally substituted by alkyl, nitro, or lower perfluoroalkyl, multiple degrees of substitution being allowed. Examples of alkyl as used herein include, but are not limited to, n-butyl, n-pentyl, isobutyl, and isopropyl, and the like.
[0053] As used herein, the term alkoxy means the group R.sub.aO, where R.sub.a is alkyl as defined above and the term C.sub.1-C.sub.2 alkoxy means the group R.sub.aO, where R.sub.a is C.sub.1-C.sub.2 alkyl as defined above.
[0054] Haloalkyl refers to a straight or branched chain hydrocarbon containing at least 1, and at most 4, carbon atoms substituted with at least one halogen, halogen being as defined herein. Examples of branched or straight chained C.sub.1-C.sub.4 haloalkyl groups useful in the present invention include, but are not limited to, methyl, ethyl, propyl, isopropyl, isobutyl and n-butyl substituted independently with one or more halogens, e.g., fluoro, chloro, bromo and iodo.
[0055] As used herein, the term haloalkoxy means the group R.sub.aO, where R.sub.a is haloalkyl as defined above and the term C.sub.1-C.sub.2 haloalkoxy means the group R.sub.aO, where R.sub.a is C.sub.1-C.sub.2 haloalkyl as defined above.
[0056] The term aryl refers to an optionally substituted benzene ring or to an optionally substituted benzene ring system fused to one or more optionally substituted benzene rings to form, for example, anthracene, phenanthrene, or napthalene ring systems. Exemplary optional substituents include lower alkyl, lower alkoxy, lower alkylsulfanyl, lower alkylsulfenyl, lower alkylsulfonyl, oxo, hydroxy, mercapto, amino optionally substituted by alkyl, carboxy, tetrazolyl, carbamoyl optionally substituted by alkyl, aminosulfonyl optionally substituted by alkyl, acyl, aroyl, heteroaroyl, acyloxy, aroyloxy, heteroaroyloxy, alkoxycarbonyl, nitro, cyano, halogen, lower perfluoroalkyl, heteroaryl, or aryl, multiple degrees of substitution being allowed. Examples of aryl groups include, but are not limited to, phenyl, 2-naphthyl, 1-naphthyl, biphenyl, as well as substituted derivatives thereof. As used herein, the term aralkyl refers to an aryl or heteroaryl group, as defined herein including both unsubstituted and substituted versions thereof, attached through a lower alkylene linker, wherein lower alkylene is as defined herein. As used herein, the term heteroaralkyl is included within the scope of the term aralkyl. The term heteroaralkyl is defined as a heteroaryl group, as defined herein, attached through a lower alkylene linker, lower alkylene is as defined herein. Examples of aralkyl, including heteroaralkyl, include, but are not limited to, benzyl, phenylpropyl, 2-pyridinylmethyl, 4-pyridinylmethyl, 3-isoxazolylmethyl, 5-methyl-3-isoxazolylmethyl, and 2-imidazoyly ethyl.
[0057] As used herein the term aralkoxy means the group R.sub.bR.sub.aO, where R.sub.a is alkylene and R.sub.b is aryl, both as defined above.
[0058] As used herein, the term alkylsulfanyl means the group R.sub.aS, where R.sub.a is alkyl as defined above.
[0059] As used herein, the term alkylsulfenyl means the group R.sub.aS(O), where R.sub.a is alkyl as defined above.
[0060] As used herein, the term alkylsulfonyl means the group R.sub.aSO.sub.2, where R.sub.a is alkyl as defined above.
[0061] As used herein, the term oxo means the group O
[0062] As used herein, the term mercapto means the group SH.
[0063] As used herein, the term carboxy means the group COOH.
[0064] The term polypeptoid means a polymer of peptoids, i.e. N-substituted glycines, as further described in Kirshenbaum et al., Sequence-specific polypeptoids: A diverse family of heteropolymers with stable secondary structure, Proc. Nat. Acd. Sci. 95(8): 4303-4308 (1998)
General Overview
[0065] The present invention relates to compositions and methods for providing a simple and efficient way to increase the binding strength of small engineered peptides such as knottin mini-proteins. A non-natural amino acid residue, containing an aminooxy (AO) side-chain, was incorporated into the native peptide backbone of two different classes of knottin scaffolds, Ecballium elaterium trypsin inhibitor (EETI) and the Agouti-related protein (AgRP).
[0066] As described above, knottin mini-proteins have a characteristic disulfide-bonded structure, which is illustrated in Gelly et al., The KNOTTIN website and database: a new information system dedicated to the knottin scaffold, Nucleic Acids Research, 2004, Vol. 32, Database issue D156-D159. A triple-stranded -sheet is present in many knottins. The spacing between Cys residues is important, as is the molecular topology and conformation of the RGD-containing integrin binding loop. These attributes are critical for high affinity integrin binding. The RGD mimic loop is inserted between knottin Cys residues, but the length of the loop must be adjusted for optimal integrin binding depending on the three-dimensional spacing between those Cys residues. For example, if the flanking Cys residues are linked to each other directly, the optimal loop may be shorter than if the flanking Cys residues are linked to Cys residues separated in primary sequence. Otherwise, particular amino acid substitutions can be introduced that constrain a longer RGD-containing loop into an optimal conformation for high affinity integrin binding.
[0067] Engineered integrin-binding variants of EETI and AgRP were site-selectively dimerized through a linker molecule, such as a polyether linker modified to contain two aldehyde groups (N,N-((butane-1,4-diylbis(oxy))bis(propane-3,1-diyl))bis(4-formylbenzamide)). The conjugation chemistry is based on the chemoselective reaction of AO groups with aldehydes to form oxime groups. The present invention also relates to oxime-based conjugation of knottin mini-proteins to small molecules, such as drugs or imaging labels. The linker may be any suitable polymeric chain, including polyether, alkyl chain, polypeptide, -peptide, or polypeptoid.
Knottin Mini-Protein Structures
[0068] The present knottin mini-proteins comprise a molecular scaffold portion. They are generally held in a rigid three dimensional conformation by disulfide bonds formed between two cystine residues. Loop portions exist between the cystines.
[0069] Characteristics of a desirable scaffold for protein design and engineering include: 1) high stability in vitro and in vivo, 2) the ability to replace amino acid regions of the scaffold with other sequences without disrupting the overall fold, 3) the ability to create multifunctional or bispecific targeting by engineering separate regions of the molecule, and 4) a small size to allow for chemical synthesis and incorporation of non-natural amino acids if desired. Scaffolds derived from human proteins are favored for therapeutic applications to reduce toxicity or immunogenicity concerns, but are not always a strict requirement. Other scaffolds that have been used for protein design include fibronectin (Koide et al., 1998), lipocalin (Beste et al., 1999), cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) (Hufton et al., 2000), and tendamistat (McConnell and Hoess, 1995; Li et al., 2003). While these scaffolds have proved to be useful frameworks for protein engineering, molecular scaffolds such as knottins have distinct advantages over other molecular scaffolds.
Chemoselective Chemistry
[0070] Chemical strategies frequently used for protein or peptide conjugation rely on amine- or thiol-based reactivity endogenous to the 20 genetically encoded amino acids. However, it is often difficult to produce homogeneous and site-selective conjugation products using these approaches. Multiple reactive amines (Lysine and N-terminal amino groups) are present in proteins and peptides, and redox active cysteines can have unpredictable and undesirable effects on protein folding and stability.
[0071] The present invention exploits the chemoselective formation of an oxime bond between an aldehyde and an aminooxy functional group, neither of which are found in genetically-encoded amino acids..sup.24,27-29 An oxime is formed by condensation of an aminooxy group with either an aldehyde or a ketone, as shown in
##STR00002##
[0072] The above chemistry is exploited in the present invention by providing a knottin with an amino acid having a non-natural side chain. The side chain will have one of the shown groups, so that another moiety (such as a small molecule, monomer peptide, or linker) can be conjugated by means of the side chain. In the examples shown in
[0073] In particular, the aminooxy residue exemplified in the present invention is 2-amino-3-(2-(aminooxy)acetamido)propanoic acid, which has the following structure and is denoted here as residue AO in various sequences described:
##STR00003##
[0074] As shown above, this residue is incorporated into the knottin polypeptide chain using standard methods for Fmoc-based solid phase peptide synthesis.
[0075] As can be seen above, the amino acid side chain may be represented as CH.sub.2NHC()CH.sub.2. The required aminooxy group is bolded and underlined. Various modifications may be employed in the CH.sub.2NHC(O)CH.sub.2 portion of the side chain, and may be represented using the general formula RONH.sub.2, where R is lower alkyl, alkylene, aryl, alkoxy, haloalkyl, haloalkoxy, aralkoxy, alkylsulfanyl, alkylsulfenyl, or alkylsulfonyl.
[0076] The present knottin peptides will generally have about 25-50 amino acid residues and so may be prepared by solid phase peptide synthesis or equivalent methods. See, e.g. Collins Water Soluble Solid Phase Peptide Synthesis, US 2012/0041173, published Feb. 16, 2012.
[0077] Methods of synthesis that allow for the incorporation of non-natural amino acids may be employed, such as described in Shen et al., Umpolumng reactivity in amide and peptide synthesis, Nature 465; 1027-1032 (24 Jun. 2010).
[0078] Using solid phase peptide synthesis (SPPS), a non-natural amino acid with either an aminooxy or an aldehyde group can be incorporated at different knottin sequence positions to allow for a variety of linking sites. Knottin dimers produced through oxime-based chemistry can contain linkers of varying lengths to alter or optimize biological properties. Non-naturals may also be included into the present peptides by mutagenesis, as described, e.g. in Hohsaka et al, Incorporation of non-natural amino acids into proteins, Curr. Opinion in Chemical Biology, 6:809-815 (2002).
[0079] The present non-natural amino acids will contain a side chain that may be coupled to a linker; as such, they may contain a side chain that is aminooxy, aldehyde, ketone, alkyne, alkene, aryl halide diene or azide. Guidance for use of such amino acids may be found in U.S. Pat. No. 6,858,396 to Dix, entitled Positively charged non-natural amino acids, methods of making and using thereof in peptides, issued Feb. 22, 2005; Mao et al. U.S. Pat. No. 8,048,988, issued Nov. 1, 2011, entitled Compositions containing, methods Involving, and uses of non-natural amino acids and peptides. In other embodiments, the present peptides may contain side chains that are aminooxy, aldehyde, ketone, alkyne, azide, alkene, aryl halide, or diene. In other embodiments, the present peptides may contain side chains that are aminooxy, aldehyde, or ketone.
[0080] The side chain used will be selected to be easily reacted with a specific reactive group contained in a linker. The linker will have functional groups on its ends that react with the side chain of each non-natural amino acid used.
[0081] Furthermore, knottins containing non-natural amino acids according to the present invention can be conjugated to a therapeutic molecule for drug delivery. Such small molecules can have an aldehyde or ketone group, or a linker that contains an aldehyde or ketone group, to react with the aminooxy group present within the knottin.
Knottins Prepared as Dimers
[0082] Aminooxy residues were incorporated into two different classes of knottins for oxime-based dimerization: Ecballium elaterium trypsin inhibitor (EETI) and a truncated form of the Agouti-related protein (AgRP). Knottin variants contain an aminooxy residue along with an RGD integrin binding sequence.
[0083] EETI was modified as follows:
TABLE-US-00004 (SEQIDNO:1) GCPRILMR[CKQDSDC*]LAGCV[CGPNGFC**]G.
[0084] The bold and underlined portion is replaced with a binding portion. As illustrated below, an integrin-binding sequence(s) containing the RGD motif is used instead as this portion. Additional loops, identified here as loops 2(*) and 3(**), are shown in brackets. These loops are part of the scaffold portion can also be varied without affecting binding efficiency, as is demonstrated below. AS can be seen, they are delimited by C residues.
[0085] EETI 2.5F was evolved from EETI to have specificity for v3, v5, and 51 integrin with antibody-like affinity..sup.11 In previous studies, a K15S mutation allowed site-specific attachment of molecular imaging probes to the knottin N-terminus.
TABLE-US-00005 EETI2.5F: (SEQIDNO:2) GCP.sub.1R.sub.2P.sub.3RGDN.sub.7P.sub.8P.sub.9L.sub.10T.sub.11CKQDSDCLAGCVCGPNGFCG
[0086] Again, the bolded portion is the binding portion. The following sequences contain a non-natural AO instead of K at position just carboxy to the binding sequence, which is numbered as 1-11.
TABLE-US-00006 EETI2.5F_AO: (SEQIDNO:3) GCPRPRGDNPPLTCXQDSDCLAGCVCGPNGFCG
[0087] Another variant was constructed, based on EETI 2.5D, which binds v3 and v5 integrin:
TABLE-US-00007 EETI2.5D: (SEQIDNO:4) GCPQGRGDWAPTSCKQDSDCRAGCVCGPNGFCG EETI2.5D_AO: (SEQIDNO:5) GCPQGRGDWAPTSCXQDSDCRAGCVCGPNGFCG
[0088] Again, the binding portions are the binding portions. AgRP 7C is a 38-amino acid knottin peptide evolved from a truncated cystine-knot domain of AgRP to have antibody-like affinity for v3 integrin..sup.12 This referenced paper discloses a truncated form of the Agouti-related protein (AgRP), a 4-kDa knottin peptide with four disulfide bonds and four solvent-exposed loops, used as a scaffold to engineer peptides that bound to .sub.v.sub.3 integrins with high affinity and specificity.
Truncated AgRP: GCVRLHESCLGQQVPCCDPAATCYCYCR (SEQ ID NO: 6) . The bolded portion is replaced by the binding portions.
TABLE-US-00008 AgRP7C: (SEQIDNO:7) GCVRLHESCLGQQVPCCDPAATCYCYGRGDNDLRCYCR AgRP7C_AO: (SEQIDNO:8) GCVRLHESCLGQQVPCCDPAATCYCYGRGDNDLRCYCX
[0089] The present peptides can be produced by recombinant DNA methods or by solid phase peptide synthesis, which has been demonstrated for both classes of knottins described here. These peptides can be conjugated through their N-termini to other molecules containing amine-reactive groups, such as fluorescent dyes, radioisotopes, or small molecule drugs. Still further, these peptides may be synthesized with non-natural amino acids that allow for additional crosslinking functionality, such as alkyne or azide groups used in Huisgen cycloaddition (click) chemistry. Crosslinked polystyrene resin containing Rink amide linkers, such as TentaGel S RAM Fmoc resin, (Advanced ChemTech) may be used to give a C-terminal amide upon cleavage. Peptides are cleaved from the resin and side-chains are deprotected with 8% trifluoroacetic acid, 2% triisopropylsilane, 5% dithiothreitol, and the final product is recovered by ether precipitation. Modified amino acids such as B-alanine are used as the N-terminal amino acid to prevent thiazolidone formation and release of fluorescein during peptide deprotection (Hermanson, 1996). Peptides are purified by reverse phase HPLC using an acetonitrile gradient in 0.1% trifluoroacetic acid and a C4 or C18 column (Vydac) and verified using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF) or electrospray ionization-mass spectrometry (ESI-MS).
[0090] The peptides specifically set forth herein may be modified in a number of ways. For example, the peptides may be further crosslinked internally, or may be crosslinked to each other, or the RGD-containing loops may be grafted onto other crosslinked molecular scaffolds. There are a number of commercially-available cross-linking reagents for preparing protein or peptide bioconjugates. Many of these crosslinkers allow dimeric homo- and heteroconjugation of biological molecules through free amine or sulfhydryl groups in protein side chains. More recently, other crosslinking methods involving coupling through carbohydrate groups with hydrazide moieties have been developed. These reagents have offered convenient, facile, crosslinking strategies for researchers with little or no chemistry experience in preparing bioconjugates.
Dimerization/Multimerization and Linkage
[0091] The present knottin monomers are linked to each other and/or to other molecules by means of the incorporation of a reactive residue within the chain of the monomer at a position determined to be on the surface of the folded peptide. The reactive residue contains an aminooxy group pendant to the peptide chain; the aminooxy group provides a basis for an oxime linkage to another molecule, i.e. a linking molecule, group containing an aldehyde or ketone group. The linking molecule has two reactive aldehyde groups for the preparation of a dimer of aminooxy-containing knottins; branched linking molecules may be used for higher order knottin clusters, e.g. trimers, tetramers, pentamers, etc. The linker molecules is chosen to provide a spacer between knottins to allow the engineered binding loop on each knottin to interact with the cognate ligand, e.g. the ability of RGD in a binding loop to bind to v3 integrin on a tumor cell.
[0092] As discussed below, the selection of linker spacing and linker site provided here allows clustering of knottin peptides and a surprising level of binding enhancement of the multimer to the target. A linker as exemplified in
[0093] The AO group of the present knottins may also be used for conjugation to a variety of small molecules, in particular anti-cancer drugs. As discussed below in connection with
EXAMPLES
Example 1: Knottin Monomers
[0094] The aminooxy group was substituted for Lys15 in EETI2.5F and Arg38 in AgRP7C since previous studies demonstrated flexibility of these positions..sup.11,30 See SEQ ID NOs; 3, 5 and 8.
[0095] These knottin monomers were prepared by incorporating the aminooxy residue 2-amino-3-(2-(aminooxy)acetamido)propanoic acid into the polypeptide using solid phase peptide synthesis with an Fmoc-protected version.
Example 2: Dimerization of Knottin Monomers
[0096] Because various lengths of diamine chains were readily available from vendors, the dialdehyde cross-linkers were prepared by conjugating two 4-formyl benzoic acid groups (4FB) to a diamine chain (
[0097] The compound 2 was purified with reverse phase HPLC (RP-HPLC) in 76% yield and conjugated to knottins containing an aminooxy residue (3) in phosphate buffer at 25 C. (
TABLE-US-00009 TABLE 1 Characteristics of knottin monomers and dimers RP-HPLC.sup.a ESI-MS.sup.b Peptide R.sub.t (min) [M + H].sup.+.sub.calc [M + H].sup.+.sub.exp Dialdehyde 33.2 469.5 469.3 linker EETI 2.5F_AO 17.6 3365.6 3365.4 EETI 2.5F- 23.9 7162.7 7160.4 Dimer AgRP 7C_AO 18.5 4225.8 4226.3 AgRP 7C 22.3 8883.1 8883.0 Dimer FNRDG_AO 18.4 3178.3 3177.8 FNRDG-Dimer 23.9 6789.1 6788.0 .sup.aThe gradient used for RP-HPLC is 10-60% solvent B (90% acetonitrile/10% water/0.1% trifluoroacetic acid) over 38 min. .sup.bMolecular masses were determined by electrospray ionization mass spectrometry (ESI-MS).
Example 3: Competition Binding Assay
[0098] Competition binding assays were performed to measure the relative binding affinities of engineered knottins to U87MG cells expressing v3, v5, and 51 integrins (
[0099] As shown by the IC.sub.50 values, the apparent binding binding affinities of EETI2.5F and AgRP7C dimers increased by approximately 46- and 4-fold compared to the monomers, respectively (Table 2).
TABLE-US-00010 TABLE 2 U87MG cell binding and adhesion data Ligand Binding IC.sub.50 (nM) Adhesion EC.sub.50 (nM) EETI 2.5F 1.64 0.03 180 14 EETI 1.57 0.05 N.D. 2.5F_AO EETI 2.5F 0.036 0.002 8 2 Dimer AgRP7 C 13 1 N.D. AgRP 7C 3.2 0.6 N.D. Dimer FNRDG_AO () () FNRDG () () Dimer
IC.sub.50 values from competition binding assays (
The scrambled EETI FNRDG monomer and dimer showed negligible binding, indicating that the binding observed is due to the specific interaction between the knottins and the integrins.
Example 4: Inhibition of Integrin-Dependent Cell Adhesion
[0100] Since the EETI 2.5F dimer showed remarkable improvement in integrin binding strength we analyzed its ability to block interaction between U87MG cells and fibronectin through a cell adhesion assay (
[0101] Varying concentrations of peptides were added to 410.sup.4 cells in 100 l of IBB, incubated for 1 h at 37 C., 5% CO.sub.2, and gently washed with Dulbecco's PBS (DPBS, Invitrogen). Remaining adherent cells were incubated with 100 l of 0.2% crystal violet and 10% ethanol for 10 min at room temperature, washed in DPBS and solubilized with 100 l/well of a 50:50 mixture of 100 mM sodium phosphate, pH 4.5 and ethanol for 10 min. The absorbance at 600 nm was measured using Synergy HT microplate reader (BioTek).
[0102] Both EETI 2.5F monomer and dimer were able to inhibit U87MG cell adhesion to fibronectin-coated plates in a dose-dependent manner. As shown by the IC.sub.50 values, EETI 2.5F dimer was 100-fold more effective in preventing U87MG cell adhesion compared to the monomer, while the scrambled FNRDG monomer and dimer controls were not able to inhibit cell adhesion (Table 2). When incubated in the presence of 500 nM of EETI 2.5F monomer and dimer for 24 h in DMEM media with 4% FBS, U87MG cells exhibited a rounded morphology (
Example 5: Cytotoxicity of EETI 2.5F Monomer and Dimer with U87MG Cells
[0103] To demonstrate the cytotoxicity of the EETI 2.5F monomer and dimer, U87MG cells were incubated in medium containing 4% FBS with 1 M of the knottins on fibronectin coated plates, and the cell viability was determined after 24, 48, and 72 hours of treatment using AlamarBlue indicator reagent (Invitrogen).
[0104] Both EETI 2.5F monomer and dimer inhibited U87MG cell proliferation in time-dependent manner, with the dimer exhibiting significantly higher potency (
Example 6: Conjugation of Drugs for Targeted Delivery
[0105] In this example, a knottin containing an aminooxy residue is added to a mixture containing a therapeutic molecule, such as doxorubicin. Mixed with PBS at 25 C., the ketone group on the therapeutic molecule doxorubicin interacts with the aminooxy group of the non-natural amino acid on the knottin peptide, producing the conjugate (
[0106] Conjugating a therapeutic small molecule to the knottin peptide provides an effective means for targeted drug delivery. Doxorubicin is used in cancer chemotherapy and interacts with DNA. Its ketone group can react with the aminooxy group of the knottin peptide monomer. Additionally, the knottins are able to traverse the vasculature, allowing delivery of the therapeutic agent to brain tumors.
[0107] EETI 2.5D and EETI 2.5F were conjugated with doxorubicin in this manner. The conjugate was purified using reverse phase HPLC with a 0.1% formic acid in acetonitrile gradient over 20 minutes. The conjugate elutes at 7.33 minutes (data not shown). The resulting purified conjugate was further verified using electrospray ionization-mass spectrosometry (ESI-MS).
Example 7: Exemplary Peptide Modifications
[0108] The above-exemplified knottin sequences may be varied to produce other knottins for multimerizatioin that have substantial identity to those disclosed. The knottin sequences of the present invention, as described above, have (i) a scaffold portion, (ii) a binding loop portion, and (iii) an aminooxy (AO) residue or other non-natural amino acid. The non-natural amino acid is advantageously placed adjacent to a binding loop; however, in certain embodiments it may be placed at a terminus. The AO was placed at the C-terminus of AgRP.
[0109] The scaffold portion provides the structural framework and is made rigid by disulfide binds between the cystine residues underlined in the exemplary sequence by the engineered EETI-11, 2.5F_AO:
G.sub.1C.sub.2P.sub.3R.sub.4P.sub.5R.sub.6G.sub.7D.sub.8N.sub.9P.sub.10P.sub.11L.sub.12T.sub.13C.sub.14X.sub.15Q.sub.16D.sub.17S.sub.18D.sub.19C.sub.20L.sub.21A.sub.22G.sub.23C.sub.24V.sub.25C.sub.26G.sub.27P.sub.28N.sub.29G.sub.30G.sub.31C.sub.32G.sub.33 (SEQ ID NO: 3). One may introduce other residues in the scaffold portion of the peptide. The scaffold portion is residues G1, C2 and C14 to the carboxy end. The binding loop, as described above, is residues P3-C14. The underlined cysteine residues should be maintained in order to preserve the three dimensional structure. The remainder of the scaffold can be varied by conservative substitutions, e.g 2-3 amino acid substitutions. For example, in GCP-RPRGDNPPLT-CXQDSDCLAGCVCPNGFCG (SEQ ID NO: 3) wherein the italicized L21, A22, V25 and G30 residues may instead be another amino acid which is A, G, L, S, T, or V. Similarly, the binding loop may be modified with 1 amino acid substitution, 2 amino acid substitutions, or three amino acid substitutions. For example, R4 could be H or L. The binding core of RGD (residues 6-8) should not be varied.
[0110] As to the binding loop (bolded in SEQ ID NO: 3), the RGD sequence should be invariant, as stated previously. The other positions may be substituted as taught in Cochran et al. US 20090257952, Engineered Integrin Binding Peptides, published Oct. 15, 2009. As stated there, the RGD-containing loop may be varied from the specific sequences disclosed. For example the loop sequence of EETI 2.5F, shown between P and C may be varied by 8 of the amino acids, but are invariant as to the RGD sequence. The other residues can be varied to a certain degree without affecting binding specificity and potency. For example, if three of the eleven residues were varied, one would have about 70% identity to 2.5F. For guidance in selecting which residues to vary, histograms in FIG. 11 (of the previously cited 20090257952) presents information on likely residues for each position. For example, in position 3 (the first X), one would most likely use a proline residue, based on isolated mutants that had positive integrin binding. However, His or Leu are also possible choices, as shown by their higher incidence in mutants with good integrin binding properties.
[0111] In specific, the present engineered knotttin peptides may be dimers that contain integrin binding portions, and the peptide comprising (i) a binding sequence specific to bind to at least one of v5 integrin, v3 integrin and 51 integrin, and (ii) a knottin protein scaffold, said binding sequence being comprised in said knottin protein scaffold and being an 11 amino acid engineered integrin binding loop, 11 amino acids long comprising the sequence RGD, wherein said RGD is in the sequence between residues 3 and 7 in an 11 residue binding loop; (iii), and said knottin protein scaffold, except for the engineered integrin binding loop, being substantially identical to one of: EETI-II, AgRP, mini-AGRP, agatoxin or miniagatoxin, wherein, when the knottin protein scaffold is substantially identical to EETI-II, said integrin binding peptide has a sequence at least 90% identical having three or fewer amino acid substitutions to a peptide.
[0112] The present peptides contain at least one non-natural amino acid, in particular an amino acid residue with a side chain comprising an aminooxy, NC(O)CH2ONH2.
[0113] The present knottin may contain a binding loop portion between the 11 residues loop, said binding loop being within a scaffold portion, wherein said scaffold portion may have up to two amino acid substitutions so as to be at least 90% identical to SEQ ID NO: 3, SEQ NO: 5. Residue P1s in the binding loop above, (See SEQ NO: 2) can be selected from the group consisting of A, V, L, P, F, Y, S, H, D, and N; R.sub.2 is selected from the group consisting of G, V, L, P, R, E, and Q; P.sub.3 is selected from the group consisting of G, A, and P; N.sub.7 is selected from the group consisting of W and N; P.sub.8 is selected from the group consisting of A, P, and S; P.sub.9 is selected from the group consisting of P and R; L.sub.10 is selected from the group consisting of A, V, L, P, S, T, and E; and T.sub.11 is selected from the group consisting of G, A, W, S, T, K, and E.
Variants and AgRp Mini Peptide
[0114]
TABLE-US-00011 (SEQIDNO:8) GCVRLHESCLGQQVPCCDPAATCYCY.sub.1G.sub.2RGDN.sub.6D.sub.7L.sub.8R.sub.9CYCX
may be made, for example as follows, with respect to the binding loop (bolded above):
Y.SUB.1 .may be F, W or H
G.SUB.2 .may be A, S or V
N.SUB.6 .may be D, Y
D.SUB.7 .may be N or Y
L.SUB.8 .may be I, V, or F, and
[0115] R.sub.9 may be K or N. The aminooxy (AO) residue is as illustrated above. In this embodiment, the AO non-natural amino acid is positioned at the carboxy terminus of the peptide.
[0116] As to the scaffold portion of the peptide (un-bolded) two to three amino acids may be substituted. This is shown for the following examples:
TABLE-US-00012 (SEQIDNO:9) GCVRLHE VCLGQQVPCCDPAATCYCY.sub.1G.sub.2RGDN.sub.6D.sub.7L.sub.8R.sub.9CYCX, (SEQIDNO:11) GCVRLHESCLGQQVPCCDPA
GTCYCY.sub.1G.sub.2RGDN.sub.6D.sub.7L.sub.8R.sub.9CYCX, (SEQIDNO:12) GCVRLHESCLGQQVPCC
EPAATCYCY.sub.1G.sub.2RGDN.sub.6D.sub.7L.sub.8R.sub.9CYCX,
and so forth.
Variations of EETI-II
[0117] As further examples, one may vary the location of the non-natural amino acid. EETI-II 2.5F_AO has the AO (shown as X) in place of the lysine at position 15: GCQDSDCLAGCVCGPNGFCG (SEQ ID NO: 3). In other words, As before, the binding loop is bolded. EETI 2.5F_AO may be shown by residue number as follows:
TABLE-US-00013 (SEQIDNO:3) G.sub.1C.sub.2P.sub.3R.sub.4P.sub.5R.sub.6G.sub.7D.sub.8N.sub.9P.sub.10P.sub.11L.sub.12T.sub.13C.sub.14X.sub.15Q.sub.16D.sub.17S.sub.18D.sub.19C.sub.20L.sub.21A.sub.22G.sub.23C.sub.24 V.sub.25C.sub.26G.sub.27P.sub.28N.sub.29G.sub.30F.sub.31C.sub.32G.sub.33.
[0118] EETI 2.5F_AO-2 is GCCQDSDCLAGCVCGPNGFCGX (SEQ ID NO: 13). This exemplified addition of the AO (shown as X) to the carboxyl terminal end, i.e. following residue 33.
[0119] Using the above numbering, one may see that the AO residue or other non-natural amino acid may be used, for example in place of any one of residues AO15-G23, residues G27-F31, or other loops. Another variant was constructed, based on EETI 2.5D, which binds v3 and v5 integrin:
TABLE-US-00014 EETI2.5D (SEQIDNO:4) GCPQGRGDWAPTSCKQDSDCRAGCVCGPNGFCG EETI2.5D_AO (SEQIDNO:5) GCPQGRGDWAPTSCXQDSDCRAGCVCGPNGFCG,
X=AO.
[0120] EETI 2.5D_AO has the same numbering as the EETI2.5F_AO, although the sequence is different; the AO residue is at position 15, as in EETI 2.5F-AO. Variations in sequences may be made as described in connection with sequence EETI 2.5F.
Example 8: Comparison of EETI 2.5F Knottin Monomer and Dimer to Cilengitide
[0121] As is known, Cilengitide is a molecule designed and synthesized at the Technical University Munich in collaboration with Merck KGaA in Darmstadt. It is based on the cyclic peptide cyclo(-RGDfV-), which is selective for v integrins, which are important in angiogenesis (forming new blood vessels). Hence, it is under investigation for the treatment of glioblastoma by inhibiting angiogenesis. The European Medicines Agency has granted cilengitide orphan drug status.
[0122] Relative U87MG binding affinity, and inhibition of U87MG cell adhesion and proliferation was measured for the EETI 2.5F dimer, EETI 2.5F monomer, and Cilengitide as described in Examples 3, 4, and 5. The relative binding affinity (IC.sub.50) of Cilengitide to U87MG cells (using 0.25 nM of Alexa488-labeled EETI 2.5F as the competitor) was 412 nM compared to 1.640.03 nM for the EETI 2.5F monomer and 0.0360.002 nM for the EETI 2.5F dimer (
Example 9: Pharmaceutical Compositions
[0123] The present engineered knottins may be used for imaging or for therapeutic purposes, as demonstrated above. The present peptides may also be formulated as pharmaceutical compositions for use in vivo in humans. Suitable formulations may be derived by reference to U.S. Pat. No. 7,262,165, entitled Aqueous preparation containing oligopeptides and etherified cyclodextrin, issued Aug. 28, 2007. Briefly, as described there, the knottin to be used will be soluble in water or a suitable buffer such as physiological saline. Based on this solubility, a concentration of knottin peptide in the solution of the pharmaceutical composition may be determined. For example, if the peptide has a saturation solubility in physiological saline solution of about 19 mg/ml and it can therefore, for therapeutic use, be safely administered parenterally in a concentration of 15 mg/ml dissolved in physiological saline solution. If, for example, a dose of 1500 mg is necessary for therapy with the peptide, a volume to be administered of 100 ml arises. Volumes in this order of magnitude can no longer simply be injected and must be infused, which is disadvantageous. Pharmaceutically acceptable ingredients may be added to increase solubility or tolerance for injection. The present peptides may also be formulated in enteric form (see e.g. U.S. Pat. No. 5,350,741). Other formulations which may be employed are in Remington: The Science and Practice of Pharmacy, 19th Edition (1995) and/or Handbook of pharmaceutical granulation technology, chapter 7, Drugs and the pharmaceutical sciences, vol. 81, 1997. In further embodiments of the present compositions, carriers are selected from hydrophilic binders, water-soluble diluents, surfactants, detergents, lubricants, disintegrants, antioxidants, non water-soluble diluents and/or other fillers known to the skilled person. In a particular embodiment the one or more carriers comprises at least a hydrophilic binder and a water-soluble diluent. Lyophilzed formulations may be prepared as described in U.S. Pat. No. 7,265,092, Pharmaceutical compositions, issued Sep. 4, 2007, to Li. as described there, various excipients and anti-aggregants may be used.
[0124] Parenteral administration is generally characterized by injection, either subcutaneously, intramuscularly, intraperitoneal, intravenously, and in the case of the present invention via intra-tumor injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid (e.g., dried or lyophilized) forms suitable for reconstitution into solution or suspension in liquid prior to injection, or as emulsions. Generally, suitable excipients include, for example, water, saline, dextrose, glycerol, ethanol or the like. In addition, minor amounts of non-toxic auxiliary substances can be employed, such as wetting or emulsifying agents, pH buffering agents, solubility enhancers, tonicifiers and the like including, for example, sodium acetate, sorbitan monolaurate, triethanolamine oleate, cyclodextrins, etc. Dosage forms for intravenous (IV) administration generally comprise an active peptide agent incorporated into a sterile solution of simple chemicals such as sugars, amino acids or electrolytes, which can be easily carried by the circulatory system and assimilated. Such solutions are typically prepared with saline or buffer. The pH of such IV fluids may vary, and will typically be from 3.5 to 8.0, as known in the art.
Example 10: Cell Inhibition of Proliferation with Dimer Knottins
[0125] Dimers of the present knottins with AO groups incorporated at different positions were prepared and conjugated with different linkages. There were tested for activity against carcinoma lines. Results are shown below in Table 3. As identified there, Dimer 1 is EETI 2.5F where the AO group was incorporated in place of Lys15, conjugated through the 17.3 Angstrom linker shown in
TABLE-US-00015 TABLE 3 Apoptosis Proliferation (Caspase-3) Cell line: MDA231 (Human breast adenocarcinoma) Cilengitide Weak inhibition Moderate induction 2.5F Monomer Weak inhibition Moderate induction 2.5F Dimer1 Strong inhibition Strong induction 2.5F Dimer2 Strong inhibition N/A 2.5F Dimer3 Moderate N/A inhibition 2.5F Dimer4 Moderate N/A inhibition Cell line: SKOV 3 (Ovarian adenocarcinoma) Cilengitide N/A N/A 2.5F Monomer N/A N/A 2.5F Dimer1 Strong inhibition N/A 2.5F Dimer2 Strong inhibition N/A 2.5F Dimer3 N/A N/A 2.5F Dimer4 N/A N/A
The results above indicate that EETI 2.5F Dimers 1 and 2 more strongly inhibited tumor cell proliferation compared to Dimers 3 and 4, demonstrating that the location of the AO group within the knottin mattered (position 15 versus C-terminus), but the crosslinker length did not (17.3 versus 68.5 angstroms). All dimers, however, were more potent at inhibiting tumor cell proliferation compared to EETI 2.5F monomer and Cilengitide.
Example 11: Additional Linkages
[0126] As described above, the present dimers are constructed of two engineered knottin peptides (e.g. EET-II and AgRP), where the peptides contain a binding loop, and, in the scaffold portion, at least one non-natural amino residue. The non-natural amino residue has a side chain that can bond to a linkage molecule. By example, the non-natural amino acid contains an aminooxy functional group. The linker molecule contains functional groups in their terminal portions. Each linker molecule can bond to two different engineered peptides. For example, the linker molecules are terminated with aldehyde groups. Alternative, the linker molecules can carry more than two functional groups, to form multimers of 3, 4, 5, or more, engineered knottins.
[0127]
CONCLUSION
[0128] The above specific description is meant to exemplify and illustrate the invention and should not be seen as limiting the scope of the invention, which is defined by the literal and equivalent scope of the appended claims. Any patents or publications mentioned in this specification, including the below cited references are indicative of levels of those skilled in the art to which the patent pertains and are intended to convey details of the invention which may not be explicitly set out but which would be understood by workers in the field. Such patents or publications are hereby incorporated by reference to the same extent as if each was specifically and individually incorporated by reference, as needed for the purpose of describing and enabling the methods and materials.
REFERENCES
[0129] 1. Mbeunkui, F.; Johann, D. J., Jr. Cancer Chemother Pharmacol 2009, 63, 571. [0130] 2. Grassian, A. R.; Coloff, J. L.; Brugge, J. S. Cold Spring Harb Symp Quant Biol 2011, 76, 313. [0131] 3. Tredan, O.; Galmarini, C. M.; Patel, K.; Tannock, I. F. J Natl Cancer Inst 2007, 99, 1441. [0132] 4. Miranti, C. K.; Brugge, J. S. Nat Cell Biol 2002, 4, E83. [0133] 5. Desgrosellier, J. S.; Cheresh, D. A. Nat Rev Cancer 2010, 10, 9. [0134] 6. Brooks, P. C.; Clark, R. A.; Cheresh, D. A. Science 1994, 264, 569. [0135] 7. Kim, S.; Bell, K.; Mousa, S. A.; Varner, J. A. Am J Pathol 2000, 156, 1345. [0136] 8. Mizejewski, G. J. Proc Soc Exp Biol Med 1999, 222, 124. [0137] 9. Stupack, D. G.; Cheresh, D. A. Curr Top Dev Biol 2004, 64, 207. [0138] 10. Haas, T. A.; Plow, E. F. Curr Opin Cell Biol 1994, 6, 656. [0139] 11. Kimura, R. H.; Levin, A. M.; Cochran, F. V.; Cochran, J. R. Proteins 2009, 77, 359. [0140] 12. Silverman, A. P.; Levin, A. M.; Lahti, J. L.; Cochran, J. R. J Mol Biol 2009, 385, 1064. [0141] 13. Pallaghy, P. K.; Nielsen, K. J.; Craik, D. J.; Norton, R. S. Protein Sci 1994, 3, 1833. [0142] 14. Werle, M.; Schmitz, T.; Huang, H. L.; Wentzel, A.; Kolmar, H.; Bernkop-Schnurch, A. J Drug Target 2006, 14, 137. [0143] 15. Chiche, L.; Heitz, A.; Gelly, J. C.; Gracy, J.; Chau, P. T.; Ha, P. T.; Hernandez, J. F.; Le-Nguyen, D. Curr Protein Pept Sci 2004, 5, 341. [0144] 16. Craik, D. J.; Daly, N. L.; Waine, C. Toxicon 2001, 39, 43. [0145] 17. Mecca, T.; Consoli, G. M. L.; Geraci, C.; Cunsolo, F. Bioorgan Med Chem 2004, 12, 5057. [0146] 18. Jain, R. K.; Hamilton, A. D. Org Lett 2000, 2, 1721. [0147] 19. Kitov, P. I.; Lipinski, T.; Paszkiewicz, E.; Solomon, D.; Sadowska, J. M.; Grant, G. A.; Mulvey, G. L.; Kitova, E. N.; Klassen, J. S.; Armstrong, G. D.; Bundle, D. R. Angew Chem Int Edit 2008, 47, 672. [0148] 20. Garanger, E.; Boturyn, D.; Coll, J. L.; Favrot, M. C.; Dumy, P. Org Biomol Chem 2006, 4, 1958. [0149] 21. Kok, R. J.; Schraa, A. J.; Bos, E. J.; Moorlag, H. E.; Asgeirsdottir, S. A.; Everts, M.; Meijer, D. K.; Molema, G. Bioconjug Chem 2002, 13, 128. [0150] 22. Hersel, U.; Dahmen, C.; Kessler, H. Biomaterials 2003, 24, 4385. [0151] 23. Hu, B.; Finsinger, D.; Peter, K.; Guttenberg, Z.; Barmann, M.; Kessler, H.; Escherich, A.; Moroder, L.; Bohm, J.; Baumeister, W.; Sui, S. F.; Sackmann, E. Biochemistry 2000, 39, 12284. [0152] 24. Thumshirn, G.; Hersel, U.; Goodman, S. L.; Kessler, H. Chemistry 2003, 9, 2717. [0153] 25. Kantlehner, M.; Finsinger, D.; Meyer, J.; Schaffner, P.; Jonczyk, A.; Diefenbach, B.; Nies, B.; Kessler, H. Angew Chem Int Edit 1999, 38, 560. [0154] 26. Oliveira-Ferrer, L.; Hauschild, J.; Fiedler, W.; Bokemeyer, C.; Nippgen, J.; Celik, I.; Schuch, G. J Exp Clin Canc Res 2008, 27. [0155] 27. Rose, K. J Am Chem Soc 1994, 116, 30. [0156] 28. Shao, J.; Tam, J. P. J Am Chem Soc 1995, 117, 3893. [0157] 29. Canne, L. E.; Ferredamare, A. R.; Burley, S. K.; Kent, S. B. H. J Am Chem Soc 1995, 117, 2998. [0158] 30. Krause, S.; Schmoldt, H. U.; Wentzel, A.; Ballmaier, M.; Friedrich, K.; Kolmar, H. Febs J 2007, 274, 86. [0159] 31. Aguzzi, M. S.; Giampietri, C.; De Marchis, F.; Padula, F.; Gaeta, R.; Ragone, G.; Capogrossi, M. C.; Facchiano, A. Blood 2004, 103, 4180. [0160] 32. Abdollahi, A.; Griggs, D. W.; Zieher, H.; Roth, A.; Lipson, K. E.; Saffrich, R.; Grone, H. J.; Hallahan, D. E.; Reisfeld, R. A.; Debus, J.; Niethammerl, A. G.; Huber, P. E. Clinical Cancer Research 2005, 11, 6270. [0161] 33. Buckley, C. D.; Pilling, D.; Henriquez, N. V.; Parsonage, G.; Threlfall, K.; Scheel-Toellner, D.; Simmons, D. L.; Albar, A. N.; Lord, J. M.; Salmon, M. Nature 1999, 397, 534.