Cannabichromenic acid synthase from <i>Cannabis sativa</i>

10724009 ยท 2020-07-28

Assignee

Inventors

Cpc classification

International classification

Abstract

Nucleic acid molecules from cannabis have been isolated and characterized and encode polypeptides having cannabichromenic acid synthase activity. Expression or over-expression of the nucleic acids alters levels of cannabinoid compounds. The polypeptides may be used in vivo or in vitro to produce cannabinoid compounds.

Claims

1. A nucleic acid molecule comprising: i) a cDNA having a nucleotide sequence encoding a polypeptide having the sequence set forth in SEQ ID NO:_2 or 6 or a polypeptide having at least 99.5% sequence identity to SEQ ID NO: 2 or 6 and encoding a polypeptide having cannabichromenic acid synthase activity; ii) a cDNA having a nucleotide sequence having at least, greater than or about 99.5% sequence identity to SEQ ID NO: 1 or 5 and encoding a polypeptide having cannabichromenic acid synthase activity; iii) a cDNA having a nucleotide sequence having at least, greater than or about 90% sequence identity to SEQ ID NO: 8 or 9 and encoding a polypeptide having cannabichromenic acid synthase activity; or iv) a nucleotide sequence that is the complement of i), ii).

2. The nucleic acid molecule of claim 1, wherein the nucleotide sequence is as set forth in SEQ ID NO: 1 or 5 or a codon degenerate nucleotide sequence thereof, optionally wherein the codon degenerate nucleotide sequence comprises the sequence set forth in SEQ ID NO: 8 or 9, or the complement of any of the foregoing.

3. The nucleic acid molecule of claim 1, wherein the encoded polypeptide has an amino acid sequence as set forth in SEQ ID NO: 2 or 6.

4. The nucleic acid molecule of claim 1, wherein the nucleic acid molecule is conjugated to or comprises one or more heterologous moieties, optionally one or more of a heterologous nucleic acid, a detectable label or a tag.

5. An in vitro expression system comprising a nucleic acid molecule comprising: i) a nucleotide sequence encoding a polypeptide having the sequence set forth in SEQ ID NO: 2 or 6 or a polypeptide having at least 99.5% sequence identity to SEQ ID NO: 2 or 6 and encoding a polypeptide having cannabichromenic acid synthase activity; ii) a nucleotide sequence having at least, greater than or about 99.5% sequence identity to SEQ ID NO: 1 or 5 and encoding a polypeptide having cannabichromenic acid synthase activity; iii) a nucleotide sequence having at least, greater than or about 90% sequence identity to SEQ ID NO: 8 or 9 and encoding a polypeptide having cannabichromenic acid synthase activity; or iv) a nucleotide sequence that is the complement of i), ii) or iii).

6. A recombinant organism, cell or tissue comprising or produced using the nucleic acid molecule of claim 1.

7. The organism of claim 6, wherein the organism is a microorganism.

8. The organism of claim 7, wherein the microorganism is yeast or E. coli.

9. A composition comprising (a) the nucleic acid molecule according to claim 1; and/or a purified extract of a recombinant cell, organism or tissue comprising or produced with said nucleic acid molecule.

10. The nucleic acid molecule of claim 4, wherein the nucleic acid molecule encodes a polypeptide having the sequence set forth in SEQ ID NO: 6 or a polypeptide having at least 99.5% sequence identity to SEQ ID NO: 6 and the heterologous nucleic acid is a signal sequence, optionally alpha mating factor signal sequence, -amylase signal sequence, glucoamylase signal sequence, serum albumin signal sequence, inulinase signal sequence, invertase signal sequence, killer protein signal sequence or lysozyme signal sequence.

11. The in vitro system of claim 5, wherein the nucleotide sequence is as set forth in SEQ ID NO: 1 or 5 or a codon degenerate nucleotide sequence thereof, optionally wherein the codon degenerate nucleotide sequence comprises the sequence set forth in SEQ ID NO: 8 or 9, or the complement of any of the foregoing.

12. The in vitro system of claim 5, wherein the amino acid sequence is as set forth in SEQ ID NO: 2 or 6.

13. The in vitro system of claim 5, wherein the nucleic acid molecule or the polypeptide is coupled to one or more heterologous moieties, optionally one or more of a linker, a signal sequence, a detectable label or a tag.

14. The in vitro system of claim 13, wherein the nucleic acid molecule encodes a polypeptide having the sequence set forth in SEQ ID NO: 6 or a polypeptide having at least 99.5% sequence identity to SEQ ID NO: 6 and the heterologous nucleic acid is a signal sequence, optionally alpha mating factor signal sequence, -amylase signal sequence, glucoamylase signal sequence, serum albumin signal sequence, inulinase signal sequence, invertase signal sequence, killer protein signal sequence or lysozyme signal sequence.

15. The in vitro expression system of claim 5, further comprising one or more of a translation competent extract of whole cells, a RNA polymerase, one or more regulatory protein factors, one or more transcription factors, ribosome preparation, and tRNA.

16. The in vitro expression system of claim 5, wherein the nucleic acid molecule is comprised in a vector with 5 T7 promoter upstream of the nucleic acid molecule.

17. The in vitro expression system of claim 5, further comprising one or more other nucleic acids that encode one or more enzymes in a cannabinoid biosynthetic pathway.

18. The in vitro expression system of claim 5, wherein the one or more enzymes in a cannabinoid biosynthetic pathway is one or more of hexanoyl CoA synthetase, olivetolic acid cyclase, a THCA synthase, a CBDA synthase, or aromatic prenyltransferase PT1.

19. The organism, cell or tissue of claim 6, wherein the organism is a plant, the cell is a plant cell or the tissue is a plant germ tissue.

20. The organism, cell or tissue of claim 19, wherein the plant, plant cell or plant germ tissue is of the genus cannabis.

21. The organism or cell of claim 6, wherein the organism is an insect or the cell is an insect cell, optionally Spodoptera frugiperda.

22. A vector construct comprising a nucleic acid molecule comprising: i) a nucleotide sequence encoding a polypeptide having the sequence set forth in SEQ ID NO: 2 or 6 or a polypeptide having at least 99.5% sequence identity to SEQ ID NO: 2 or 6 and encoding a polypeptide having cannabichromenic acid synthase activity; ii) a nucleotide sequence having at least, greater than or about 99.5% sequence identity to SEQ ID NO: 1 or 5 and encoding a polypeptide having cannabichromenic acid synthase activity; iii) a nucleotide sequence having at least, greater than or about 90% sequence identity to SEQ ID NO: 8 or 9 and encoding a polypeptide having cannabichromenic acid synthase activity; or iv) a nucleotide sequence that is the complement of i), ii) or iii).

23. The vector construct of claim 22, wherein the nucleotide sequence is as set forth in SEQ ID NO: 1 or 5 or a codon degenerate nucleotide sequence thereof, optionally wherein the codon degenerate nucleotide sequence comprises the sequence set forth in SEQ ID NO: 8 or 9, or the complement of any of the foregoing.

24. The vector construct of claim 22, wherein the encoded polypeptide has an amino acid sequence as set forth in SEQ ID NO: 2 or 6.

25. The vector construct of claim 22, wherein the nucleic acid molecule is conjugated to or comprises one or more heterologous moieties, optionally one or more of a heterologous nucleic acid, a detectable label or a tag.

26. The vector construct of claim 25, wherein the nucleic acid molecule encodes a polypeptide having the sequence set forth in SEQ ID NO: 6 or a polypeptide having at least 99.5% sequence identity to SEQ ID NO: 6 and the heterologous nucleic acid is a signal sequence, optionally alpha mating factor signal sequence, -amylase signal sequence, glucoamylase signal sequence, serum albumin signal sequence, inulinase signal sequence, invertase signal sequence, killer protein signal sequence or lysozyme signal sequence.

27. A recombinant organism, cell or tissue comprising or produced using the vector construct of claim 22.

28. A composition comprising the vector construct of claim 22; and/or a purified extract of a recombinant cell, organism or tissue comprising or produced with said vector construct.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) In order that the invention may be more clearly understood, embodiments thereof will now be described in detail by way of example, with reference to the accompanying drawings, in which:

(2) FIG. 1 depicts a proposed pathway leading to the main cannabinoid types in Cannabis sativa. Abbreviations: THCA synthase is .sup.9-tetrahydrocannabinolic acid synthase, CBDA synthase is cannabidiolic acid synthase, and CBCA synthase is cannabichromenic acid synthase.

(3) FIG. 2 depicts HPLC chromatograms of genuine cannabinoid standards and CBCAS reactions products. A. CBGA standard (retention time 6.8 min). B. CBCA standard (retention time 9.9 min). Inset is the ultraviolet spectrum of the CBCA standard. C. Products of CBCAS reaction showing that the recombinant enzyme produces CBCA (retention time 9.9 min). Inset is the ultraviolet spectrum of the CBCA produced by this reaction. D. Boiled enzyme reaction. No CBCA was produced by this reaction.

(4) FIG. 3 depicts a SDS-PAGE gel or purified recombinant CBCAS expressed in Pichia pastoris. Panel A is the protein ladder. Panel B shows purified CBCAS. Panel C shows purified CBCAS deglycosylated with Endo Hf. The upper band shows Endo Hf (70 kDa), the lower band shows deglycosylated CBCAS (63 kDa). Panel D shows Endo Hf only.

(5) FIG. 4 depicts optimal conditions for CBCAS activity. Panel A shows the effect of a buffer and a buffer pH on CBCA production. Values are expressed as a fraction of CBCA produced (CBCA A265 nm/(CBGA A265 nm+CBCA A265 nm)*100). Panel B shows the effect of incubation temperature on CBCA production. Panel C shows the effect of additive on CBCA production.

DETAILED DESCRIPTION

(6) Described herein is a polynucleotide from Cannabis sativa which encodes CBCA synthase (CBCAS) and the encoded polypeptide. Methods of using said CBCAS, including through plant breeding, mutagenesis or genetic engineering, as well as methods for making recombinant cells, and recombinant organisms such as recombinant plants such as cannabis plants with enhanced CBCA content as well as cell free systems, are described. Furthermore, methods of inactivating or silencing CBCAS for example in a cannabis cell and/or plant are described, optionally to block and/or reduce CBCA biosynthesis and CBCA content of a cannabis cell or plant. Some embodiments describe use of said CBCA in combination with nucleic acids encoding other enzymes in the cannabinoid pathway.

(7) As described herein, the cannabis genome sequence (van Bakel et al., 2011) was analyzed for genes with high similarity to THCA synthase using BLAST analysis, leading to the identification of a gene with 96% nucleotide similarity to THCA synthase. Based on the subsequent biochemical characterization, the identified gene was named Cannabis sativa cannabichromenic acid synthase (CBCAS).

(8) The sequence of the CBCAS cDNA is provided in SEQ ID NO:1. SEQ ID NO: 1 includes a predicted signal sequence that is coded by nucleotides 1 to 84.

(9) The corresponding amino acid sequence of the open reading frame of CBCAS is provided in SEQ ID NO:2. SEQ ID NO: 2 includes the predicted signal sequence which is found at amino acids 1-28. SEQ ID NO: 6 does not include the predicted signal sequence.

(10) An embodiment provides an isolated nucleic acid that encodes the polypeptide encoded by SEQ ID NO: 2 or 6 or a fragment thereof.

(11) In an embodiment, the isolated or purified nucleic acid is deleted of all or part of the nucleotides that encode the signal sequence, for example nucleotides 4-84 of SEQ ID NO:1, as shown in SEQ ID NO: 5.

(12) The 5 codon ATG (and or additional codons optionally 1-50 additional codons, optionally 27 additional codonscan be replaced with another nucleic acid sequence, for example to introduce a sequence encoding a 5 heterologous moiety such as a tag or signal sequence for example alpha mating factor signal sequence.

(13) In an embodiment, the isolated or purified polypeptide is deleted of all or part of the signal sequence, for example amino acids 1-28 or all or part of 2-28 of SEQ ID NO: 2, as shown in SEQ ID NO: 6.

(14) The 5 methionine and/or additional amino acids at the 5 end (for example up to 50 additional amino acids) can be replaced with another amino acid sequence such as a 5 heterologous moiety such as a tag or signal sequence for example alpha mating factor signal sequence.

(15) Other signal sequences can include for example -amylase signal sequence from Aspergillus niger, Glucoamylase signal sequence from Aspergillus awamori, Serum albumin signal sequence from Homo sapiens, Inulinase signal sequence from Kluyveromcyes maxianus, Invertase signal sequence from Saccharomyces cerevisiae, Killer protein signal sequence from Saccharomyces cerevisiae or Lysozyme signal sequence from Gallus gallus.

(16) The signal sequence of CBCAS can also be mutated by adding arginine residues or replacing amino acids with arginine residues.

(17) SEQ ID NOs: 8 and 9 provide codon optimized nucleic acid sequences, optimized for E. coli and yeast respectively. Accordingly, in an embodiment, the sequence is a codon optimized sequence. The codon optimized sequences share about 78% and 79% sequence identity with SEQ ID NO: 1 and encode SEQ ID NO:2. In an embodiment, the optimized sequences are deleted of all or part of the corresponding predicted signal sequence nucleotides. In an embodiment, the signal sequence is replaced with another signal sequence or deleted and replaced with a methionine start codon.

(18) Some embodiments relate to an isolated or purified nucleic acid molecule having at least or about 78%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98% or at least or about 99% sequence identity to SEQ ID NO: 1, 5, 8 and/or 9. In certain embodiments, the isolated or purified nucleic acid molecule is a codon degenerate sequence of SEQ ID NO: 1, 5, 8 or 9. In an embodiment the nucleic acid molecule has cannabichromenic acid synthase activity.

(19) Fragments of the above sequences including fragments of SEQ ID NO: 1, 5, 8 and 9 and sequences with at least or about 78% or more sequence identity thereto are also contemplated. In some embodiments, the nucleic acid molecule comprises at least and/or up to or about 15, at least and/or up to or about 20 at least and/or up to or about 25, at least and/or up to or about 30, at least and/or up to or about 40 at least and/or up to or about 50, at least and/or up to or about 60, at least and/or up to or about 70, at least and/or up to or about 80, at least and/or up to or about 90, at least and/or up to 100, at least or up to or about 200, at least or up to or about 300, at least or up or about 400, at least or up to or about 500, at least or up to or about 600, at least or up to or about 700, at least or up to or about 800, at least or up to or about 900, at least or up to or about 1000, at least or up to or about 1100, at least or up to or about 1200, at least or up to or about 1300, at least or up to or about 1400 or at least or up to or about 1500 contiguous nucleotides of SEQ ID NO:1, 5, 8 or 9 or a sequence with at least or about 78% or more, for example about 96% sequence identity thereto. For example, the nucleic acid molecule can be from 15 contiguous nucleotides up to 1500 contiguous nucleotides or any range or number of nucleotides there between.

(20) Further included are nucleic acid molecules that hybridize to the above disclosed sequences. Hybridization conditions may be stringent in that hybridization will occur if there is at least about a 96% or about a 97% sequence identity with the nucleic acid molecule in SEQ ID NO: 1 or 5. The stringent conditions may include those used for known Southern hybridizations such as, for example, incubation overnight at 42 C. in a solution having 50% formamide, 5SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5Denhardt's solution, 10% dextran sulfate, and 20 mg/mL denatured, sheared salmon sperm DNA, following by washing the hybridization support in 0.1SSC at about 65 C. Other known hybridization conditions are well known and are described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor, N.Y. (2001).

(21) As will be appreciated by the skilled practitioner, changes in nucleic acid sequence do not necessarily alter the amino acid sequence of the encoded polypeptide. It will be appreciated by persons skilled in the art that changes in the identities of nucleotides in a specific nucleic acid sequence that change the amino acid sequence of the encoded polypeptide may result in reduced or enhanced effectiveness of the genes and that, in some applications (e.g., anti-sense, co suppression, or RNAi), partial sequences can be used. The ways in which the nucleotide sequence can be varied or shortened are well known to persons skilled in the art, as are ways of testing the effectiveness of the altered sequences. In certain embodiments, effectiveness may easily be tested by, for example, conventional gas chromatography. All such variations of the nucleic acid sequences are therefore included as part of the present disclosure.

(22) As will be appreciated by one of skill in the art, the length of the nucleic acid molecule described above will depend on the intended use. For example, if the intended use is as a primer or probe, for example, for PCR amplification or for screening a library, the length of the nucleic acid molecule will be less than the full length sequence, such as a fragment of for example, about 15 to about 50 nucleotides, optionally at least about 15 nucleotides of SEQ ID NO:1, 5, 8 or 9 and/or its complement, optionally at least about 17 nucleotides of SEQ ID NO:1, 5, 8 or9 or its complement, optionally at least about 19 nucleotides of SEQ ID NO:1, 5, 8 or 9 or its complement, optionally at least about 21 nucleotides of SEQ ID NO:1, 5, 8 or 9 or its complement, optionally at least about 23 nucleotides of SEQ ID NO:1, 5, 8 or 9 or its complement, optionally at least about 25 nucleotides of SEQ ID NO:1, 5, 8 or 9 and/or its complement. In these embodiments, the primers or probes may be substantially identical to a highly conserved region of the nucleic acid sequence or may be substantially identical to either the 5 or 3 end of the DNA sequence. In some cases, these primers or probes may use universal bases in some positions so as to be substantially identical but still provide flexibility in sequence recognition. It is of note that suitable primer and probe hybridization conditions are well known in the art.

(23) In an embodiment, the nucleic acid molecule can be used as a primer and for example comprises the sequence of SEQ ID NO: 3 or 4.

(24) In an embodiment, the nucleic acid is conjugated to and/or comprises a heterologous moiety, such as a unique tail, purification tag or detectable label.

(25) The unique tail can be a specific nucleic acid sequence.

(26) The nucleic acid can for example be end labelled (5 or 3) or the label can be incorporated randomly during synthesis.

(27) Also provided in another embodiment is an isolated polynucleotide molecule comprising i) a nucleic acid molecule comprising at least about 15 nucleotides of SEQ ID NO: 1, 5, 8 or 9 (e.g. a fragment of SEQ ID NO:1, 5, 8 or 5=9), or a nucleic acid comprising 15 nucleotides and having at least about 96%, at least about 97%, at least about 98% or at least about 99% identity to SEQ ID NO:1, 5, 8 or 9 and ii) a heterologous moiety. In an embodiment, the nucleic acid molecule encodes a polypeptide comprising enzymatic activity.

(28) In an embodiment, the heterologous moiety is a heterologous nucleic acid that encodes a heterologous polypeptide and the polynucleotide molecule encodes a fusion polypeptide.

(29) Some embodiments relate to an isolated or purified polypeptide having at least at least about 96%, at least about 97%, at least about 98% or at least about 99% identity to the amino acid sequence as set forth in SEQ ID NO: 2 or 6.

(30) Fragments of SEQ ID NO: 2 or 6 are also contemplated. In some embodiments, the polypeptide comprises at least and/or up to about 5, at least and/or up to or about 10, at least and/or up to or about 15, at least and/or up to or about 20 at least and/or up to or about 25, at least and/or up to or about 30, at least and/or up to or about 40 at least and/or up to or about 50, at least and/or up to or about 60, at least and/or up to or about 70, at least and/or up to or about 80, at least and/or up to or about 90, at least and/or up to or about 100; at least and/or up to or about 150, at least and/or up to or about 200, at least and/or up to or about 250, at least and/or up to or about 300, at least and/or up to or about 350, at least and/or up to or about 400, at least and/or up to or about 450, at least and/or up to or about 500 contiguous amino acids of SEQ ID NO:2 or 6.

(31) In an embodiment, the fragment has at least about 96%, at least about 97%, at least about 98% or at least about 99% identity to the amino acid sequence as set forth in SEQ ID NO: 2 or 6.

(32) In an embodiment, the isolated polypeptide is differentially glycosylated, non-glycosylated (e.g. devoid of N and/or O-linked glycosylation) and/or deglycosylated as compared to Cannabis produced CBCAS. For example, the isolated polypeptide can be deglycosylated using chemical or enzymatic methods, for example treatment with Endo Hf or a deglycosylation enzyme mix. The isolated polypeptide for example is differentially glycosylated due to expression in yeast or other expression system.

(33) Other embodiments relate to an isolated or purified composite polypeptide comprising: i) a polypeptide comprising at least 5 amino acid residues of SEQ ID NO:2 or 6 and optionally having at least, greater than or about 96%, at least, greater than or about 97%, at least, greater than or about 98% or at least, greater than or about 99% identity to the amino acid sequence as set forth in SEQ ID NO:2 or 6 and ii) a heterologous moiety.

(34) In an embodiment, the heterologous moiety is a heterologous polypeptide and the composite polypeptide is a fusion polypeptide. For example the heterologous polypeptide can be a signal sequence such as alpha mating factor signal sequence.

(35) In an embodiment, the fusion polypeptide optionally comprises a peptide linker joining the polypeptide comprising all or part of SEQ ID NO:2 or 6 and the heterologous polypeptide.

(36) In an embodiment, the heterologous moiety is a detectable label or tag.

(37) The detectable label is preferably capable of producing, either directly or indirectly, a detectable signal. For example, the label may be radio-opaque or a radioisotope, such as .sup.3H, .sup.14C, .sup.32P (including for example radioactive phosphates), .sup.35S, 123I, .sup.125I, .sup.131I; biotin, a fluorescent (fluorophore) or chemiluminescent (chromophore) compound, such as fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase; an imaging agent; or a metal ion.

(38) In another embodiment, the detectable signal is detectable indirectly, for example, using a secondary antibody.

(39) In an embodiment, the tag is selected from a His tag, HA tag, FLAG tag, AviTag, Calmodulin tag, polyglutamate tag, Myc tag, S-tag, SBP tag, strep-tag, V5-tag, GFP-tag, GST-tag, and thioredoxin-tag.

(40) Another aspect includes an antibody that specifically binds CBCAS, for example as shown in SEQ ID NO: 2 or 6.

(41) In aspects, the antibody is a purified or isolated antibody. By purified or isolated is meant that a given antibody or fragment thereof, whether one that has been removed from nature (isolated from blood serum) or synthesized (produced by recombinant means), has been increased in purity, wherein purity is a relative term, not absolute purity. In particular aspects, a purified antibody is 60% free, preferably at least about 75% free, and more preferably at least about 90% free from other components with which it is naturally associated or associated following synthesis.

(42) A further aspect of the disclosure includes a composition comprising a nucleic acid, construct, polypeptide, antibody or fragment thereof and/or a cell described herein. The composition can comprise for example a suitable carrier, diluent or additive. For example, wherein the composition comprises an antibody or fragment thereof, the suitable carrier can be a protein such as BSA.

(43) In an embodiment, the composition comprises an isolated nucleic acid, isolated construct, isolated polypeptide, isolated antibody or fragment thereof and/or an isolated cell described herein, optionally in combination with a suitable carrier, diluent or additive.

(44) In an embodiment, the composition is a purified extract, for example of a recombinant cell or recombinant organism described herein, such as a recombinant plant extract comprising an increased level of one or more cannabinoids and/or CBCAS. In an embodiment, the recombinant plant extract comprises an increased level of one or more cannabinoids such as CBCA or CBC. Accordingly, an aspect includes a cannabinoid or a composition comprising a cannabinoid such as CBCA or CBC, produced according to a method or system described herein.

(45) In an embodiment, the purified extract comprises the culture supernatant of a recombinant organism culture, for example a recombinant yeast cell culture wherein the CBCAS is secreted into the culture supernatant.

(46) Also provided in another aspect is a fermentation system comprising a recombinant organism or cell, for example a recombinant yeast cell. The system can comprise CBGA and/or other substrates in combination with one or more enzymes or cells expressing one or more enzymes in the cannabinoid pathway.

(47) Some embodiments relate to a construct or in vitro expression system containing an isolated or purified nucleic acid molecule having at least, greater than or about 78% or more optionally at least, greater than or about 96% sequence identity to SEQ ID NO: 1, 5, 8 or 9, optionally comprising a heterologous moiety. Accordingly, there is provided a method for preparing a construct or in vitro expression system including such a sequence, or a fragment thereof, for introduction of the sequence or partial sequence in a sense or anti-sense orientation, or a complement thereof, into a cell.

(48) As used herein a vector refers to a nucleic acid used to transfer a nucleic acid (often recombinant) into a host cell.

(49) As used herein construct refers to an artificially created nucleic acid, comprising a delivery vector and a polynucleotide of interest, for example a vector comprising a polynucleotide described herein. The polynucleotide of interest can be cloned into a vector of interest to produce a construct.

(50) In an embodiment, the vector is an expression vector. Possible expression vectors include but are not limited to cosmids, plasmids, or modified viruses (e.g. replication defective retroviruses, adenoviruses and adeno-associated viruses), so long as the vector is compatible with the host cell used. The expression vectors are suitable for transformation of a host cell, which means that the expression vectors contain a nucleic acid molecule of the application and regulatory sequences selected on the basis of the host cells to be used for expression, which is operatively linked to the nucleic acid molecule. Operatively linked is intended to mean that the nucleic acid is linked to regulatory sequences in a manner which allows expression of the nucleic acid.

(51) In some embodiments, the isolated and/or purified nucleic acid molecules, polynucleotides or vectors, constructs or in vitro expression systems comprising these isolated and/or purified nucleic acid molecules, may be used to create transgenic or recombinant organisms or recombinant cells (e.g. optionally cells of recombinant organisms) that produce polypeptides with cannabichromenic acid synthase activity and/or modulated levels of polypeptides with cannabichromenic acid synthase activity.

(52) Therefore, one embodiment relates to a recombinant organism, host cell or germ tissue (e.g. seed) of the organism comprising a nucleic acid molecule having at least 15 contiguous nucleotides of SEQ ID NO:1 and 5 and optionally at least about 96% sequence identity to SEQ ID NO: 1 or 5 and/or a construct comprising said isolated and/or purified nucleic acid molecule.

(53) In an embodiment, the recombinant organism, cell and/or germ tissue expresses a polypeptide having at least and/or up to about 150, about 175, about 200, about 225, or about 250 amino acids of the polypeptide sequence and optionally at least about 96% sequence identity to as set forth in SEQ ID NO:2 or 6.

(54) The recombinant expression vectors may also contain nucleic acid sequences which encode a heterologous polypeptide (e.g. fusion moiety) producing a fusion polypeptide when a nucleic acid of interest encoding a polypeptide is introduced into the vector in frame. The heterologous polypeptide can provide for increased expression of the recombinant protein; increased solubility of the recombinant protein; and/or aid in the purification of the target recombinant protein by acting as a ligand in affinity purification. For example, a proteolytic cleavage site may be added between the target recombinant protein to allow separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion polypeptide. Typical fusion expression vectors include pGEX (Amrad Corp., Melbourne, Australia), pMal (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the recombinant protein.

(55) Preferably, the recombinant organism is a recombinant plant, recombinant multicellular microorganism or recombinant insect. Plants are preferably of the genus Cannabis, for example Cannabis sativa L., Cannabis indica Lam. and Cannabis ruderalis Janisch, especially Cannabis sativa. Microorganisms are preferably bacteria (e.g. Escherichia coli) or yeast (e.g. Saccharomyces cerevisiae, Pichia pastoris). Microorganisms that are unicellular can be considered organisms or cells, including host cells. Insect is preferably Spodoptera frugiperda.

(56) Cannabis plants containing the CBCAS nucleotide sequence may be created via known plant transformation methods for example Agrobacterium-mediated transformation, transformation via particle bombardment, pollen tube or protoplast transformation. In these methodological approaches, the gene of interest is incorporated into the genome of the target organism. For example, tissue culture and Agrobaterium mediated transformation of hemp is described in Feeney and Punja, 2003.

(57) Recombinant expression vectors can be introduced into host cells to produce a transformed host cell. Prokaryotic and/or eukaryotic cells can be transformed with nucleic acid by, for example, electroporation or calcium chloride-mediated transformation. For example, nucleic acid can be introduced into mammalian cells via conventional techniques such as calcium phosphate or calcium chloride co-precipitation, DEAE-dextran mediated transfection, lipofectin, viral mediated methods, electroporation or microinjection. Suitable methods for transforming and transfecting cells can be found in Sambrook et al. (Molecular Cloning: A Laboratory Manual, 3rd Edition, Cold Spring Harbor Laboratory Press, 2001), and other laboratory textbooks.

(58) Suitable host cells include a wide variety of eukaryotic cells and prokaryotic cells. For example, the nucleic acids and proteins of the disclosure may be expressed in plant cells, yeast cells or mammalian cells. Plant cells are preferably of the genus Cannabis, for example Cannabis sativa L., Cannabis indica Lam. and Cannabis ruderalis Janisch, especially Cannabis sativa. Microorganisms are preferably bacteria (e.g. Escherichia coli) or yeast (e.g. Saccharomyces cerevisiae, Pichia pastoris). Insect cells are preferably Spodoptera frugiperda cells.

(59) Accordingly an embodiment includes a recombinant cell and in a preferred embodiment the recombinant cell is a recombinant plant cell. In another preferred embodiment, the recombinant cell is a recombinant yeast cell.

(60) Other suitable host cells can be found in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1991). In addition, the proteins of the disclosure may be expressed in prokaryotic cells, such as Escherichia coli (Zhang et al., Science 303(5656): 371-3 (2004)). In addition, a Pseudomonas-based expression system such as Pseudomonas fluorescens can be used (US Patent Application Publication No. US 2005/0186666).

(61) Accordingly, also provided herein is a recombinant cell comprising a nucleic acid molecule or polynucleotide of the disclosure. In an embodiment, the nucleic acid molecule results in an increased level of cannabichromenic acid synthase.

(62) Recombinant organisms, cells and germ tissues described herein may have altered levels of cannabinoid compounds. With reference to FIG. 1, it will be appreciated by one skilled in the art that expression or over-expression of the nucleic acid molecule will result in expression or over-expression of the cannabichromenic acid synthase enzyme which may result in increased production of cannabinoid compounds such as cannabichromenic acid and cannabichromene. Silencing of cannabichromenic acid synthase in an organism, cell or tissue will result in under-expression of the cannabichromenic acid synthase which may result in accumulation of higher amounts of cannabigerolic acid, cannabigerol, 9-tetrahydrocannabinolic acid, 9-tetrahydrocannabinol, cannabidiolic acid and cannabidiol or variants of these compounds having methyl or propyl sidechains. Germ tissues can include seeds, embryos or parts thereof comprising the isolated nucleic acid and/or polypeptide.

(63) Expression or over-expression of the nucleic acid molecule may be done in combination with expression or over-expression of one or more other nucleic acids that encode one or more other enzymes in a cannabinoid biosynthetic pathway. Some examples of other nucleic acids include: nucleic acids that encode an hexanoyl-CoA synthetase, tetraketide synthase, olivetolic acid cyclase, a THCA synthase, a CBDA synthase and/or an aromatic prenyltransferase (e.g. CsPT1).

(64) Expression or over-expression of the cannabichromenic acid synthase enzyme of the present disclosure compared to a control which has normal levels of the enzyme for the same variety grown under similar or identical conditions will result in increased levels of cannabinoid compounds, for example, about 1-about 20%, about 2-about 20%, about 5-about 20%, about 10-about 20%, about 15-about 20%, about 1-about 15%, about 1-about 10%, about 2-about 15%, about 2-about 10%, about 5-about 15%, or about 10-about 15% (w/w).

(65) Accordingly, another aspect includes a method of altering levels of cannabinoid compounds in an organism, cell or tissue, said method comprising using a nucleic acid molecule of the present disclosure or a fragment thereof, to silence and/or decrease expression of CBCAS in the organism, cell or tissue.

(66) In an embodiment, CBCA and CBC can be altered and/or produced in a cell or organism that produces CBGA, or in cells and organisms producing CBCA and/or CBC, the production of CBCA and/or CBC may be increased by making recombinant cells expressing CBCAS.

(67) Another aspect includes an in vitro method of producing CBCA comprising: contacting CBGA with CBCAS in a solution or an immobilized state under suitable conditions and for a suitable time to produce CBCA and/or CBC; and isolating and/or purifying the CBCA and/or CBC.

(68) The contacting can for example be achieved by mixing the CBGA with recombinant CBCAS in a solution and/or in an immobilized state under conditions and for a length of time suitable to convert at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% of the CBGA to CBCA.

(69) The solution optionally comprises MES, citrate or phosphate buffer, with the pH of the solution optionally between about pH 4 and about pH 6.5, or optionally about pH 4, about pH 4.5, about pH 5 about pH 5.5, about pH 6, or about pH 6.5.

(70) The in vitro assay is optionally carried out at a temperature between 35 C. and 50 C., or about any temperature there between (e.g. any 0.1 C. increment between about 35 C. and about 50 C.) optionally at about 35 C., about 40 C., about 45 C. or about 50 C.

(71) The CBCAS can be immobilized, for example, to a bead or column resin and used for example in in vitro systems.

(72) Cannabichromene (CBC), the decarboxylated product of CBCA, does not contribute significantly to the psychoactivity of marijuana but shows THC-like activity in a mouse tetrad model at high concentrations (DeLong et al., 2011). In addition, CBC has been reported to cause numerous pharmacological and biological effects including analgesia (Davis and Hatoum, 1983) and antinocieptin (Maione et al., 2011) and possesses anti-inflammatory (DeLong et al. 2011; Wirth et al., 1980; Izzo et al. 2012), antifungal (Elsohly and Turner, 1982), antibiotic (Elsohly and Turner, 1982) and antitumour (Ligresti et al. 2006) activities. A further aspect includes a method of producing CBCA and/or CBC and/or increasing production of CBCA and/or CBC the method comprising: i) introducing into a cell or organism producing CBGA, a vector comprising a nucleic acid comprising SEQ ID NO:1, 5, 8 or 9, or a fragment thereof retaining CBCAS activity, optionally having at least or about 78% or more optionally 96% sequence identity to SEQ ID NO: 1, 5, 8 or 9 to produce a recombinant cell or recombinant organism; ii) culturing the recombinant cell and/or growing the recombinant organism under conditions that permit expression of the nucleic acid; and optionally iii) isolating and/or purifying CBCA and/or CBC.

(73) The recombinant cell can be transiently expressing, inducibly expressing and/or stabley expressing.

(74) In an embodiment, the method comprises heating and/or storing the CBCA to produce CBC. Storing and/or heating CBCA increases decarboxylation to CBC. For example, thermal decarboxylation of THCA and CBDA have been shown to occur at temperatures >94 C. (Veress et al 1990). Accordingly in an embodiment the CBCA is heated to at least about 94 C., optionally for at least or about 20 min, at least or about 30 min, at least or about 40 min, at least or about 50 min or at least or about 60 minutes or longer. In another embodiment CBCA is heated to at least about 105 C., optionally for at least or about 10 min, at least or about 20 min, at least or about 30 min, at least or about 40 min, at least or about 50 min, or at least or about 60 min or longer. In another embodiment CBCA is heated to at least about 120 C., optionally for at least or about 10 min, at least or about 15 min, at least or about 20 min, at least or about 25 min, at least or about 30 min, at least or about 35 min, at least or about 40 min, at least or about 45 min, at least or about 50 min. In yet another embodiment CBCA is heated to at least about 140 C., optionally for at least or about 5 min, at least or about 10 min, at least or about 15 min, at least or about 20 min, or at least or about 25 min. In another embodiment the temperature is any 0.1 C. increment between about 94 C. and about 150 C. and the time of heating is any 1 min increment between about 3 and about 90 min.

(75) In an embodiment, neutral and acidic cannabinoids are isolated and/or purified. In an embodiment, neutral cannabinoids are isolated and/or purified. In an embodiment, acidic cannabinoids are isolated and/or purified. Another aspect includes a method of producing CBC and/or increasing CBC production, the method comprising: i) introducing into a cell or organism producing CBGA a vector comprising a nucleic acid comprising all or a fragment of SEQ ID NO:1, 5, 8 or 9, the fragment having CBCAS activity, optionally having at least about 96% identity to SEQ ID NO: 1, 5, 8 or 9 to produce a recombinant cell or recombinant organism; ii) culturing the recombinant cell and/or growing the recombinant organism under conditions that permit expression of the nucleic acid; iii) isolating CBCA; and iv) heating and/or storing the CBCA to produce CBC.

(76) In an embodiment, the cell is a plant cell. In an embodiment the plant cell is cannabis cell. In another embodiment, the cell is a non-cannabis cell.

(77) In cannabis plants the enhanced production of cannabinoids or the reduction/removal of cannabinoids could be achieved through breeding and selection as well as genetic engineering with the use of genes encoding the enzymes of cannabinoid biosynthetic pathways, e.g. the CBCA synthase gene in this disclosure. In addition, the biosynthetic pathway leading to cannabinoids may be transferred to bacteria, yeast, fungi or other heterologous organisms, or by in vitro biocatalysts, to produce cannabinoids without the need for the cannabis plant.

(78) In an embodiment, the organism is a plant. In an embodiment, the plant is cannabis plant.

(79) Nucleic acid isolation and cloning is well established. Similarly, an isolated gene may be inserted into a vector and transformed into a cell by conventional techniques. Nucleic acid molecules may be transformed into a cell and/or an organism. As known in the art, there are a number of ways by which genes, vectors and constructs can be introduced into cells and/or organisms, and a combination of transformation and tissue culture techniques have been successfully integrated into effective strategies for creating recombinant cells and/or organisms. These methods, which can be used herein have been described elsewhere (Potrykus, 1991; Vasil, 1994; Walden and Wingender, 1995; Songstad et al., 1995), and are well known to persons skilled in the art. Suitable vectors are well known to those skilled in the art and are described in general technical references such as Pouwels et al., (1986). Particularly suitable vectors include the Ti plasmid vectors. For example, one skilled in the art will certainly be aware that, in addition to Agrobacterium mediated transformation of Arabidopsis by vacuum infiltration (Bechtold, et al. 1993) or wound inoculation (Katavic et al., 1994), it is equally possible to transform other plant species, using Agrobacterium Ti-plasmid mediated transformation (e.g., hypocotyl (DeBlock et al., 1989) or cotyledonary petiole (Moloney et al., 1989) wound infection), particle bombardment/biolistic methods (Sanford et al., 1987; Nehra. et al., 1994; Becker et al., 1994) or polyethylene glycol-assisted, protoplast transformation (Rhodes et al., 1988; Shimamoto et al., 1989) methods.

(80) In an embodiment, the recombinant cell or organism is a transgenic cell or transgenic organism. In an embodiment, the recombinant cell or organism comprises an episome comprising the isolated polynucleotide.

(81) The recombinant expression vector in addition to containing a nucleic acid molecule or polynucleotide disclosed herein, may contain regulatory sequences for the transcription and translation of the inserted nucleic acid molecule.

(82) Suitable regulatory sequences may be derived from a variety of sources, including bacterial, fungal, viral, mammalian, or insect genes (For example, see the regulatory sequences described in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990)). Selection of appropriate regulatory sequences is dependent on the host cell chosen as discussed below, and may be readily accomplished by one of ordinary skill in the art. Examples of such regulatory sequences include: a transcriptional promoter and enhancer or RNA polymerase binding sequence, a ribosomal binding sequence, including a translation initiation signal. Additionally, depending on the host cell chosen and the vector employed, other sequences, such as an origin of replication, additional DNA restriction sites, enhancers, and sequences conferring inducibility of transcription may be incorporated into the expression vector.

(83) As will also be apparent to persons skilled in the art, and as described elsewhere (Meyer, 1995; Datla et al., 1997), it is possible to utilize promoters to direct any intended up- or down-regulation of transgene expression using constitutive promoters (e.g., those based on CaMV35S), or by using promoters which can target gene expression to particular cells, tissues (e.g., napin promoter for expression of transgenes in developing seed cotyledons), organs (e.g., roots, leaves), to a particular developmental stage, or in response to a particular external stimulus (e.g., heat shock).

(84) Promoters for use herein may be inducible, constitutive, or tissue-specific or have various combinations of such characteristics. Useful promoters include, but are not limited to constitutive promoters such as carnation etched ring virus (CERV), cauliflower mosaic virus (CaMV) 35S promoter, or more particularly the double enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in tandem (referred to as a Double 35S promoter). In an embodiment, the promoter is a promoter active in monocots, for example APX, SCP1, PGD1, R1G1B, or EIF5 promoter. It may be desirable to use a tissue-specific or developmentally regulated promoter instead of a constitutive promoter in certain circumstances. A tissue-specific promoter allows for over-expression in certain tissues without affecting expression in other tissues.

(85) The promoter and termination regulatory regions will be functional in the host cell and may be heterologous (that is, not naturally occurring) or homologous (derived from the plant host species) to the cell and the gene. Suitable promoters which may be used are described above.

(86) The termination regulatory region may be derived from the 3 region of the gene from which the promoter was obtained or from another gene. Suitable termination regions which may be used are well known in the art and include Agrobacterium tumefaciens nopaline synthase terminator (Tnos), A. tumefaciens mannopine synthase terminator (Tmas) and the CaMV 35S terminator (T35S). Particularly preferred termination regions for use herein include the pea ribulose bisphosphate carboxylase small subunit termination region (TrbcS) or the Tnos termination region. Such gene constructs may suitably be screened for activity by transformation into a host plant via Agrobacterium and screening for altered cannabinoid levels.

(87) The recombinant expression constructs of the disclosure may also contain a selectable marker gene which facilitates the selection of host cells transformed or transfected with a recombinant molecule of the application. Examples of selectable marker genes are genes encoding a protein such as G418 and hygromycin which confer resistance to certain drugs, -galactosidase, chloramphenicol acetyltransferase, firefly luciferase, or an immunoglobulin or portion thereof such as the Fc portion of an immunoglobulin, optionally IgG. Transcription of the selectable marker gene is monitored by changes in the concentration of the selectable marker protein such as -galactosidase, chloramphenicol acetyltransferase, or firefly luciferase. If the selectable marker gene encodes a protein conferring antibiotic resistance such as neomycin resistance transformant cells can be selected with G418. Cells that have incorporated the selectable marker gene will survive, while the other cells die. This makes it possible to visualize and assay for expression of recombinant expression constructs of the application and in particular to determine the effect of a mutation on expression and phenotype. It will be appreciated that selectable markers can be introduced on a separate vector from the nucleic acid of interest.

(88) The nucleic acid molecule or fragments thereof may be used to block cannabinoid biosynthesis in organisms that naturally produce cannabinoid compounds. Silencing using a nucleic acid molecule disclosed herein may be accomplished in a number of ways generally known in the art, for example, RNA interference (RNAi) techniques, artificial microRNA techniques, virus-induced gene silencing (VIGS) techniques, antisense techniques, sense co-suppression techniques and targeted mutagenesis techniques.

(89) RNAi techniques involve stable transformation using RNA interference (RNAi) plasmid constructs (Helliwell and Waterhouse, 2005). Such plasmids are composed of a fragment of the target gene to be silenced in an inverted repeat structure. The inverted repeats are separated by a spacer, often an intron. The RNAi construct driven by a suitable promoter, for example, the Cauliflower mosaic virus (CaMV) 35S promoter, is integrated into the plant genome and subsequent transcription of the transgene leads to an RNA molecule that folds back on itself to form a double-stranded hairpin RNA. This double-stranded RNA structure is recognized by the plant and cut into small RNAs (about 21 nucleotides long) called small interfering RNAs (siRNAs). siRNAs associate with a protein complex (RISC) which goes on to direct degradation of the mRNA for the target gene.

(90) Artificial microRNA (amiRNA) techniques exploit the microRNA (miRNA) pathway that functions to silence endogenous genes in plants and other eukaryotes (Schwab et al, 2006; Alvarez et al, 2006). In this method, about 21 nucleotide long fragments of the gene to be silenced are introduced into a pre-miRNA gene to form a pre-amiRNA construct. The pre-miRNA construct is transferred into the organism genome using transformation methods apparent to one skilled in the art. After transcription of the pre-amiRNA, processing yields amiRNAs that target genes which share nucleotide identity with the 21 nucleotide amiRNA sequence.

(91) In RNAi silencing techniques, two factors can influence the choice of length of the fragment. The shorter the fragment the less frequently effective silencing will be achieved, but very long hairpins increase the chance of recombination in bacterial host strains. The effectiveness of silencing also appears to be gene dependent and could reflect accessibility of target mRNA or the relative abundances of the target mRNA and the hpRNA in cells in which the gene is active. A fragment length of between about 100 and about 800 bp, preferably between about 300 and about 600 bp, is generally suitable to maximize the efficiency of silencing obtained. The other consideration is the part of the gene to be targeted. 5 UTR, coding region, and 3 UTR fragments can be used with equally good results. As the mechanism of silencing depends on sequence homology there is potential for cross-silencing of related mRNA sequences. Where this is not desirable a region with low sequence similarity to other sequences, such as a 5 or 3 UTR, should be chosen. The rule for avoiding cross-homology silencing appears to be to use sequences that do not have blocks of sequence identity of over about 20 bases between the construct and the non-target gene sequences. Many of these same principles apply to selection of target regions for designing amiRNAs.

(92) Virus-induced gene silencing (VIGS) techniques are a variation of RNAi techniques that exploits the endogenous antiviral defenses of plants. Infection of plants with recombinant VIGS viruses containing fragments of host DNA leads to post-transcriptional gene silencing for the target gene. In one embodiment, a tobacco rattle virus (TRV) based VIGS system can be used.

(93) Antisense techniques involve introducing into a plant an antisense oligonucleotide that will bind to the messenger RNA (mRNA) produced by the gene of interest. The antisense oligonucleotide has a base sequence complementary to the gene's messenger RNA (mRNA), which is called the sense sequence. Activity of the sense segment of the mRNA is blocked by the anti-sense mRNA segment, thereby effectively inactivating gene expression. Application of antisense to gene silencing in plants is described in more detail by Stam et al., 2000.

(94) Sense co-suppression techniques involve introducing a highly expressed sense transgene into a plant resulting in reduced expression of both the transgene and the endogenous gene (Depicker et al., 1997). The effect depends on sequence identity between transgene and endogenous gene.

(95) Targeted mutagenesis techniques, for example TILLING (Targeting Induced Local Lesions IN Genomes) and delete-a-gene using fast-neutron bombardment, may be used to knockout gene function in an organism (Henikoff et al., 2004; Li et al., 2001). TILLING involves treating germplasm or individual cells with a mutagen to cause point mutations that are then discovered in genes of interest using a sensitive method for single-nucleotide mutation detection. Detection of desired mutations (e.g. mutations resulting in the inactivation of the gene product of interest) may be accomplished, for example, by sequencing methods. For example, oligonucleotide primers derived from the gene of interest may be prepared and PCR may be used to amplify regions of the gene of interest from organisms in the mutagenized population. Amplified mutant genes may be annealed to wild-type genes to find mismatches between the mutant genes and wild-type genes. Detected differences may be traced back to the organism which had the mutant gene thereby revealing which mutagenized organism will have the desired expression (e.g. silencing of the gene of interest). These organisms may then be selectively bred to produce a population having the desired expression. TILLING can provide an allelic series that includes missense and knockout mutations, which exhibit reduced expression of the targeted gene. TILLING is touted as a possible approach to gene knockout that does not involve introduction of transgenes, and therefore may be more acceptable to consumers. Fast-neutron bombardment induces mutations, i.e. deletions, in organism genomes that can also be detected using PCR in a manner similar to TILLING.

(96) Terms:

(97) To facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:

(98) As used herein, the term about will be understood by persons of ordinary skill in the art and will vary to some extent depending upon the context in which it is used. If there are uses of the term which are not clear to persons of ordinary skill in the art given the context in which it is used, about will mean up to plus or minus 10% of the particular term.

(99) Antibody: The term antibody as used herein is intended to include monoclonal antibodies, polyclonal antibodies, and chimeric antibodies. The antibody may be from recombinant sources and/or produced in transgenic animals.

(100) Antibody binding fragment: The term antibody binding fragment as used herein is intended to include Fab, Fab, F(ab)2, scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, and multimers thereof and bispecific antibody fragments. Antibodies can be fragmented using conventional techniques. For example, F(ab)2 fragments can be generated by treating the antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments. Papain digestion can lead to the formation of Fab fragments. Fab, Fab and F(ab)2, scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, bispecific antibody fragments and other fragments can also be synthesized by recombinant techniques.

(101) Antibodies may be monospecific, bispecific, trispecific or of greater multispecificity. Multispecific antibodies may immunospecifically bind to different epitopes of a cannabichromenic acid synthase and/or or a solid support material.

(102) Antibodies may be from any animal origin including birds and mammals (e.g., human, murine, donkey, sheep, rabbit, goat, guinea pig, camel, horse, or chicken).

(103) Antibodies may be prepared using methods known to those skilled in the art. Isolated native or recombinant polypeptides may be utilized to prepare antibodies. See, for example, Kohler et al. (1975) Nature 256:495-497; Kozbor et al. (1985) J. Immunol. Methods, 81:31-42; Cote et al. (1983) Proc Natl Acad Sci., 80:2026-2030; and Cole et al. (1984) Mol Cell Biol., 62:109-120, for the preparation of monoclonal antibodies; Huse et al. (1989) Science, 246:1275-1281, for the preparation of monoclonal Fab fragments; and, Pound (1998) Immunochemical Protocols, Humana Press, Totowa, N.J., for the preparation of phagemid or B-lymphocyte immunoglobulin libraries to identify antibodies.

(104) Codon degeneracy: It will be appreciated that this disclosure embraces the degeneracy of codon usage as would be understood by one of ordinary skill in the art and as illustrated in Table 1. Codon optimized sequences are provided in Example 8.

(105) TABLE-US-00001 TABLE 1 Codon Degeneracies Amino Acid Codons Ala/A GCT, GCC, GCA, GCG Arg/R CGT, CGC, CGA, CGG, AGA, AGG Asn/N AAT, AAC Asp/D GAT, GAC Cys/C TGT, TGC Gln/Q CAA, CAG Glu/E GAA, GAG Gly/G GGT, GGC, GGA, GGG His/H CAT, CAC Ile/I ATT, ATC, ATA Leu/L TTA, TTG, CTT, CTC, CTA, CTG Lys/K AAA, AAG Met/M ATG Phe/F TTT, TTC Pro/P CCT, CCC, CCA, CCG Ser/S TCT, TCC, TCA, TCG, AGT, AGC Thr/T ACT, ACC, ACA, ACG Trp/W TGG Tyr/Y TAT, TAC Val/V GTT, GTC, GTA, GTG START ATG STOP TAG, TGA, TAA

(106) Conservative substitutions: Furthermore, it will be understood by one skilled in the art that conservative substitutions may be made in the amino acid sequence of a polypeptide without disrupting the structure or function of the polypeptide. Conservative amino acid substitutions are accomplished by the skilled artisan by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another. Additionally, by comparing aligned sequences of homologous proteins from different species, conservative amino acid substitutions may be identified by locating amino acid residues that have been mutated between species without altering the basic functions of the encoded proteins. Table 2 provides an exemplary list of conservative substitutions.

(107) TABLE-US-00002 TABLE 2 Conservative Substitutions Type of Amino Acid Substitutable Amino Acids Hydrophilic Ala, Pro, Gly, Glu, Asp, Gln, Asn, Ser, Thr Sulphydryl Cys Aliphatic Val, Ile, Leu, Met Basic Lys, Arg, His Aromatic Phe, Tyr, Trp

(108) Complementary nucleotide sequence: Complementary nucleotide sequence of a sequence is understood as meaning any nucleic acid molecule whose nucleotides are complementary to those of sequence of the disclosure, and whose orientation is reversed (antiparallel sequence).

(109) Degree or percentage of sequence homology: The term degree or percentage of sequence homology refers to degree or percentage of sequence identity between two sequences after optimal alignment. Percentage of sequence identity (or degree of identity) is determined by comparing two optimally aligned sequences over a comparison window, where the portion of the peptide or polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.

(110) Fusion molecule: The term a fusion molecule refers to the linking of a peptide sequence derived from the extracellular domain or domains of the polypeptide having cannabichromenic acid synthase activity (SEQ ID NO:2 or 6) to a fusion partner and can be a direct or indirect linkage via a covalent or non-covalent linkage. The fusion partner may be linked to either the N-terminus or the C-terminus of the peptide sequence derived from cannabichromenic acid synthase (SEQ ID NO:2 or 6).

(111) Homologous isolated and/or purified sequence: Homologous isolated and/or purified sequence is understood to mean an isolated and/or purified sequence having a percentage identity with the bases of a nucleotide sequence, or the amino acids of a polypeptide sequence, of at least about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 99.6%, or about 99.7%. This percentage is purely statistical, and it is possible to distribute the differences between the two nucleotide sequences at random and over the whole of their length. Sequence identity can be determined, for example, by computer programs designed to perform single and multiple sequence alignments. It will be appreciated that this disclosure embraces the degeneracy of codon usage as would be understood by one of ordinary skill in the art. Furthermore, it will be understood by one skilled in the art that conservative substitutions may be made in the amino acid sequence of a polypeptide without disrupting the structure or function of the polypeptide. Conservative substitutions are accomplished by the skilled artisan by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another. Additionally, by comparing aligned sequences of homologous proteins from different species, conservative substitutions may be identified by locating amino acid residues that have been mutated between species without altering the basic functions of the encoded proteins.

(112) Increasing, decreasing, modulating, altering or the like: As will be appreciated by one of skill in the art, such terms refer to comparison to a similar variety grown under similar conditions but without the modification resulting in the increase, decrease, modulation or alteration. In some cases, this may be an untransformed control, a mock transformed control, or a vector-transformed control.

(113) Isolated: As will be appreciated by one of skill in the art, isolated refers to for example polypeptides or nucleic acids that have been isolated from their native environment, including but not limited to virus, proteins, glycoproteins, peptide derivatives or fragments or polynucleotides. For example the term isolated nucleic acid molecule as used herein refers to a nucleic acid substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized. An isolated nucleic acid is also substantially free of sequences, which naturally flank the nucleic acid (i.e. sequences located at the 5 and 3 ends of the nucleic acid) from which the nucleic acid is derived.

(114) In vitro expression system: The term in vitro expression system as used herein is understood to refer to reagents and components (e.g. in a kit) and/or solutions comprising said reagents and components for recombinant protein expression, wherein the in vitro expression system is cell free and includes optionally translation competent extracts of whole cells and/or other translation machinery reagents or components optionally in a solution, said reagents and components optionally including RNA polymerase, one or more regulatory protein factors, one or more transcription factors, ribosomes, and tRNA, optionally supplemented with cofactors and nucleotides, and the specific gene template of interest. Chemical based expression systems are also included, optionally using unnaturally occurring amino acids.

(115) In an embodiment, the in vitro expression system comprises a vector optionally with a 5 T7 promoter downstream of which the isolated polynucleotide is introduced.

(116) Polynucleotide, or nucleic acid molecule: Polynucleotide, or nucleic acid molecule will be understood as meaning double-stranded or single-stranded in the monomeric and dimeric (so-called in tandem) forms and the transcription products thereof, as well as complementary nucleic acid sequences. Polynucleotide and nucleic acid molecules includes a sequence of nucleoside or nucleotide monomers consisting of naturally occurring bases, sugars and intersugar (backbone) linkages. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof. The nucleic acid sequences of the present disclosure may be deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil. The sequences may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil; and xanthine and hypoxanthine. In an embodiment, the polynucleotide or nucleic acid molecule is a cDNA.

(117) Protein or polypeptide: Protein or polypeptide will be understood as meaning a sequence of amino acid residues encoded by a nucleic acid molecule. Within the context of the present application, a polypeptide of the disclosure may in one embodiment include various structural forms of the primary protein. For example, a polypeptide of the disclosure may be in the form of acidic or basic salts or in neutral form. In addition, individual amino acid residues may be modified by oxidation or reduction. The proteins and polypeptides of the present disclosure may also include truncations, analogs and homologs of the proteins and polypeptides as described herein having substantially the same function as the proteins or polypeptides of the present disclosure, such as having cannabichromenic acid synthase activity.

(118) Sequence identity: Two amino-acids or nucleotide sequences are said to be identical if the sequence of amino-acids or nucleotide residues in the two sequences is the same when aligned for maximum correspondence as described below. Sequence comparisons between two (or more) peptides or polynucleotides are typically performed by comparing sequences of two optimally aligned sequences over a segment or comparison window to identify and compare local regions of sequence similarity. Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman, Ad. App. Math 2: 482 (1981), by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48: 443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. (U.S.A.) 85: 2444 (1988), by computerized implementation of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by visual inspection.

(119) The definition of sequence identity given above is the definition that would be used by one of skill in the art. The definition by itself does not need the help of any algorithm, said algorithms being helpful only to achieve the optimal alignments of sequences, rather than the calculation of sequence identity.

(120) From the definition given above, it follows that there is a well defined and only one value for the sequence identity between two compared sequences which value corresponds to the value obtained for the best or optimal alignment.

(121) Fragment thereof: As used herein, the term fragment thereof interchangeably used with part refers to a nucleic acid or amino acid sequence comprising up to about 3, about 5, about 10, about 15, about 25, about 50, about 100, about 250 or about 500, contiguous residues of a nucleotide or amino acid sequence of interest, for example comprising up to about 3, about 5, about 10, about 15, about 25, about 50, about 100, about 200, about 250, about 300, about 400, about 500, about 600, about 700, about 800, about 900, about 1000, about 1100, about 1200, about 1300, about 1400, or about 1500 nucleotides of SEQ ID NO:1 or comprising up to about 3, about 5, about 10, about 15, about 25, about 50, about 100, about 200, about 250, about 300, about 400, or about 500 amino acids of SEQ ID NO: 2.

(122) Stringent hybridization: Hybridization under conditions of stringency with a nucleotide sequence is understood as meaning a hybridization under conditions of temperature and ionic strength chosen in such a way that they allow the maintenance of the hybridization between two fragments of complementary nucleic acid molecules. Homologs of the CBCAS gene described herein obtained from other organisms, for example plants, may be obtained by screening appropriate libraries that include the homologs, wherein the screening is performed with the nucleotide sequence of the specific CBCAS gene disclosed herein, or portions or probes thereof, or identified by sequence homology search using sequence alignment search programs such as BLAST, FASTA.

(123) The terms transformed with, transfected with, transformation and transfection are intended to encompass introduction of nucleic acid (e.g. a construct) into a cell by one of many possible techniques known in the art.

(124) A single-stranded nucleic acid molecule is complementary to another single-stranded nucleic acid molecule when it can base-pair (hybridize) with all or a portion of the other nucleic acid molecule to form a double helix (double-stranded nucleic acid molecule), based on the ability of guanine (G) to base pair with cytosine (C) and adenine (A) to base pair with thymine (T) or uridine (U).

(125) In understanding the scope of the present disclosure, the term comprising and its derivatives, as used herein, are intended to be open ended terms that specify the presence of the stated features, elements, components, groups, integers, and/or steps, but do not exclude the presence of other unstated features, elements, components, groups, integers and/or steps. The foregoing also applies to words having similar meanings such as the terms, including, having and their derivatives. Finally, terms of degree such as substantially, about and approximately as used herein mean a reasonable amount of deviation of the modified term such that the end result is not significantly changed. These terms of degree should be construed as including a deviation of at least 10% of the modified term if this deviation would not negate the meaning of the word it modifies

(126) In understanding the scope of the present disclosure, the term consisting and its derivatives, as used herein, are intended to be close ended terms that specify the presence of stated features, elements, components, groups, integers, and/or steps, and also exclude the presence of other unstated features, elements, components, groups, integers and/or steps.

(127) The recitation of numerical ranges by endpoints herein includes all numbers and fractions subsumed within that range (e.g. about 1 to about 5 includes 1, 1.5, 2, 2.75, 3, 3.90, 4, and 5). It is also to be understood that all numbers and fractions thereof are presumed to be modified by the term about. Further, it is to be understood that a, an, and the include plural referents unless the content clearly dictates otherwise.

(128) Further, the definitions and embodiments described in particular sections are intended to be applicable to other embodiments herein described for which they are suitable as would be understood by a person skilled in the art. For example, in the following passages, different aspects of the invention are defined in more detail. Each aspect so defined may be combined with any other aspect or aspects unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous. The above disclosure generally describes the present application. A more complete understanding can be obtained by reference to the following specific examples. These examples are described solely for the purpose of illustration and are not intended to limit the scope of the application. Changes in form and substitution of equivalents are contemplated as circumstances might suggest or render expedient. Although specific terms have been employed herein, such terms are intended in a descriptive sense and not for purposes of limitation.

(129) All publicly available documents referenced herein, including but not limited to US patents, are specifically incorporated by reference.

(130) The following non-limiting examples are illustrative of the present disclosure:

EXAMPLES

Example 1: Identification of CBCA Synthase in the Cannabis Genome

(131) The cannabis genome sequence (van Bakel et al., 2011) was analyzed for genes with high similarity to THCA synthase using BLAST analysis. This led to the identification of a gene with 96% nucleotide similarity to THCA synthase. Based on subsequent biochemical characterization, the authors named this gene Cannabis sativa cannabichromenic acid synthase (CBCAS).

(132) The cDNA sequence of Cannabis sativa cannabichromenic acid synthase (CBCAS)1635 bp is provided in SEQ ID NO:1. Underlined sequence relates to the sequence deleted in SEQ ID NO:5. SEQ ID NO: 1 can comprise the full sequence or deleted of replicates of 3 in the underlined sequence and/or the first ATG to maintain coding frame.

(133) TABLE-US-00003 ATGAATTGCTCAACATTCTCCTTTTGGTTTGTTTGCAAAATAATATTTTT CTTTCTCTCATTCAATATCCAAATTTCAATAGCTAATCCTCAAGAAAACT TCCTTAAATGCTTCTCGGAATATATTCCTAACAATCCAGCAAATCCAAAA TTCATATACACTCAACACGACCAATTGTATATGTCTGTCCTGAATTCGAC AATACAAAATCTTAGATTCACCTCTGATACAACCCCAAAACCACTCGTTA TTGTCACTCCTTCAAATGTCTCCCATATCCAGGCCAGTATTCTCTGCTCC AAGAAAGTTGGTTTGCAGATTCGAACTCGAAGCGGTGGCCATGATGCTGA GGGTTTGTCCTACATATCTCAAGTCCCATTTGCTATAGTAGACTTGAGAA ACATGCATACGGTCAAAGTAGATATTCATAGCCAAACTGCGTGGGTTGAA GCCGGAGCTACCCTTGGAGAAGTTTATTATTGGATCAATGAGATGAATGA GAATTTTAGTTTTCCTGGTGGGTATTGCCCTACTGTTGGCGTAGGTGGAC ACTTTAGTGGAGGAGGCTATGGAGCATTGATGCGAAATTATGGCCTTGCG GCTGATAATATCATTGATGCACACTTAGTCAATGTTGATGGAAAAGTTCT AGATCGAAAATCCATGGGAGAAGATCTATTTTGGGCTATACGTGGTGGAG GAGGAGAAAACTTTGGAATCATTGCAGCATGTAAAATCAAACTTGTTGTT GTCCCATCAAAGGCTACTATATTCAGTGTTAAAAAGAACATGGAGATACA TGGGCTTGTCAAGTTATTTAACAAATGGCAAAATATTGCTTACAAGTATG ACAAAGATTTAATGCTCACGACTCACTTCAGAACTAGGAATATTACAGAT AATCATGGGAAGAATAAGACTACAGTACATGGTTACTTCTCTTCCATTTT TCTTGGTGGAGTGGATAGTCTAGTTGACTTGATGAACAAGAGCTTTCCTG AGTTGGGTATTAAAAAAACTGATTGCAAAGAATTGAGCTGGATTGATACA ACCATCTTCTACAGTGGTGTTGTAAATTACAACACTGCTAATTTTAAAAA GGAAATTTTGCTTGATAGATCAGCTGGGAAGAAGACGGCTTTCTCAATTA AGTTAGACTATGTTAAGAAACTAATACCTGAAACTGCAATGGTCAAAATT TTGGAAAAATTATATGAAGAAGAGGTAGGAGTTGGGATGTATGTGTTGTA CCCTTACGGTGGTATAATGGATGAGATTTCAGAATCAGCAATTCCATTCC CTCATCGAGCTGGAATAATGTATGAACTTTGGTACACTGCTACCTGGGAG AAGCAAGAAGATAACGAAAAGCATATAAACTGGGTTCGAAGTGTTTATAA TTTCACAACTCCTTATGTGTCCCAAAATCCAAGATTGGCGTATCTCAATT ATAGGGACCTTGATTTAGGAAAAACTAATCCTGAGAGTCCTAATAATTAC ACACAAGCACGTATTTGGGGTGAAAAGTATTTTGGTAAAAATTTTAACAG GTTAGTTAAGGTGAAAACCAAAGCTGATCCCAATAATTTTTTTAGAAACG AACAAAGTATCCCACCTCTTCCACCGCGTCATCAT
The corresponding amino acid sequence of the open reading form of Cannabis sativa cannabichromenic acid synthase (CBCAS)545 aa is provided in SEQ ID NO:2 (and can include all or part of the first 28 amino acids).

(134) TABLE-US-00004 MNCSTFSFWFVCKIIFFFLSFNIQISIANPQENFLKCFSEYIPNNPANPK FIYTQHDQLYMSVLNSTIQNLRFTSDTTPKPLVIVTPSNVSHIQASILCS KKVGLQIRTRSGGHDAEGLSYISQVPFAIVDLRNMHTVKVDIHSQTAWVE AGATLGEVYYWINEMNENFSFPGGYCPTVGVGGHFSGGGYGALMRNYGLA ADNIIDAHLVNVDGKVLDRKSMGEDLFWAIRGGGGENFGIIAACKIKLVV VPSKATIFSVKKNMEIHGLVKLFNKWQNIAYKYDKDLMLTTHFRTRNITD NHGKNKTTVHGYFSSIFLGGVDSLVDLMNKSFPELGIKKTDCKELSWIDT TIFYSGVVNYNTANFKKEILLDRSAGKKTAFSIKLDYVKKLIPETAMVKI LEKLYEEEVGVGMYVLYPYGGIMDEISESAIPFPHRAGIMYELWYTATWE KQEDNEKHINWVRSVYNFTTPYVSQNPRLAYLNYRDLDLGKTNPESPNNY TQARIWGEKYFGKNFNRLVKVKTKADPNNFFRNEQSIPPLPPRHH

Example 2: Cloning and Expression of CBCAS

(135) CBCAS was amplified from a cannabis genomic DNA fragment using the primers 5-CTGCAGGAATGAATTGCTCAACATTCTCCT-3 (SEQ ID NO: 3) AND 5-AAGCTTTCATGGTACCCCATGATGACGCGGTGGAAGA-3 (SEQ ID NO: 4). The 50 L reaction contained 100 ng of template, 0.2 M of each primer, Pfu Ultrall DNA polymerase, 1 Pfu reaction buffer and 0.4 M dNTPs. The cycling conditions were 95 C. for 20 s, 55 C. for 20 s, and 75 C. for 2 min. The product was purified, A-tailed with Taq polymerase, and cloned into pCR8/GW/TOPO entry vector (Invitrogen). Individual colonies were isolated, grown in LB media supplemented with spectinomycin, plasmid DNA was isolated using a Qiagen QiaPrep kit and verified by Sanger sequencing. The CBCAS ORF was excised using Pstl and Kpnl, isolated by gel electrophoresis, and cloned into IPICzC (Invitrogen) that had been cut with the same restriction enzymes and dephosphorylated. The entire CBCA synthase coding sequence, including the native N-terminal secretory signal, was used in the construction of the Pichia expression vector.

(136) The enzyme was expressed as an N-terminal fusion product with the vector encoded alpha-factor signal peptide to ensure protein secretion from the Pichia cells. IPICzC:CBCAS was transformed into Pichia pastoris strain X33 (Invitrogen) by electroporation. Phleomycin-resistant colonies were selected and streaked onto minimal methanol plates, from which single colonies were picked and used to inoculate 50 mL of modified BMGY medium (1% yeast extract, 2% peptone, 50 mP HEPES pH 6, 1.34% yeast nitrogen base, 410.sup.5% biotin, 1% glycerol) which was grown for two days. Approximately 20 mL of this culture was used to inoculate 400 mL of modified BMMY medium (1% yeast extract, 2% peptone, 50 mM HEPES pH 7, 1.34% yeast nitrogen base, 410.sup.5% biotin, 1% methanol, 0.0001% riboflavin) to an approximate initial OD600 of 1. The culture was grown for four days at 20 C. with shaking at 90 RPM. Methanol was added every 24 h to a final concentration of 1%. After four days, the cells were removed from the medium by centrifugation (13k g for 20 min) and the clarified medium was passed through a 2 m filter and stored on ice. 100 mL was passed through hydroxyapatite cartridge (BioRad Bio-Scale Mini CHT Type 1, 40 m media) at 90 mL h.sup.1 that had been previously equilibrated with 5 CV of 10 mM sodium phosphate pH 7. Two cartridges were processed as such in parallel. The cartridges were washed with 5 column volumes of 10 mM sodium phosphate pH 7, and were then installed in series of an FLCP system (Akta, Amersham Biosciences). Proteins were eluted from the cartridges with a linear gradient of 10 mM sodium phosphate pH 7 to 100% 500 mM sodium phosphate pH over 7 over 20 column volumes at a flow rate of 1.75 mL min.sup.1. Five mL fractions were collected. After re-equilibrating the hydroxyapatite cartridges, the remaining medium was processed as above, and the fractions were then pooled and tested for CBCAS activity.

Example 3: CBCAS Assays

(137) Reactions using media were performed by incubating 10 mols CBGA in 500 L of clarified culture media for 14 h. Reactions using hydroxyl-apatite fractions were performed with 100 L of the fraction incubated with 10 nmols of CBGA for 14 h. Completed reactions were acidified with one drop of 4 N HCl and extracted twice with 400 L of acetonitrile. After centrifugation, the organic phases were pooled and evaporated to dryness. Products were resuspended in 20 L of 50% methanol, of which 10 L was analyzed by LCMS. Products were separated with a Waters Alliance HPLC using a binary solvent system (solvent A: 10% acetonitrile, 0.05% formic acid; solvent B: 99.95% acetonitrile, 0.05% formic acid) and an Ascnetis C18 5 cm2.1 mm 2.7 m column (Sigma). Initial conditions: 55% A at 0.25 mL/min. Ramp to 5% A from 0-8 min, hold at 5% A for 2.5 min, return to initial conditions over 2 min and equilibrate at initial conditions for 7 min. Ultraviolet spectra were obtained using photodiode array detection at 200-350 nm.

(138) As shown in FIG. 2, recombinant CBCAS catalyzed the formation of CBCA from CBGA. As shown in FIG. 3, the recombinant CBCAS has an apparent mass of 63 kDa after treatment with endoglycosylase (Endo Hf). As shown in FIG. 4, recombinant CBCAS has a pH optimum of 5.5, a temperature optimum of 40 degrees and is inhibited by high concentrations of DMSO and Triton X-100.

(139) Activity for pH 3.5, 4, 4.5, 5, 5.5, 6, 6.5, and 7 were tested. There was activity between pH 4 and pH 6.5 in one or more buffers. Maximal activity was observed at pH 5 and 5.5. Activity for temperatures 35, 40, 45, and 50 C. were tested, with maximal activity observed at 40 C.

(140) The present gene encodes a CBCAS enzyme from cannabis. This gene could be used to create, through breeding of recombinant plants, targeted mutagenesis, or genetic engineering, cannabis plants with enhanced cannabinoid production. In addition, inactivating or silencing this gene in cannabis could be used to block cannabinoid biosynthesis and thereby reduce production of cannabinoids such as CBCA, the precursor of CBC, in cannabis plants (e.g. industrial hemp). This gene could be used, in combination with genes encoding other enzymes in the cannabinoid pathway, to engineer cannabinoid biosynthesis in other plants or in microorganisms.

Example 4

(141) Recombinant sequences lacking predicted signal sequence and comprising a start codon/start methionine

(142) TABLE-US-00005 SEQIDNO:5 ATG----------------------------------------------- -------------------------------------CCTCAAGAAAACT TCCTTAAATGCTTCTCGGAATATATTCCTAACAATCCAGCAAATCCAAAA TTCATATACACTCAACACGACCAATTGTATATGTCTGTCCTGAATTCGAC AATACAAAATCTTAGATTCACCTCTGATACAACCCCAAAACCACTCGTTA TTGTCACTCCTTCAAATGTCTCCCATATCCAGGCCAGTATTCTCTGCTCC AAGAAAGTTGGTTTGCAGATTCGAACTCGAAGCGGTGGCCATGATGCTGA GGGTTTGTCCTACATATCTCAAGTCCCATTTGCTATAGTAGACTTGAGAA ACATGCATACGGTCAAAGTAGATATTCATAGCCAAACTGCGTGGGTTGAA GCCGGAGCTACCCTTGGAGAAGTTTATTATTGGATCAATGAGATGAATGA GAATTTTAGTTTTCCTGGTGGGTATTGCCCTACTGTTGGCGTAGGTGGAC ACTTTAGTGGAGGAGGCTATGGAGCATTGATGCGAAATTATGGCCTTGCG GCTGATAATATCATTGATGCACACTTAGTCAATGTTGATGGAAAAGTTCT AGATCGAAAATCCATGGGAGAAGATCTATTTTGGGCTATACGTGGTGGAG GAGGAGAAAACTTTGGAATCATTGCAGCATGTAAAATCAAACTTGTTGTT GTCCCATCAAAGGCTACTATATTCAGTGTTAAAAAGAACATGGAGATACA TGGGCTTGTCAAGTTATTTAACAAATGGCAAAATATTGCTTACAAGTATG ACAAAGATTTAATGCTCACGACTCACTTCAGAACTAGGAATATTACAGAT AATCATGGGAAGAATAAGACTACAGTACATGGTTACTTCTCTTCCATTTT TCTTGGTGGAGTGGATAGTCTAGTTGACTTGATGAACAAGAGCTTTCCTG AGTTGGGTATTAAAAAAACTGATTGCAAAGAATTGAGCTGGATTGATACA ACCATCTTCTACAGTGGTGTTGTAAATTACAACACTGCTAATTTTAAAAA GGAAATTTTGCTTGATAGATCAGCTGGGAAGAAGACGGCTTTCTCAATTA AGTTAGACTATGTTAAGAAACTAATACCTGAAACTGCAATGGTCAAAATT TTGGAAAAATTATATGAAGAAGAGGTAGGAGTTGGGATGTATGTGTTGTA CCCTTACGGTGGTATAATGGATGAGATTTCAGAATCAGCAATTCCATTCC CTCATCGAGCTGGAATAATGTATGAACTTTGGTACACTGCTACCTGGGAG AAGCAAGAAGATAACGAAAAGCATATAAACTGGGTTCGAAGTGTTTATAA TTTCACAACTCCTTATGTGTCCCAAAATCCAAGATTGGCGTATCTCAATT ATAGGGACCTTGATTTAGGAAAAACTAATCCTGAGAGTCCTAATAATTAC ACACAAGCACGTATTTGGGGTGAAAAGTATTTTGGTAAAAATTTTAACAG GTTAGTTAAGGTGAAAACCAAAGCTGATCCCAATAATTTTTTTAGAAACG AACAAAGTATCCCACCTCTTCCACCGCGTCATCAT -dashesrepresentdeletedsequence SEQIDNO:6 M---------------------------NPQENFLKCFSEYIPNNPANPK FIYTQHDQLYMSVLNSTIQNLRFTSDTTPKPLVIVTPSNVSHIQASILCS KKVGLQIRTRSGGHDAEGLSYISQVPFAIVDLRNMHTVKVDIHSQTAWVE AGATLGEVYYWINEMNENFSFPGGYCPTVGVGGHFSGGGYGALMRNYGLA ADNIIDAHLVNVDGKVLDRKSMGEDLFWAIRGGGGENFGIIAACKIKLVV VPSKATIFSVKKNMEIHGLVKLFNKWQNIAYKYDKDLMLTTHFRTRNITD NHGKNKTTVHGYFSSIFLGGVDSLVDLMNKSFPELGIKKTDCKELSWIDT TIFYSGVVNYNTANFKKEILLDRSAGKKTAFSIKLDYVKKLIPETAMVKI LEKLYEEEVGVGMYVLYPYGGIMDEISESAIPFPHRAGIMYELWYTATWE KQEDNEKHINWVRSVYNFTTPYVSQNPRLAYLNYRDLDLGKTNPESPNNY TQARIWGEKYFGKNFNRLVKVKTKADPNNFFRNEQSIPPLPPRHH PredictedNterminalsignalpeptide: SEQIDNO:7 MNCSTFSFWFVCKIIFFFLSFNIQISIA

Example 5

(143) Codon optimized sequences were generated for E. coli and yeast. E. coli Optimized sequence

(144) TABLE-US-00006 SEQIDNO:8) ATGAACTGCTCGACATTTAGTTTTTGGTTTGTGTGCAAGA TCATTTTTTTTTTTCTTTCGTTTAACATTCAGATTAGTAT TGCAAACCCGCAGGAGAACTTTCTCAAATGTTTTAGCGAA TATATCCCGAACAACCCGGCCAACCCGAAATTCATTTACA CACAACACGATCAACTGTACATGAGCGTATTGAACAGCAC CATCCAGAATTTGCGCTTTACTTCGGACACAACGCCGAAG CCTCTGGTCATCGTTACGCCCTCGAATGTTTCACATATCC AAGCGTCAATTCTTTGTTCTAAAAAGGTCGGCCTGCAGAT TCGCACACGGTCGGGCGGCCATGATGCCGAAGGTCTGTCT TACATCTCACAAGTCCCTTTCGCAATCGTTGATTTGCGGA ACATGCACACTGTAAAAGTTGATATTCACTCACAAACCGC TTGGGTCGAAGCAGGTGCCACGCTTGGGGAAGTATATTAC TGGATTAACGAAATGAACGAGAATTTCTCGTTTCCAGGCG GTTACTGCCCAACCGTAGGTGTGGGCGGTCATTTTTCCGG AGGCGGTTATGGTGCGTTAATGCGCAACTATGGCCTGGCG GCAGACAATATTATTGATGCCCACCTCGTTAATGTGGATG GTAAAGTACTGGATCGCAAATCAATGGGTGAAGACCTCTT CTGGGCGATTCGTGGTGGGGGTGGCGAGAACTTTGGTATC ATCGCGGCATGTAAGATCAAGCTGGTGGTAGTTCCGTCTA AAGCGACCATCTTTAGCGTGAAAAAAAACATGGAGATTCA CGGCCTGGTAAAATTGTTCAACAAATGGCAGAACATCGCT TACAAATACGACAAAGATCTGATGTTAACGACTCACTTCC GCACCCGTAACATTACTGACAATCACGGCAAAAATAAGAC TACTGTGCATGGTTACTTTAGTAGTATCTTCCTGGGTGGA GTCGATTCCCTGGTCGATTTAATGAACAAGAGCTTTCCGG AGCTGGGGATTAAAAAAACCGACTGTAAAGAGCTGAGTTG GATCGACACGACGATCTTCTACAGCGGAGTAGTCAACTAC AACACTGCCAACTTTAAGAAAGAAATTCTGCTGGACCGCA GCGCAGGTAAAAAGACCGCCTTCTCCATCAAACTGGATTA CGTCAAAAAGCTGATTCCGGAAACAGCAATGGTAAAGATT CTGGAAAAACTGTATGAAGAAGAGGTTGGCGTTGGCATGT ATGTCTTATATCCGTATGGGGGCATTATGGATGAAATTTC TGAAAGTGCTATTCCCTTCCCACACCGCGCGGGGATTATG TACGAACTGTGGTATACGGCCACGTGGGAAAAACAAGAGG ACAATGAGAAACACATCAACTGGGTTCGGTCAGTATATAA CTTTACCACCCCGTATGTCTCGCAGAACCCGCGTCTGGCG TATCTGAACTATCGCGATCTTGATTTGGGTAAAACCAATC CGGAAAGCCCGAATAACTACACCCAGGCACGCATTTGGGG GGAAAAATATTTCGGGAAAAACTTCAACCGGCTGGTGAAG GTGAAAACGAAGGCTGACCCGAATAACTTTTTTCGGAATG AACAAAGCATTCCGCCGTTACCGCCGCGCCACCAC The E. coli optimized sequence shares 75% sequence identity with SEG ID NO: 1 Saccharomyces (yeast) Optimized sequence

(145) TABLE-US-00007 (SEQIDNO:9) ATGAATTGTAGTACTTTCTCTTTCTGGTTTGTTTGTAAGA TTATATTTTTTTTTCTTAGTTTCAATATACAAATTTCAAT TGCAAACCCTCAAGAAAATTTCCTTAAGTGCTTTTCAGAA TATATCCCTAATAATCCTGCAAACCCTAAATTCATTTATA CACAACATGATCAGTTATATATGTCTGTCTTAAACTCTAC CATTCAAAATTTGAGGTTCACGTCTGATACAACCCCAAAG CCTTTAGTTATCGTGACACCCTCTAACGTTAGTCATATTC AGGCTAGTATCTTATGTTCAAAAAAAGTGGGTTTACAAAT CAGAACTAGGTCTGGTGGTCATGACGCGGAAGGTCTGTCT TACATATCTCAGGTGCCGTTTGCAATCGTTGATCTACGTA ATATGCATACAGTTAAAGTCGATATTCACTCTCAAACTGC ATGGGTCGAGGCTGGTGCCACTCTAGGTGAAGTTTATTAC TGGATCAATGAAATGAACGAGAATTTTTCCTTCCCAGGTG GTTATTGTCCTACTGTGGGTGTAGGCGGACACTTTTCTGG CGGGGGGTATGGTGCTTTGATGAGGAACTATGGTTTGGCC GCCGATAATATAATTGACGCCCATCTTGTAAACGTCGACG GGAAGGTTCTGGACCGTAAATCTATGGGTGAAGATTTATT CTGGGCGATAAGAGGTGGCGGGGGAGAGAACTTTGGTATT ATCGCAGCTTGTAAGATTAAGTTAGTTGTTGTCCCCTCAA AAGCAACAATTTTTTCAGTGAAGAAGAACATGGAAATCCA CGGTTTGGTAAAACTGTTTAATAAATGGCAGAATATTGCC TACAAATACGATAAGGATTTGATGTTGACAACACATTTCA GAACTAGAAATATTACTGACAACCACGGAAAGAACAAGAC AACCGTCCATGGATATTTTAGTTCTATTTTCTTAGGCGGA GTTGATTCACTAGTAGACTTAATGAACAAGTCTTTCCCCG AATTGGGAATAAAAAAAACCGATTGCAAGGAATTATCCTG GATAGATACAACAATATTCTACTCTGGAGTCGTTAATTAT AATACGGCCAACTTTAAGAAGGAAATATTATTAGATCGTT CCGCAGGTAAAAAGACAGCTTTTTCCATAAAATTGGACTA CGTCAAAAAATTAATTCCTGAGACAGCCATGGTAAAAATA TTGGAAAAATTGTACGAAGAGGAGGTAGGCGTGGGTATGT ATGTGTTATACCCATACGGTGGTATTATGGATGAAATTTC TGAGAGCGCTATTCCCTTCCCCCATCGTGCAGGTATAATG TATGAATTATGGTACACAGCAACATGGGAAAAACAAGAGG ATAACGAAAAGCATATTAATTGGGTACGTAGTGTGTACAA CTTTACGACACCTTACGTGTCCCAAAATCCAAGATTAGCG TATTTGAACTATAGAGACTTAGATTTAGGTAAAACAAACC CTGAGTCTCCAAATAATTACACCCAAGCCAGGATTTGGGG TGAAAAATACTTCGGCAAAAATTTCAATAGATTGGTTAAG GTAAAAACTAAGGCGGATCCAAACAATTTTTTTAGAAATG AGCAGAGTATTCCGCCCCTGCCTCCAAGACACCAT The yeast optimized sequence shares 78% sequence identity with SEQ ID NO:1. Other advantages that are inherent to the structure are obvious to one skilled in the art. The embodiments are described herein illustratively and are not meant to limit the scope of the invention as claimed. Variations of the foregoing embodiments will be evident to a person of ordinary skill and are intended by the inventor to be encompassed by the following claims.

REFERENCES

(146) Alvarez J P, Pekker I, Goldshmidt A, Blum E, Amsellem Z, Eshed Y (2006) Endogenous and synthetic microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets in diverse species. Plant Cell 18:1134-51.

(147) van Bakel, H., Stout, J. M., Cote, A. G., Tallon, C. M., Sharpe, A. G., Hughes, T. R., & Page, J. E. (2011). The draft genome and transcriptome of Cannabis sativa. Genome Biology, 12(10), R102.

(148) Bechtold N, Ellis J, Pelletier G (1993) In planta Agrobacterium-mediated gene transfer by infiltration of adult Arabidopsis thaliana plants. C R Acad Sci Paris, Sciences de la vie/Life sciences 316: 1194-1199.

(149) Becker D, Brettschneider R, Lorz H (1994) Fertile transgenic wheat from microprojectile bombardment of scutellar tissue. Plant J. 5: 299-307.

(150) Bourrie, M (2003) Hemp: A Short History of the Most Misunderstood Plant and Its Uses and Abuses (Key Porter, Toronto).

(151) Collakova E, DellaPenna D (2001) Isolation and functional analysis of homogentisate phytyltransferase from Synechocystis sp. PCC 6803 and Arabidopsis. Plant Physiol 127: 1113-1124.

(152) Datla R, Anderson J W, Selvaraj G (1997) Plant promoters for transgene expression. Biotechnology Annual Review 3: 269-296.

(153) Davis, W. M., & Hatoum, N. S. (1983). Neurobehavioral actions of cannabichromene and interactions with delta 9-tetrahydrocannabinol. General Pharmacology, 14(2), 247-52.

(154) DeBlock M, DeBrouwer D, Tenning P (1989) Transformation of Brassica napus and Brassica oleracea using Agrobacterium tumefaciens and the expression of the bar and neo genes in the transgenic plants. Plant Physiol. 91: 694-701.

(155) DeLong, G. T., Wolf, C. E., Poklis, A., & Lichtman, A. H. (2010). Pharmacological evaluation of the natural constituent of Cannabis sativa, cannabichromene and its modulation by (9)-tetrahydrocannabinol. Drug and Alcohol Dependence, 112(1-2), 126-33.

(156) Depicker A, Montagu M V (1997) Post-transcriptional gene silencing in plants. Curr Opin Cell Biol. 9: 373-82.

(157) Elsohly, M. A., & Slade, D. (2005). Chemical constituents of marijuana: the complex mixture of natural cannabinoids. Life Sciences, 78(5), 539-48.

(158) Feeney M and Z K Punja (2003) Tissue culture and Agrobacterium-mediated transformation of Hemp (Cannabis sativa L.) In Vitro Cell Dev Biol-Plant 39:578-585

(159) Fellermeier M, Zenk M H. (1998) Prenylation of olivetolate by a hemp transferase yields cannabigerolic acid, the precursor of tetrahydrocannabinol. FEBS Letters. 427: 283-285.

(160) Fernandez-Valverde, M., Reglero, A., Martinez-Blanco, H., & Luengo, J. M. (1993). Purification of Pseudomonas putida acyl coenzyme A ligase active with a range of aliphatic and aromatic substrates. Appl. Envir. Microbiol., 59(4), 1149-1154.

(161) Gagne, S. J., Stout, J. M., Liu, E., Boubakir, Z., Clark, S. M., & Page, J. E. (2012). Identification of olivetolic acid cyclase from Cannabis sativa reveals a unique catalytic route to plant polyketides. Proceedings of the National Academy of Sciences of the United States of America, 109(31), 12811-6.

(162) Helliwell C A, Waterhouse P M (2005) Constructs and methods for hairpin RNA-mediated gene silencing in plants. Methods Enzymology 392:24-35.

(163) Izzo, A. A., Capasso, R., Aviello, G., Borrelli, F., Romano, B., Piscitelli, F., . . . Di Marzo, V. (2012). Inhibitory effect of cannabichromene, a major non-psychotropic cannabinoid extracted from Cannabis sativa, on inflammation-induced hypermotility in mice. British Journal of Pharmacology, 166(4), 1444-60.

(164) Henikoff S, Till B J, Comai L (2004) TILLING. Traditional mutagenesis meets functional genomics. Plant Physiol 135:630-6.

(165) Katavic V, Haughn G W, Reed D, Martin M, Kunst L (1994) In planta transformation of Arabidopsis thaliana. Mol. Gen. Genet. 245: 363-370.

(166) Katsuyama Y, Funa N, Miyahisa I, Horinouchi S (2007) Synthesis of unnatural flavonoids and stilbenes by exploiting the plant biosynthetic pathway in Escherichia coli. Chem Biol. 14(6): 613-21.

(167) Kichikai K, Taura F, Morimoto S, Masayama Y. (2001) Japanese Patent Publication 2001-029082 published Feb. 6, 2001.

(168) Kojoma M, Seki H Yoshida S Muranaka T (2006) DNA polymorphisms in the THCA synthase gene in drug-type and figer-type Cannabis sativa L. Forensic Sci Int 159:132-40.

(169) Leonard E, Yan Y, Fowler Z L, Li Z, Lim C G, Lim K H, Koffas M A (12 Mar. 2008) Strain Improvement of Recombinant Escherichia coli for Efficient Production of Plant Flavonoids. Mol Pharm. [Epub ahead of print] PMID: 18333619 [PubMedas supplied by publisher].

(170) Ligresti, A., Moriello, A. S., Starowicz, K., Matias, I., Pisanti, S., De Petrocellis, L., . . . Di Marzo, V. (2006). Antitumor activity of plant cannabinoids with emphasis on the effect of cannabidiol on human breast carcinoma. Journal of Pharmacology and Experimental Therapeutics, 318(3), 1375-87. doi:10.1124/jpet.106.105247

(171) Maione, S., Piscitelli, F., Gatta, L., Vita, D., De Petrocellis, L., Palazzo, E., . . . Di Marzo, V. (2011). Non-psychoactive cannabinoids modulate the descending pathway of antinociception in anaesthetized rats through several mechanisms of action. British Journal of Pharmacology, 162(3), 584-96. doi:10.1111/j.1476-5381.2010.01063.x

(172) Meyer P (1995) Understanding and controlling transgene expression. Trends in Biotechnology, 13: 332-337.

(173) Moloney M M, Walker J M, Sharma K K (1989) High efficiency transformation of Brassica napus using Agrobacterium vectors. Plant Cell Rep. 8: 238-242.

(174) Morimoto S, Komatsu K, Taura F, Shoyama, Y. (1998) Purification and characterization of cannabichromenic acid synthase from Cannabis sativa. Phytochemistry. 49: 1525-1529.

(175) Nehra N S, Chibbar R N, Leung N, Caswell K, Mallard C, Steinhauer L, Baga M, Kartha K K (1994) Self-fertile transgenic wheat plants regenerated from isolated scutellar tissues following microprojectile bombardment with two distinct gene constructs. Plant J. 5: 285-297.

(176) Ohyanagi H, Tanaka T, Sakai H, Shigemoto Y, Yamaguchi K, Habara T, Fujii Y, Antonio B A, Nagamura Y, Imanishi T, Ikeo K, Itoh T, Gojobori T, Sasaki T. (2008) GenBank Accession NP_001060083.

(177) Page J E, Nagel J (2006) Biosynthesis of terpenophenolics in hop and cannabis. In J T Romeo, ed, Integrative Plant Biochemistry, Vol. 40. Elsevier, Oxford, pp 179-210.

(178) R. G. Pertwee, R. G. Pertwee, Cannabinoids R. G. Pertwee, Ed. (Springer-Verlag, Berlin/Heidelberg, 2005), pp. 1-51-51.

(179) Potrykus I (1991) Gene transfer to plants: Assessment of published approaches and results. Annu. Rev. Plant Physiol. Plant Mol. Biol. 42: 205-225.

(180) Pouwels et al., Cloning Vectors. A Laboratory Manual, Elsevier, Amsterdam (1986).

(181) Ralston L, Subramanian S, Matsuno M, Yu O (2005) Partial reconstruction of flavonoid and isoflavonoid biosynthesis in yeast using soybean type I and type II chalcone isomerases. Plant Physiol. 137(4): 1375-88.

(182) Rhodes C A, Pierce D A, Mettler I J, Mascarenhas D, Detmer J J (1988) Genetically transformed maize plants from protoplasts. Science 240: 204-207.

(183) Romano, B., Borrelli, F., Fasolino, I., Capasso, R., Piscitelli, F., Cascio, M., . . . Izzo, A. (2013). The cannabinoid TRPA1 agonist cannabichromene inhibits nitric oxide production in macrophages and ameliorates murine colitis. British Journal of Pharmacology, 169(1), 213-29.

(184) Sambrook et al, Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor, N.Y. (2001).

(185) Sanford J C, Klein T M, Wolf E D, Allen N (1987) Delivery of substances into cells and tissues using a particle bombardment process. J. Part. Sci. Technol. 5: 27-37.

(186) Schneider, K., Kienow, L., Schmelzer, E., Colby, T., Bartsch, M., Miersch, O., . . . Stuible, H.-P. (2005). A new type of peroxisomal acyl-coenzyme A synthetase from Arabidopsis thaliana Has the Catalytic Capacity to Activate Biosynthetic Precursors of Jasmonic Acid 10.1074/jbc. M413578200. Journal of Biological Chemistry, 280(14), 13962-13972.

(187) Schwab R, Ossowski S, Riester M, Warthmann N, Weigel D (2006) Highly specific gene silencing by artificial microRNAs in Arabidopsis. Plant Cell 18:1121-33.

(188) Shimamoto K, Terada R, Izawa T, Fujimoto H (1989) Fertile transgenic rice plants regenerated from transformed protoplasts. Nature 338: 274-276.

(189) Shockey, J. M., Fulda, M. S., & Browse, J. (2003). Arabidopsis Contains a Large Superfamily of Acyl-Activating Enzymes. Phylogenetic and Acyl-Coenzyme A Synthetases. Plant Physiol., 132(June), 1065-1076.

(190) Shoyama Y, Hirano H, Nishioka I. (1984) Biosynthesis of propyl cannabinoid acid and its biosynthetic relationship with pentyl and methyl cannabinoid acids. Phytochemistry. 23(9): 1909-1912.

(191) Sirikantaramas S, Morimoto S, Shoyama Y, Ishikawa Y, Wada Y, Shoyama Y, Taura F. (2004) The gene controlling marijuana psychoactivity: molecular cloning and heterologous expression of Delta1-tetrahydrocannabinolic acid synthase from Cannabis sativa L. J Biol Chem. 279: 39767-39774.

(192) Sirikantaramas S, Taura F, Tanaka Y, Ishikawa Y, Morimoto S, Shoyama Y. (2005) Tetrahydrocannabinolic acid synthase, the enzyme controlling marijuana psychoactivity, is secreted into the storage cavity of the glandular trichomes. Plant Cell Physiol. 46: 1578-1582.

(193) Songstad D D, Somers D A, Griesbach R J (1995) Advances in alternative DNA delivery techniques. Plant Cell, Tissue and Organ Culture 40:1-15.

(194) Stam M, de Bruin R, van Blokland R, van der Hoorn R A, Mol J N, Kooter J M (2000) Distinct features of post-transcriptional gene silencing by antisense transgenes in single copy and inverted T-DNA repeat loci. Plant J. 21:27-42.

(195) Stout, J. M., Boubakir, Z., Ambrose, S. J., Purves, R. W., & Page, J. E. (2012). The hexanoyl-CoA precursor for cannabinoid biosynthesis is formed by an acyl-activating enzyme in Cannabis sativa trichomes. Plant J. 71(3): 353-65.

(196) Taura F, Morimoto S, Shoyama Y. (1996) Purification and characterization of cannabidiolic-acid synthase from Cannabis sativa L. Biochemical analysis of a novel enzyme that catalyzes the oxidocyclization of cannabigerolic acid to cannabidiolic acid. J Biol Chem. 271: 17411-17416.

(197) Taura F, Morimoto S, Shoyama Y, Mechoulam R. (1995) First direct evidence for the mechanism of 1-tetrahydrocannabinolic acid biosynthesis. Journal of the American Chemical Society. 117: 9766-9767.

(198) Taura F, Matsushita H, Morimoto S, Masayama Y. (2000) Japanese Patent Publication 2000-078979 published Mar. 21, 2000.

(199) Taura F, Sirikantaramas S, Shoyama Y, Yoshikai K, Shoyama Y, Morimoto S. (2007) Cannabidiolic-acid synthase, the chemotype-determining enzyme in the fiber-type Cannabis sativa. FEBS Left. 581: 2929-2934.

(200) Taura F, Tanaka S, Taguchi C, Fukamizu T, Tanaka H, Shoyama Y, Morimoto, S. (2009) Characterization of olivetol synthase, a polyketide synthase putatively involved in cannabinoid biosynthetic pathway. FEBS Left. 583: 2061-2066.

(201) Vasil I K (1994) Molecular improvement of cereals. Plant Mol. Biol. 25: 925-937.

(202) Veress T, Szanto J. I. and Leisztner, L (1990) Determination of cannabinoid acids by high performance liquied chromatography of their neutral derivatives formed by thermal decarboxylation. J. of Chromatography, 520:339-347

(203) Walden R, Wingender R (1995) Gene-transfer and plant regeneration techniques. Trends in Biotechnology 13: 324-331.

(204) Ware, M. A., Wang, T., Shapiro, S., Robinson, A., Ducruet, T., Huynh, T., . . . Collet, J.-P. (2010). Smoked cannabis for chronic neuropathic pain: a randomized controlled trial. CMAJ: Canadian Medical Association Journal=Journal de I'Association Medicale Canadienne, 182(14), E694-701.

(205) Wirth, P. W., Watson, E. S., ElSohly, M. A., Seidel, R., Murphy, J. C., & Turner, C. E. (1980). Anti-inflammatory activity of cannabichromene homologs. Journal of Pharmaceutical Sciences, 69(11), 1359-60.

(206) Zhang H, Wang Y, Pfeifer B A (31 Jan. 2008) Bacterial hosts for natural product production. Mol Pharm. [Epub ahead of print] PMID: 18232637 [PubMedas supplied by publisher].