ANTI-HSV GB MONOCLONAL ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF

20200239549 ยท 2020-07-30

    Inventors

    Cpc classification

    International classification

    Abstract

    An anti-HSV monoclonal antibody or an antigen-binding fragment thereof is an anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof that specifically binds to herpes simplex virus (HSV) envelope glycoprotein B (gB), comprising: a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 3, a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 5; and a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 6, a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 7, and a light chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 8.

    Claims

    1. An anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof that specifically binds to herpes simplex virus (HSV) envelope glycoprotein B (gB), comprising: a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 3, a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 5; and a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 6, a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 7, and a light chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 8.

    2. The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to claim 1, comprising: a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2.

    3. The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to claim 1, wherein the HSV is HSV-1 or HSV-2.

    4. A polynucleotide encoding the anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to claim 1.

    5. An expression vector comprising the polynucleotide according to claim 4 and one or more regulatory sequences operably linked to the polynucleotide.

    6. A transformant comprising the expression vector according to claim 5 introduced therein.

    7. A method for producing an anti-HSV gB monoclonal antibody or antigen-binding fragment thereof using the polynucleotide according to claim 4, wherein the anti-HSV gB monoclonal antibody or the antigen-binding fragment thereof specifically binds to herpes simplex virus (HSV) envelope glycoprotein B (qB), comprising: a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 3, a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 5; and a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 6, a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 7, and a light chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 8.

    8. A pharmaceutical composition for preventing or treating HSV infection, comprising the anti-HSV gB monoclonal antibody or antigen-binding fragment according to claim 1.

    9. The pharmaceutical composition according to claim 8, wherein the HSV infection is HSV-1 infection or HSV-2 infection.

    10. The pharmaceutical composition according to claim 8, wherein the HSV infection is selected from the group consisting of herpes labialis, herpetic keratitis, genital herpes, systemic neonatal herpes, and stomatitis, dermatosis, encephalitis, meningitis, and myelitis caused by HSV.

    11. An anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof that specifically binds to at least one amino acid residue in the region consisting of the amino acid residues 383-388 of the herpes simplex virus-1 (HSV-1) envelope glycoprotein B (gB) set forth in SEQ ID NO: 10, and/or at least one amino acid residue in the region consisting of the amino acid residues 386-391 of the herpes simplex virus-2 (HSV-2) envelope glycoprotein B (gB) set forth in SEQ ID NO: 11.

    12. The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to claim 11, comprising: a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 3, a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 5; and a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 6, a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 7, and a light chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 8.

    13. The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to claim 12, comprising: a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2.

    14. A polynucleotide encoding the anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to claim 11.

    15. An expression vector comprising the polynucleotide according to claim 14 and one or more regulatory sequences operably linked to the polynucleotide.

    Description

    BRIEF DESCRIPTION OF DRAWINGS

    [0025] FIG. 1 is a figure illustrating the result of the reactivity analysis of an anti-HSV gB antibody (Fab) by the ELISA of Example 2.

    [0026] FIG. 2 is a figure illustrating the result of the reactivity analysis of an anti-HSV gB antibody (human-murine chimeric IgG2a) by the ELISA of Example 2.

    [0027] FIG. 3 is a figure illustrating the result of the reactivity analysis of anti-HSV gB antibodies by immunoblotting of Example 3.

    [0028] FIG. 4 is a figure illustrating the result of the epitope analysis by the hydrogen-deuterium exchange mass spectrometry (HDX-MS) of Example 6.

    [0029] FIG. 5 is a figure illustrating the result of comparison of survival rates in a mouse infection-prevention test with antibodies D48, F67, and E31 of Example 8.

    [0030] FIG. 6 is a figure illustrating the result of survival rates from the preventive administration to mice of antibody D48 of Example 8.

    [0031] FIG. 7 is a figure illustrating the result of symptom scores after the preventive administration to mice of antibody D48 of Example 8.

    [0032] FIG. 8 is a figure illustrating the result of survival rates after the therapeutic administration to mice of antibody D48 of Example 8.

    [0033] FIG. 9 is a figure illustrating the result of symptom scores after the therapeutic administration to mice of antibody D48 of Example 8.

    [0034] FIG. 10 is a figure illustrating the result of symptom scores after the preventive administration to mice of antibody D48 of Example 9.

    [0035] FIG. 11 is a figure illustrating the result of symptom scores after the therapeutic administration to guinea pigs of antibody D48 of Example 9.

    [0036] FIG. 12 is a figure illustrating the result of amounts of HSV released in a vaginal swab after the therapeutic administration to guinea pigs of antibody D48 of Example 9.

    [0037] FIG. 13 is a figure illustrating the result of comparison by multiple alignment of an amino acid sequence (SEQ ID NO: 10) of gB derived from HSV-1 and an amino acid sequence (SEQ ID NO: 11) of gB derived from HSV-2, and the italic letters represent the leader sequence and the underlined letters represent amino acid residues 383-388 (I383-R388) in domain II of gB derived from HSV-1 and the amino acid residues 386-391 in domain II of gB derived from HSV-2.

    DESCRIPTION OF EMBODIMENTS

    [0038] Modes for carrying out the present invention will be described in detail below. The present invention is not limited to the following embodiments.

    [0039] The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to the present invention specifically binds to herpes simplex virus (HSV) envelope glycoprotein B (gB). The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to the present invention comprises a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 3, a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 5, and a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 6, a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 7, and a light chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 8.

    [0040] The present inventors obtained 44 anti-gB antibodies by comprehensive search of anti-HSV-2 gB antibodies conducted by using a human antibody library. As a result of examining those antibodies in a virus neutralization test, monoclonal antibody D48 exhibited strong plaque number-reducing activity and cell to cell infection spread-suppression activity.

    [0041] Antibody D48 has a heavy chain variable region (VH) having the amino acid sequence set forth in SEQ ID NO: 1 and a light chain variable region (VL) having the amino acid sequence set forth in SEQ ID NO: 2 and a heavy chain variable region comprising a heavy chain CDR1, a heavy chain CDR2, and a heavy chain CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 3-5 and a light chain variable region comprising a light chain CDR1, a light chain CDR2, and a light chain CDR3 consisting of amino acid sequences set forth in SEQ ID NOs: 6-8, shown in Table 1.

    TABLE-US-00001 TABLE1 VHandVLaminoacidsequencesofantibodyD48andCDRsthereof SEQID Region Aminoacidsequence NO. VH EVQLVETGGGVVRPGRSLRLSCTTSGFSFSGSAMHWVRQAPG 1 KGLEWVAVISHDGNIIQYHDSVKGRFTISRDNSKNVLLLQMNSLR VDDTAMYYCARDVWLLPATISYAFDFWGQGTMVTVSS VL VIWMTQSPPSLSASIGDTVTITCRASQGISNSIAWYQRRPGKAPE 2 LLVYAAYRLQSGVPSRLSGSGSGAEYTLTIKNMQPEDFATYYC QQYYDNPLTFGGGTKVEIK VH CDR1 SGSAMH 3 CDR2 VISHDGNIIQYHDSVKG 4 CDR3 DVWLLPATISYAFDF 5 VL CDR1 RASQGISNSIA 6 GDR2 AAYRLQS 7 CDR3 QQYYDNPLT 8

    [0042] Since the anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to the present invention comprises CDR sequences of monoclonal antibody D48, it has strong virus-neutralizing activity (plaque number-reducing activity) to HSV-1 and HSV-2, as well as strong cell to cell infection spread (intercellular transmission)-suppression activity.

    [0043] The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof may comprise a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2.

    [0044] The anti-HSV gB monoclonal antibody is an antibody comprising at least a heavy chain variable domain and a light chain variable domain and may be a complete antibody. The complete antibody has 2 full length light chains and 2 full length heavy chains and the light chains and respective heavy chains are linked by disulfide bonds. The complete antibody includes IgA, IgD, IgE, IgM, and IgG, and IgG includes IgG.sub.1, IgG.sub.2, IgG.sub.3, and IgG.sub.4 as subtypes.

    [0045] The antigen-binding fragment is also referred to as the antibody fragment and means a fragment with the function of binding to antigens (antigen-binding fragment). The antigen-binding fragment includes, for example, single chain variable region fragment (scFv), Fab, Fab, F(ab).sub.2, scAb, scFvFc, and Fv. Fab has one antigen-binding site as a structure having light chain and heavy chain variable regions and a light chain invariable region and the first heavy chain invariable region (CH1 domain). Fab is different from Fab in that it has a hinge region containing at least a cysteine residue at the C terminus of the heavy chain CH1 domain. The F(ab).sub.2 antibody is produced by a disulfide bond between cysteine residues of the hinge region of Fab. Fv (variable fragment) means the minimum antigen-binding fragment having only a heavy chain variable site and a light chain variable site. Double-stranded Fv (dsFv) has a heavy chain variable site linked with a light chain variable site by a disulfide bond and single chain Fv (scFv) has a heavy chain variable region linked with a light chain variable region by a covalent bond usually through a peptide linker. scAb is a fragment in which a partial domain (C domain) in an L-chain or H chain constant region is bound to scFv. scFvFc is a fragment in which CH1 and CH2 of the H chain are linked to scFv.

    [0046] The antigen-binding fragment can be obtained, for example, from a complete antibody using a proteolytic enzyme. For example, the Fab fragment can be obtained by digesting a complete antibody with papain and the F(ab).sub.2 fragment can be obtained by digesting a complete antibody with pepsin. Moreover, the antigen-binding fragment can be produced using a gene recombination technique. The light chain and heavy chain variable regions contain 3 highly variable regions called complementarity-determining regions (hereinafter, referred to as CDRs). The CDRs mainly serve to bind to antigenic epitopes. The 3 CDRs are respectively called CDR1, CDR2, CDR3 in the order from the N-terminus.

    [0047] The anti-HSV gB monoclonal antibody may be a human antibody (fully human antibody), a humanized antibody, or a chimeric antibody and is preferably a human monoclonal antibody or a humanized monoclonal antibody, in particular.

    [0048] The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to this embodiment specifically binds to herpes simplex virus (HSV) envelope glycoprotein B (gB). HSV gB includes gB derived from HSV-1 and gB derived from HSV-2 and FIG. 13 illustrates the result of comparison by multiple alignment of an amino acid sequence (SEQ ID NO: 10) of gB derived from HSV-1 and an amino acid sequence (SEQ ID NO: 11) of gB derived from HSV-2. According to FIG. 13, the identity between both sequences is 87%. The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to this embodiment specifically binds to either of gB derived from HSV-1 and gB derived from HSV-2, particularly to domain II of gB and more particularly to I383-R388 of domain II of gB derived from HSV-1 or at least 1, at least 2, or furthermore at least 3 amino acid residues in the region corresponding to I386-R391 of domain II of gB derived from HSV-2.

    [0049] The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to this embodiment is considered to have the following 2 merits over existing antiviral drugs: (1) few side effects and (2) low risk of emergence of a resistant viral strain. As for the latter in particular, the emergence of HSV resistance that would be caused by a mutation in the epitope sequence in the gB protein is considered to be unlikely because the anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to this embodiment is an antibody that specifically binds to an epitope sequence on the HSV-1 and HSV-2 envelope surface glycoprotein B (gB) indispensable for the virus replication cycle and therefore it is considered that such a mutation itself should cause the loss of virus infectivity titer.

    [0050] The anti-HSV gB monoclonal antibody or antigen-binding fragment thereof according to another embodiment of the present invention specifically binds to at least one amino acid residue in the region consisting of the amino acid residues 383-388 of the herpes simplex virus-1 (HSV-1) envelope glycoprotein B (gB) set forth in SEQ ID NO: 10, and/or at least one amino acid residue in the region consisting of the amino acid residues 386-391 of the herpes simplex virus-2 (HSV-2) envelope glycoprotein B (gB) set forth in SEQ ID NO: 11. Examples of the anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof include those comprising a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 3, a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 5, and a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 6, a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 7, and a light chain CDR3 consisting of the amino acid sequence set forth in SEQ ID NO: 8.

    [0051] As other embodiments, a polynucleotide encoding the monoclonal antibody or antigen-binding fragment thereof, an expression vector comprising the polynucleotide and one or more regulatory sequences operably linked to the polynucleotide, and a transformant comprising the expression vector are provided.

    [0052] The polynucleotide may be a polynucleotide encoding a complete antibody and may be polynucleotides respectively encoding antigen-binding fragments comprising the amino acid sequences set forth in SEQ ID NOs: 1 to 8 and polynucleotides encoding a plurality of CDRs may be incorporated in one polynucleotide. Such a polynucleotide can be obtained, for example, by chemical synthesis.

    [0053] The expression vector comprising a polynucleotide encoding an anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof and one or more regulatory sequences operably linked to the polynucleotide according to this embodiment is not particularly limited, but may be a vector that can replicate and/or express a polynucleotide in host cells. Examples thereof include pCAG and pET. The regulatory sequence is a sequence that controls the expression of a polynucleotide in host cells (for example, a promoter, an enhancer, a ribosome-binding sequence, and a transcription termination sequence) and can be selected as appropriate depending on the kind of the host. The expression vector is operably linked to an appropriate promoter so that the polynucleotide can be expressed in host cells and may be a vector comprising a selection marker. Moreover, polynucleotides respectively encoding antigen-binding fragments comprising the amino acid sequences set forth in SEQ ID NOs: 1 to 8, for example, a polynucleotide encoding a heavy chain variable region and a polynucleotide encoding a light chain variable region may be expressed with separate vectors.

    [0054] The host cells are not particularly limited as long as they are those that can express an antibody, but examples thereof include cells of a mammalian animal such as human, Chinese hamster, mouse, rat, rabbit, pig, monkey, goat, and horse, plant cells, yeast cells, insect cells, or bacterial cells.

    [0055] Methods for transforming the host cells are not particularly limited, but conventionally known methods such as electroporation, the calcium phosphate method, the liposome method, and the DEAE dextran method can be suitably used.

    [0056] The monoclonal antibody or antigen-binding fragment thereof can be prepared, for example, by a known method of genetic engineering. The monoclonal antibody or antigen-binding fragment thereof can be prepared, for example, by expressing a vector comprising the polynucleotide encoding an anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof in host cells. Those skilled in the art can appropriately design the polynucleotide depending on whether the antibody is a human antibody, a humanized antibody, or a chimeric antibody. For example, in the case of a human antibody or an antigen-binding fragment thereof, the polypeptide may further comprise in addition to the heavy chain and light chain variable regions set forth in SEQ ID NOs: 1 and 2 or polynucleotides encoding heavy chain CDR1-3 and light chain CDR1-3 set forth SEQ IDs NO: 3 to 8, at least a part of a polynucleotide encoding the amino acid sequence of the parts other than these parts of the human antibody. In the case of a complete antibody, such a polypeptide can be obtained by functionally linking a polynucleotide encoding the variable regions or CDR1-3 and a polynucleotide encoding the other parts in the right order. Polynucleotides encoding a heavy chain and a light chain may be incorporated in one polynucleotide or separate polynucleotides. Moreover, the polynucleotide may further comprise a polynucleotide(s) encoding a promoter for the expression and/or a tag necessary for confirmation of the expression. In the case of a chimeric antibody or an antigen-binding fragment thereof, the other parts other than the heavy chain and light chain variable regions set forth in SEQ ID NOs: 1 and 2 or the polynucleotides encoding heavy chain CDR1-3 and light chain CDR1-3 set forth SEQ IDs NO: 3 to 8 may comprise a polynucleotide encoding an amino acid sequence derived from an animal such as mouse or guinea pig.

    [0057] A further embodiment provides a pharmaceutical composition for preventing or treating HSV infection, comprising an anti-HSV gB monoclonal antibody or an antigen-binding fragment thereof. The HSV infection comprises infection with HSV-1 and HSV-2 and examples thereof include herpes labialis, herpetic keratitis, genital herpes, systemic neonatal herpes, and stomatitis, dermatosis, encephalitis, meningitis, and myelitis caused by HSV.

    [0058] The prevention means suppressing or delaying the onset of the infection or palliating symptoms by administration to a subject with risk of HSV infection, particularly an immunocompromised patient with high risk of HSV infection or a bone marrow transplantation, blood stem cell transplantation, or organ transplantation patient given an immunosuppressive agent. The treatment means palliation, improvement, or complete remission of symptoms by administration to a subject having already established HSV infection in the living body and includes the prevention of recurrence by administration to a subject undergoing repetitive HSV recurrence. The pharmaceutical composition for treating HSV infection may be used as an alternative drug or a concomitant drug of existing antiviral drugs.

    [0059] The pharmaceutical composition may further comprise a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier is not particularly limited, but examples thereof include water, salt solutions, phosphate buffered physiological saline, dextrose, glycerol, ethanol, and the like. One of these carriers may be used alone or of two or more thereof may be used in a combination.

    [0060] The pharmaceutical composition may be formulated into tablets, granules, capsules, an injection, an instillation, an inhaler, or a poultice. As a formulation agent for the purpose, the pharmaceutical composition may further comprise a small amount of an auxiliary substance that improves preservation or efficacy of an antibody or an antibody portion, for example, a lubricant, an emulsifier, an antiseptic, a buffer, an stabilizing agent.

    EXAMPLES

    [0061] The present invention will be described more specifically with reference to Examples below. However, the present invention is not limited to the following examples.

    Example 1: Preparation of Anti-HSV gB Monoclonal Antibody D48

    [0062] 4 molecular forms, the scFv-hFc form, the Fab form, the human-murine chimeric IgG2a form, and the human-guinea pig chimeric IgG2 form of antibody D48, which was obtained by comprehensive search of anti-HSV-2 gB (HSV gB2) antibodies conducted by using a human antibody library were prepared and further analyzed.

    scFv-hFc

    [0063] The isolated antibody D48 scFv (single chain Fv) gene encoding the amino acid sequence set forth in SEQ ID NO: 9 was linked to an Fc gene (CH2-CH3) derived from human IgG1 and cloned into the pCAG vector to construct an scFv-Fc expression plasmid. For expression, FreeStyle293 or Expi293 expression system (Life Technology Inc.) was used. Cells were transfected with the expression plasmid and culture supernatant was collected in 4 to 6 days. The culture supernatant was purified using Ab-Rapid PuRe 10 (ProteNova) or Ab-Rapid PuRe Ex (ProteNova) to obtain an scFv-hFc.

    Fab

    [0064] The VH region of the isolated antibody D48 scFv gene was linked to a CH1 gene derived from murine IgG2a and cloned into the pCAG vector to construct an H chain expression plasmid. Moreover, the VL region of the antibody D48 scFv gene was linked to a murine CL gene and cloned into the pCAG vector to construct an L chain expression plasmid. To facilitate purification, His tag gene was linked after (on the C terminal side of) the CH1 gene. For expression, FreeStyle293 or Expi293 expression system was used. Cells were transfected with the expression plasmid and culture supernatant was collected in 4 to 6 days. The culture supernatant was purified using Ni NTA Agarose (QIAGEN) to obtain a Fab.

    Human-Murine Chimeric IgG2a

    [0065] The VH region of the isolated antibody D48 scFv gene was linked to an H chain constant region gene (CH1-CH2-CH3) derived from murine IgG2a and cloned into the pCAG vector to construct an H chain expression plasmid. Moreover, the VL region of the antibody D48 scFv gene was linked to a murine CL gene and cloned into the pCAG vector to construct an L chain expression plasmid. For expression, FreeStyle293 or Expi293 expression system was used. Cells were transfected with the expression plasmid and culture supernatant was collected in 4 to 6 days. Culture supernatant was purified using a Hi Trap ProteinA HP Column (GE Healthcare) to obtain a human-murine chimeric IgG2a.

    Human-Guinea Pig Chimeric IgG2

    [0066] The VH region of the isolated antibody D48 scFv gene was linked to an H chain constant region gene (CH1-CH2-CH3) derived from guinea pig IgG2a and cloned into the pCAG vector to construct an H chain expression plasmid. Moreover, the VL region of the antibody D48 scFv gene was linked to a murine CL gene and cloned into the pCAG vector to construct an L chain expression plasmid. For expression, FreeStyle293 or Expi293 expression system was used. Cells were transfected with the expression plasmid and culture supernatant was collected in 4 to 6 days. Culture supernatant was purified using a Hi Trap ProteinA HP Column to obtain a human-guinea pig chimeric IgG2.

    Example 2 Reactivity Analysis of Anti-HSV gB Antibody by ELISA

    Reactivity Analysis of Fab

    [0067] The binding activity of the obtained Fab was evaluated by ELISA. The Fab was diluted to 2 g/mL in PBS and immobilized by transferring 100 L into a MaxiSorp plate (Nunc) and incubating the plate at room temperature for 2 hours. After the immobilization, the plate was washed with PBS and 100 L solutions of a recombination HSV-1 gB (gB1-705-strep) serially diluted 3.16-fold each from 1 g/mL to 0.316 ng/ml were added to wells of the plate, which was incubated at 37 C. One hour later, the plate was washed with PBST and 100 L aliquots of the detection antibody anti-strep-Tactin/HRP (Funakoshi) were added to the wells of the plate, which was incubated at 37 C. One hour later, the plate was washed with PBST and 100 L of TMB (3,3,5,5-tetramethylbenzidine) was added to each well of the plate for the color development. 30 minutes later, the reaction was stopped with 1 N sulfuric acid and the color value (O. D. 450 nm/650 nm) was measured with a microplate reader (Molecular Devices). The recombinant gB (gB1-705-strep) used was one obtained by connecting Strep tagII to the C terminus of the ectodomain of the wild type gB, derived from HSV-2 strain 333, consisting of 1st to 705th amino acid residues of the amino acid sequence set forth in SEQ ID NO: 11 and the purification and the detection by ELISA were conducted using this tag.

    [0068] As a result, the recombination gB (gB1-705-strep) exhibited specific binding to the antibody D48 Fab, as shown in FIG. 1.

    Reactivity Analysis of Human-Murine Chimeric IgG2a

    [0069] The binding activity of the obtained human-murine chimeric IgG2a was evaluated by ELISA. A recombinant gB (gB1-705-strep) was diluted to 1 g/mL with PBS and 100 L was transferred into a MaxiSorp plate and the recombinant gB (gB1-705-strep) was immobilized by incubating the plate at room temperature for 1 hour. After the immobilization, the plate was washed with PBS and 100 L solutions of the human-murine chimeric IgG2a serially diluted 3.16-fold each from 1 L to 0.316 ng/ml were added to wells of the plate, which was incubated at 37 C. One hour later, the plate was washed with PBST and 100 L solutions of the detection antibody rabbit anti-mouse IgG/HRP (invitrogen) was added to the wells of the plate, which was incubated at 37 C. One hour later, the plate was washed with PBST and 100 L of TMB was added to each well of the plate for the color development. 30 minutes later, the reaction was stopped with 1 N sulfuric acid and the color value (O.D. 450 nm/650 nm) was measured with a microplate reader.

    [0070] As a result, the human-murine chimeric IgG2a exhibited specific binding to the recombinant gB (gB1-705-strep), as illustrated in FIG. 2.

    Example 3 Reactivity Analysis of Anti-HSV gB Antibody by Immunoblotting

    [0071] 2 g/lane of gB1-705-strep was loaded in an 8-16% by weight SDS-PAGE gel and electrophoresis was performed. After the electrophoresis, transfer from the gel to a nitrocellulose membrane (Immobilon-P, MILLIPORE) was made and the membrane was blocked with 2% skim milk (Wako)-PBST. The nitrocellulose membrane blocked was washed with PBST and incubated with 2% skim milk-PBST and 10 g/mL of scFv-hFc, Fab, human-murine chimeric IgG2a or human-guinea pig chimeric IgG2 at room temperature for 60 minutes. After washing again, the nitrocellulose membrane was incubated with anti-hIgG (H+L)/HRP (BIORAD), anti-His tag/HRP (R & D), anti-mouse IgG (H+L)/HRP, or anti-guinea pig (H+L)/HRP (Invitrogen) in 2% skim milk-PBST and developed in Immobilon Western Detection Regent (Millipore). Native gB1-705-strep, denatured gB1-705-strep and reduced and denatured gB1-705-strep were prepared. The reduced and denatured gB1-705-strep was obtained by adding 1 M DTT and boiling the mixture at 96 C. for 5 minutes. The denatured gB1-705-strep was obtained by boiling gB1-705-strep at 96 C. for 5 minutes. The native gB1-705-strep is gB1-705-strep without these treatments. The prepared native gB1-705-strep, denatured gB1-705-strep, and reduced and denatured gB1-705-strep were directly loaded into a gel.

    [0072] The results are shown in FIG. 3. Lanes 1 to 3 were native gB1-705-strep, denatured gB1-705-strep, and reduced and denatured gB1-705-strep, in order, and Lanes M and M were respectively BenchMark prestained Ladder and Magic Western standard. The left photograph is of SDS-PAGE and CBB staining was performed for the band staining The 4 right photographs were the results of Western blotting (WB). As seen in FIG. 3, the original scFv-hFc had an interesting characteristic to strongly react to reduced and denatured gB1-705-strep in comparison with native gB1-705-strep and this characteristic was shared to the Fab form, the human-murine chimeric IgG2a form, and the human-guinea pig chimeric IgG2 form, which are the modified molecule forms. It is considered that antibodies that strongly react to denatured antigen epitopes are likely to recognize linear sequences. Accordingly, it is speculated that antibody D48 recognizes a linear sequence of gB from this result.

    Example 4 Analysis by Surface Plasmon Resonance (SPR)

    [0073] The analysis was performed using Biacore T200 (GE Healthcare). In all experiments, HBS-EP+buffer was used and the temperature was set at 25 C. and the flow rate was set to 30 L/m. The sensor tip used was CM5 (GE Healthcare) and about 100 resonance units (RU) of gB1-705-strep was immobilized. The measurement is conducted in the single cycle kinetics mode. scFv-hFc was used at 128 nM, 64 nM, 32 nM, 16 nM, 8 nM; Fab was used at 64 nM, 32 nM, 16 nM, 8 nM, 4 nM; and human-murine chimeric IgG2a, human-guinea pig chimeric IgG2, monoclonal antibody E31, and monoclonal antibody F67 were used at 256 fold, 128 fold, 64 fold, 32 fold, and 16 fold dilutions. All samples were measured only once. Monoclonal antibody E31 and monoclonal antibody F67 are both antibodies that recognizes domain IV of gB.

    [0074] The result is shown in Table 2. Also from the kinetic analysis using SPR, it was suggested that the affinity was maintained. Also from the kinetic analysis, it was found that F67 and E31, which are other antibody strains obtained by comprehensive search of anti-HSV HSV gB2 antibodies using a human antibody library, have affinities that are 1 order lower than that of antibody D48.

    TABLE-US-00002 TABLE 2 Results of kinetic analysis of various molecular forms of antibody D48 Clone Molecular form K.sub.D (M) D48 scFv-hFc 8.1 10.sup.10 D48 Fab 5.8 10.sup.10 D48 IgG2a 7.4 10.sup.10 D48 IgG2a 7.6 10.sup.10 E31 IgG2a 4.5 10.sup.9 F67 IgG2a 3.0 10.sup.9

    Example 5 Epitope Analysis by Alanine Scanning

    [0075] To identify the epitope of antibody D48, 187 clones in which a charged amino acid contained in gB1-705 is substituted by alanine were prepared and the reactivity to the scFv-hFc of antibody D48 was examined.

    [0076] The genes in which the charged amino acid residues (187 positions) in gB1-705 were changed to alanine were constructed by PCR and cloned into pCAGGS1-dhfr-neo. For expression, FreeStyle293 or Expi293 expression system was used. The expression levels of the obtained gB alanine substitutes and the binding activity of alanine substitutes to the antibody fragment was evaluated by ELISA.

    [0077] Culture supernatants containing the gB alanine substitutes were transferred to a MaxiSorp plate and the gB alanine substitutes were immobilized by incubating the plate at room temperature for 1 hour. After the immobilization, the plate was washed with PBST and 100 L solutions of the detection antibody StrepTactin/HRP (IBA) were added to the wells of the plate, which was incubated at room temperature. One hour later, the plate was washed with PBST and 100 L solutions of TMB were added to the wells of the plate for the color development. 30 minutes later, the reaction was stopped with 1 N sulfuric acid and the color values (O.D. 450 nm/650 nm) were measured with a microplate reader to determine the expression levels.

    [0078] Meanwhile, the culture supernatants containing the gB alanine substitutes were transferred into a MaxiSorp plate on which Streptactin (IBA) was immobilized and the gB alanine substitutes were immobilized by incubating the plate at room temperature for 1 hour. After the immobilization, the plate was washed with PBST and 100 L solutions of the antibody fragment were added to the wells of the plate, which was incubated at room temperature. One hour later, the plate was washed with PBST and 100 L solutions of the detection antibody anti-human Fc/HRP (Cosmo bio) were added into the wells of the plate, which was incubated at room temperature. One hour later, the plate was washed with PBST and 100 L solutions of TMB were added to the wells of the plate for the color development. 30 minutes later, the reaction was stopped with 1 N sulfuric acid and the color values (O.D. 450 nm/650 nm) were measured with a microplate reader to determine the binding activity. Epitope candidates were selected on the basis of whether the reactivity per expression level is changed in comparison with that of the wild type gB1-705 with no alanine substitution.

    [0079] As a result, it has been suggested that R391 on domain II of gB is an amino acid residue that is important as an epitope.

    Example 6 Epitope Analysis by Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

    [0080] Alanine scanning is an analysis that targets only hydrophilic residues and the possibility that other non-hydrophilic residues may be epitopes was well expected.

    [0081] Therefore, a detailed epitope analysis of antibody D48 was conducted using hydrogen-deuterium exchange mass spectrometry (HDX-MS). This technique takes advantage of the phenomenon in which amide hydrogen (H) not forming a stable hydrogen bond on the surface of the structure and in intrinsically disordered regions is rapidly exchanged for D when the protein is exposed to D.sub.2O. For example, the antibody-protein interface where an antibody has formed tight binding would be strongly protected from HDX since the entry of D.sub.2O is allowed only by breathing motion and, as a result, only low rate HDX occurs. Meanwhile, since places other than the antibody-protein interface are not protected from HDX, high rate HDX occurs, as a result. By analyzing the mass change of the antibody-protein complex having undergone HDX heterogeneously due to this difference of the HDX rate by MS-based peptide mapping, detailed epitope analysis of the antibody is possible. HDX-MS has already become an established technique with applied results in many fields and, particularly in the epitope analysis of antibodies, it has become an important technique in that it allows analysis of conformational epitopes with maintaining the conformation in solution.

    [0082] The procedure of the experiment was as follows. 120 M gB1-705 and 400 M antibody D48 Fab that are the same amount were mixed to prepare a gB1-705/antibody D48 Fab complex. This complex was prepared in PBS (pH 7.2) and H/D exchange reaction was performed at 20 C. using PBS (pD7.2) as a deuterium buffer. To the complex after the reaction were added Quench buffer (100 mM sodium phosphate, 150 mM sodium chloride, 4M guanidine hydrochloride, 150 mM tris(2-carboxyethyl)phosphine hydrochloride (TCEP)) and a mixture was prepared to be pH 2.4. Using a pepsin column, the complex was processed into peptide fragments, which were analyzed by LC-MS. Digestion and elution conditions in this process were Injected sample: 75 pmol, time for pepsin digestion+desalination: 6 minutes, gradient condition for LC: 9 minutes. 192 peptides were common to three times of measurement of gB1-705, gB1-705/antibody D48 Fab complex under such conditions and the sequence coverage was 99.2%.

    [0083] The result of the epitope analysis by the hydrogen-deuterium exchange mass spectrometry (HDX-MS) is shown in FIG. 4. As a result of analysis using gB1-705 and antibody D48 Fab, the peptide V380-D389 made a hit. Moreover, since L377-C385 was judged to be a peptide with no difference in the deuterium exchange rate, I386-D389 was suggested to be an epitope of antibody D48. This is very close to R391, the result of the previous analysis by the present inventors.

    [0084] Moreover, pepsin is used as a digestive enzyme in this study and it was not possible to obtain any peptide containing R391, but, taken together, the possibility that I386-R391 in HSV-2 gB set forth in SEQ ID NO: 11 is an epitope of antibody D48 is considered to be very high. Moreover, it is considered that there is a possibility that either one of D389, R388, G387, and I386 is the epitope. Furthermore, it is also possible that a part of the epitope is composed of a residue after R391. Similarly, the possibility that the region consisting of I383-R388 of HSV-1 set forth in SEQ ID NO: 10 corresponding to I386-R391 of HSV-2 gB set forth in SEQ ID NO: 11 is an epitope of antibody D48 is considered to be very high.

    [0085] Referring to the conformation, I386-R391 forms an alpha helix located in the protein-solvent interface of gB domain II and is considered to be a site easily accessible to antibodies. Moreover, L416-L422 did not satisfy the criteria for hit, but a difference in the deuterium exchange rate was detected. Since L416-L422 is located more inside in the structure than I386-R391 and resides at the position that is unlikely to be exposed to solvent, this difference in deuterium exchange rate is considered to reflect the effect of structural change.

    [0086] While C226, H1838, and H1781, of already reported antibodies, are known as anti-HSV gB monoclonal antibodies to recognize epitopes on domain II of HSV gB and approximate epitopes and in vitro bioactivity have been reported, there is no report on details of in vivo bioactivity (Non-Patent Literature 18).

    Example 7: Virus Neutralization Test

    Culture of Cells and Viruses

    [0087] For culture of viruses, measurement of infectivity titer, and measurement of neutralizing antibody titer, Vero cells (CCL.81) purchased from ATCC were used. The Vero cells were cultured under conditions at 37 C. and 5% CO.sub.2. A MEM medium supplemented with 10% FBS was used at the time of preparing plates for expansion, maintenance, and analysis and an MEM medium supplemented with 2% FBS was used at the time of the measurement of infectivity titer and the measurement of neutralizing antibody titer. For the virus bank used in the neutralization test and the analysis of protective ability against infection, human herpesvirus 2 (HSV-2) strain MS (VR-540) and human herpesvirus 1 (HSV-1) strain KOS (VR-1493) purchased from ATCC was inoculated onto full sheets of Vero cells at a m.o.i=0.01 to 1 and cultured in the MEM medium supplemented with 2% FBS for 2 to 3 days. Collected culture bottles of the infected cells were freeze-thawed three times; to disrupt the cells and then centrifuged at room temperature in a TOMY centrifuge at 3500 rpm for 10 minutes to obtain supernatant as the HSV-2 virus bank and the HSV-1 virus bank.

    Neutralization Test

    [0088] The neutralization test was conducted using 2 methods: the measurement of plaque number-reducing activity (plaque reduction activity) and the measurement of cell to cell infection spread-suppression activity. The viruses used in the test were 2 viruses: HSV-2 strain MS and HSV-1 strain KOS.

    [0089] For the measurement of plaque reduction activity, a test antibody is prepared at a predetermined concentration and mixed with about 100 PFU of HSV-2 strain MS or HSV-1 strain KOS and then incubated at 37 C. for 1 hour. The resultant reaction solution was seeded onto Vero cells allowed to become full sheets in a 48-well plate, left for the adsorption at 30 C. for 1 hour, and then cultured in a MEM (2% FBS) medium supplemented with 1% methylcellulose for 24 hours, and then the inactivation and the fixation were performed with 50% methanol/50% ethanol (20 C.) at 20 C. for 30 minutes. Subsequently, this was incubated with the anti-HSV gB monoclonal antibody at 37 C. for 1 hour and immunostained with an anti-mouse IgG/HRP (Dako P0447) and TMBH and images of the respective wells were taken in an ELISPOT analyzer (ImmunoSpot S6 Analyzer CTL) to count the number of plaques using an analysis soft (BioSpot CTL).

    [0090] For the measurement of cell to cell infection spread-suppression activity, about 100 PFU of HSV-2 strain MS or HSV-1 strain KOS was inoculated onto Vero cells allowed to become full sheets in a 48-well plate and left for the adsorption at 30 C. for 1 hour, and then a MEM (2% FBS) medium supplemented with 1% methylcellulose containing a test antibody at a predetermined concentration (the antibody concentrations are 5, 25 and 125 g/mL) was added; and HSV-2 strain MS was cultured for about 40 hours and HSV-1 strain KOS was cultured for 48 hours and then the inactivation and the fixation were performed with 50% methanol/50% ethanol (20 C.) at 20 C. for 30 minutes. Subsequently, they were incubated with an anti-HSV gB monoclonal antibody prepared in house at 37 C. for 1 hour and immunostained with an anti-mouse IgG/HRP and TMBH and images of the respective wells were taken in an ELISPOT analyzer to analyze the average of the plaque size using an analysis software.

    [0091] The results are shown in Table 3. Any of scFv-hFc, Fab, human-murine chimeric IgG2a, and human-guinea pig chimeric IgG2k of antibody D48 exhibited a strong 50% plaque number-reducing activity of 1 nM or less or several nM to both strains KOS (HSV-1) and MS (HSV-2). Moreover, scFv-hFc and human-murine chimeric IgG2a of antibody D48 exhibited strong 50% cell to cell infection spread-suppression activities of 40 nM and 48 nM respectively to the strain MS (HSV-2).

    TABLE-US-00003 TABLE 3 Neutralizing activity of various molecular forms of antibody D48 50% plaque number- 50% cell-to-cell infection Molecular reducing activity spread-suppression activity form Strain KOS Strain MS Strain KOS Strain MS of antibody (HSV-1) (HSV-2) (HSV-1) (HSV-2) D48 [nM] [nM] [nM] [nM] scFv-hFc 1 0.12 N.T. 40 Fab 2.7 4.4 N.T. N.T. IgG2a 1.9 1.6 N.T. 48 IgG2 0.94 7.5 N.T. N.T. N.T.: not tested

    [0092] 50% plaque number-reducing activities of antibody D48 in vitro against HSV-1 and HSV-2 are outstanding in comparison with a variety of anti-HSV gB monoclonal antibodies previously reported.

    Example 8 Murine Infection-Prevention Test

    Method of Testing

    [0093] Using a mouse model of genital herpes infection, an infection-prevention test upon preventive administration and therapeutic administration of an anti-HSV gB monoclonal antibody (human-murine chimeric IgG2a) was conducted. BALB/c mice (5 weeks old, female) were used. A predetermined amount of the antibody was dissolved in physiological saline for injection and the antibody was administered to the mice. For preventive administration, the antibody in a volume of 200 L/animal was intraperitoneally administered 24 hours before the inoculation of virus. For therapeutic administration, the antibody in a volume of 200 L/animal was intraperitoneally administered 48 hours before the inoculation of virus. The number of animals was set at N=10 per group. To improve multiplicity of infection upon the inoculation of virus, 2 mg/animal of Depo-Provera was inoculated subcutaneously 6 days before the inoculation of virus. 510.sup.5 PFU/20 L of HSV-2 strain MS was transvaginally inoculated under anesthesia and follow-up was conducted for 21 days. Infection prevention ability was expressed by survival time (survival rate) and symptom score as indicators. The symptom score was defined by the presence or absence and degree of vaginal lesion symptoms and expressed as the mean of each group. The scores were defined as follows: 0: no change, 1: partial erythema/swelling, 2: extensive swelling/edema, 3: ulcer/hemorrhage, 4: death. When serious general symptoms (piloerection, paralysis, tremor, convulsion, and the like) with no possibility of recovery are observed, the animal was given a score of 3.5 on the day of observation and sacrificed, and given a score of 4 next day, handled as dead.

    Mouse Infection-Prevention Test with Antibodies D48, F67, and E31

    [0094] The mouse infection prevention abilities of the 3 anti-HSV gB2 antibodies D48, F67, and E31 (all human-murine chimeric IgG2a) set forth in Table 4 were evaluated and compared. While antibody D48 is an antibody having an epitope in domain II region of HSV gB and having strong virus-neutralizing activity (50% plaque number-reducing activity), F67 and E31 both have an epitope in domain IV region and the former had no virus-neutralizing activity and the latter had intermediate virus-neutralizing activity.

    TABLE-US-00004 TABLE 4 Neutralizing activity and epitope region of antibodies D48, F67, and E31 50% plaque Human- number-reducing murine activity chimeric [Strain MS] IgG2a (nM) Epitope region D48 1.6 Domain II Amino acid sequence containing I386-R391 F67 >5000 Domain IV Reduction of binding ability by alanine substitution of any one of R613, E626, E627, and H632 E31 67 Domain IV Reduction of binding ability by alanine substitution of any one of D554, R563, and D583

    [0095] Preventive administration in which the number of animals per group was n=7 was performed. The survival time after the infection and the mean thereof are shown in Table 5 and the mean of survival rate (%) after the infection is shown in FIG. 5. As to the mouse infection prevention ability, while antibody D48 exhibited prominent survival time prolongation effect at 30 g/animal/dose and 3 g/animal/dose and significant survival time prolongation effect even at 0.3 g/animal/dose, F67 and E31 both exhibited only limited effect. From this result, the possibility was suggested that antibody D48 has prominent infection prevention activity in comparison with other anti-HSV gB2 antibodies not only in vitro but also in vivo and the superiority is based on the difference of epitope region and affinity.

    TABLE-US-00005 TABLE 5 Survival time after preventive administration of IgG2a of antibodies D48, F67, and E31 to mice Human- Inoculation Mean Significant marine amount survival difference chimeric (g/animal/ time test IgG2a dose) Survival time after infection (days) (days) (vs saline) D48 30 >28, >28, >28, >28, >28, >28 >28 *** 3 8, >28, >28, >28, >28, >28, >28 >28 ** 0.3 6, 6, 6, 10, 10, 12, >28 10 * F67 30 7, 7, 8, 10, 10, >28, >28 10 * 3 6, 7, 7, 8, 9, >28, >28 8 N.S. 0.3 6, 6, 7, 7, 7, 7, >28 7 N.S. E31 30 5, 6, 7, 7, 9, 11, >28 7 N.S. 3 8, 9, 9, 11, 11, 15, >28 11 ** 0.3 6, 6, 6, 7, 7, 12, 14 7 N.S. saline 6, 6, 6, 6, 7, 8, 8 6 [Significant difference test] ***: p < 0.001, **: 0.001 p < 0.01, *: 0.01 p < 0.05 (Kaplan-Meier method)

    Result of Mouse Infection-Prevention Test with Antibody D48

    [0096] The results of infection-prevention tests in preventive administration and therapeutic administration of antibody D48 (human-murine chimeric IgG2a) using a mouse model of genital herpes infection (n=10) are shown. The results of preventive administration are shown in Table 6 (survival time by dosage), FIG. 6 (survival rate), and FIG. 7 (symptom score). The results of therapeutic administration are shown in Table 7 (survival time by dosage), FIG. 8 (survival rate), and FIG. 9 (symptom score).

    [0097] In the preventive administration, significant survival time prolongation effect was exhibited at all doses set (10 mg/kg, 3 mg/kg, 1 mg/kg, 0.5 mg/kg, 0.3 mg/kg) in comparison with a negative control group (saline administration group). In particular, at 2 doses of 10 mg/kg and 3 mg/kg in the high dose range, prominent survival rate and symptom score-improving effects were exhibited.

    TABLE-US-00006 TABLE 6 Survival time after preventive administration of antibody D48 (IgG2a) to mice Mean Significant survival difference Dosage time test (mg/kg) Survival time after infection (days) (days) (vs saline) D48 10 7, >21, >21, >21, >21, >21, >21, >21, >21 *** preventative >21, >21 administration 3 14, >21, >21, >21, >21, >21, >21, >21, >21 *** >21, >21 1 5, 7, 7, 8, 8, 8, >21, >21, >21, >21 8 *** 0.5 6, 6, 6, 6, 6, 7, 7, 8, 8, 8 6.5 ** 0.3 5, 6, 6, 7, 7, 7, 7, 7, 9, 9 7 ** saline 5, 5, 5, 5, 5, 5, 5, 6, 6, 6 5 ***: p < 0.0001, **: 0.0001 p < 0.001, *: 0.001 p < 0.05 (Kaplan-Meier method)

    [0098] There is a report that HSV moves from the site of infection to ganglia in the body within 48 hours after the entry in therapeutic administration. However, prominent survival rate and symptom score-improving effects were exhibited at 2 doses of 10 mg/kg and 3 mg/kg even in therapeutic administration of antibody D48 at a time point within 48 hours after the infection. From these results, it was confirmed that antibody D48 exhibited a strong infection prevention effect not only in the preventive administration but also in the therapeutic administration.

    TABLE-US-00007 TABLE 7 Survival time after therapeutic administration of IgG2a of antibody D48 to mice Mean Significant survival difference Dosage time test (mg/kg) Survival time after infection (days) (days) (vs saline) D48 10 19, 19, >21, >21, >21, >21, >21, >21, >21 *** therapeutic >21, >21 administration 3 7, 8, 9, 9, 11, >21, >21, >21, >16 *** >21, >21 1 5, 5, 5, 6, 6, 7, 7, 7, 11, 19 6.5 N.S. 0.5 6, 6, 6, 6, 6, 6, 7, 7, 7, 7 6 N.S. 0.3 5, 6, 6, 6, 7, 7, 7, 7, 8, 8 7 N.S. saline 5, 5, 5, 6, 6, 6, 6, 6, 7, 7 6 ***: p < 0.0001, **: 0.0001 p < 0.001, *: 0.001 p < 0.05 (Kaplan-Meier method)

    Example 9 Guinea Pig Infection-Prevention Test

    Method of Testing

    [0099] Using a guinea pig model of genital herpes infection, an infection-prevention test upon preventive administration and therapeutic administration of an anti-HSV gB monoclonal antibody D48 (human-guinea pig chimeric IgG2k) was conducted. Hartley guinea pigs (3 to 5 weeks old, female) purchased from SLC were used. A predetermined amount of the antibody was dissolved in physiological saline for injection and the antibody was intraperitoneally administered at a dose of 1 mg/kg to 30 mg/kg 24 hours before the viral inoculation in the case of preventive administration and 4 days after the viral inoculation in the case of therapeutic administration. In the case of therapeutic administration, symptoms were observed before the administration and individuals exhibiting vaginal symptoms were selected and randomized such that the mean scores of groups are unbiased. The number of animals per group was set at N=9 in the preventive administration and set at N=15 in the therapeutic administration. In the viral inoculation, 510.sup.5 PFU/50 L of HSV-2 strain MS was transvaginally inoculated under anesthesia and acute phase symptoms were observed for 2 to 3 weeks after the inoculation. The symptom scores were defined as follows: 0: no apparent lesions, 0.5 to 1: erythema, 1.5 to 2: localized vesicles, 2.5 to 3: localized ulcer or crust, 3 to 5: extended vesicles, ulcer, or crust, 3 to 7: extended ulcer or crust with incontinence, 7.5: euthanization due to serious symptoms, and 8: death. Moreover, 7 days after the viral inoculation, vaginal swabs were collected and the amount of virus release was measured by the plaque method. The vagina swabs were collected by inserting a cotton swab wet with the MEM medium into vagina and then wiping the mucosa of the intravaginal wall. Collected vaginal swabs were suspended in 1 mL aliquots of the MEM medium dispensed in siliconized tubes and cryopreserved until use. When measuring the amount of virus release, the vagina swabs were diluted 1-fold, 10-fold, 100-fold, and 1000-fold and inoculated at 100 L/well onto Vero cells allowed to become full sheets in 96-well or 48-well. Virus adsorption was performed at 37 C. for 1 hour after the inoculation of vaginal swabs and the number of plaques was measured by a predetermined method after culturing in 2% FBS MEM medium supplemented with of 1% methylcellulose for 24 to 72 hours.

    Result

    [0100] The result of the symptom score of infection-prevention test of preventive administration of antibody D48 (human-guinea pig chimeric IgG2) is shown in FIG. 10, the result of the symptom score of the therapeutic administration infection-prevention test is shown in FIG. 11, and the amount of HSV release in the vaginal swab in the therapeutic administration infection-prevention test using a guinea pig model of genital herpes infection (acute phase) is shown in FIG. 12.

    [0101] As shown in FIG. 10, after the preventive administration, significant symptom score-improving effect was observed at all doses set (30 mg/kg, 10 mg/kg, 3 mg/kg, 1 mg/kg) in comparison with a negative control group (saline administration group).

    [0102] As shown in FIG. 11, administration of 30 mg/kg of antibody D48 to guinea pigs which already exhibited vaginal symptoms 4 days after the infection resulted in significant reduction of symptom score in comparison with a negative control group (saline administration group). Moreover, collecting vaginal swabs on Day 7 after the viral inoculation and measuring the amount of virus release by the plaque method resulted in, as shown in FIG. 12, significant reduction of amount of virus release in comparison with a negative control group. Based on the foregoing, it was confirmed that antibody D48 exhibit significant infection prevention effect not only after the preventive administration but also after the therapeutic administration.

    INDUSTRIAL APPLICABILITY

    [0103] According to the present invention, novel anti-HSV gB monoclonal antibodies that exhibit strong HSV-neutralizing effect and can suppress cell to cell spread of HSV can be provided. Thereby, the antibodies can be applied to the prevention and/or the treatment of HSV infection and used as a preventive agent for immunocompromised patients having high risk of HSV infection or patients undergoing bone marrow transplantation, blood stem cell transplantation, or organ transplantation receiving an immunosuppressive agent, as a therapeutic agent for patients undergoing repetitive reactivation of HSV, or as an alternative drug or a concomitant drug of existing antiviral drugs.