ASSAY FOR THE DETECTION OF ALPHA-SYNUCLEIN SEEDING ACTIVITY ASSOCIATED WITH SYNUCLEINOPATHIES
20200232996 ยท 2020-07-23
Assignee
Inventors
- Byron Winslow Caughey (Hamilton, MT, US)
- Bradley Richard Groveman (Hamilton, MT, US)
- Christina Doriana Groveman (Hamilton, MT, US)
- Lynne DePuma Raymond (Hamilton, MT, US)
- Andrew Gregory Hughson (Hamilton, MT, US)
Cpc classification
G01N2800/2835
PHYSICS
G01N33/543
PHYSICS
International classification
Abstract
Methods are disclosed for determining whether a subject has a synucleinopathy. Methods are also disclosed for detecting misfolded alpha synuclein (Syn) in a biological sample or fraction thereof. These methods include the use of an Syn seeding assay.
Claims
1. (canceled)
2. A method of determining whether a subject has a synucleinopathy, comprising: A) performing an alpha synuclein (Syn) seeding assay on a biological sample, or fraction thereof, from the subject, comprising: i) contacting the biological sample or a fraction thereof with a soluble mutated recombinant alpha synuclein (rSyn) to form a reaction mixture, wherein the soluble mutated rSyn comprises an amino acid sequence a) comprising one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) a deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1; ii) incubating the reaction mixture to permit coaggregation of misfolded Syn aggregates present in the biological sample or fraction thereof with the mutated rSyn; iii) maintaining incubation conditions that promote coaggregation of the mutated rSyn with the misfolded Syn aggregates to result in a conversion of the soluble mutated rSyn to mutated rSyn aggregates while inhibiting spontaneous aggregation of soluble mutant rSyn; and iv) agitating mutated rSyn aggregates formed during step iii), wherein the conditions comprise shaking the reaction mixture in a shaking cycle, wherein each shaking cycle comprises a period of rest and a period of shaking; and B) detecting misfolded mutated rSyn aggregates in the reaction mixture, and wherein detection of misfolded mutated rSyn aggregates in the reaction mixture indicates that the subject has the synucleinopathy
3. The method of claim 2, wherein the soluble mutated rSyn comprises the amino acid sequence of one of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23.
4. The method of claim 2, wherein the subject is a human, and wherein the synucleinopathy is Parkinson disease, Lewy body dementia, or multiple system atrophy.
5. The method of claim 2, wherein the reaction mix of step i) further comprises a detectable label.
6. The method of claim 2, wherein detecting the presence of misfolded mutated rSyn aggregates comprises the use of fluorescence or thioflavin T (ThT).
7. (canceled)
8. The method of claim 2, wherein the biological sample is a nasal brushing, saliva, skin, blood, serum, plasma, cerebrospinal fluid, feces, urine or tissue sample.
9. The method claim 2, wherein agitating aggregates in step (iv) comprises agitating aggregates in the absence of sonication.
10. The method of claim 2, wherein: the period of rest and the period of shaking are substantially equal in the shaking cycle in step (iv); and/or the shaking cycle in step (iv) is 20 to 180 seconds in length.
11-13. (canceled)
14. The method of claim 2, wherein the incubation conditions comprise a temperature of about 30 to about 55 C.
15. (canceled)
16. The method of claim 2, wherein the incubation conditions comprise 0-0.1% sodium dodecyl sulfate.
17-18. (canceled)
19. The method of claim 2, wherein the reaction mixture comprises 1 to 10 beads per 100 l.
20. The method of claim 19, wherein the beads are about 0.5 mm to about 3 mm in diameter.
21-23. (canceled)
24. A method for detecting misfolded alpha synuclein (Syn) in a biological sample or fraction thereof comprising: (A) mixing the biological sample or a fraction thereof with a purified soluble mutated recombinant Syn (rSyn) to make a reaction mix, wherein the soluble mutated rSyn comprises an amino acid sequence a) comprising one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) with a deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1 (B) performing an amplification reaction comprising: (i) incubating the reaction mix to permit coaggregation of the soluble mutated rSyn with misfolded Syn that may be present in the reaction mix, and maintaining incubation conditions that promote coaggregation of the soluble mutated rSyn with the misfolded Syn and result in a conversion of the soluble mutated rSyn to misfolded rSyn aggregates initiated by the presence of misfolded Syn in the sample, while inhibiting development of spontaneously arising rSyn aggregates; and (ii) agitating aggregates formed during step (i), in shaking cycles, wherein each shaking cycle of the shaking cycles comprises a period of rest and a period of shaking, wherein agitating is performed in the absence of sonication; and (c) detecting misfolded rSyn aggregates in the reaction mix, and detection of misfolded rSyn in the reaction mix indicates that misfolded Syn was present in the biological sample or fraction thereof.
25. The method of claim 24, wherein the reaction mix of step a) further comprises a detectable label.
26. The method of claim 24, wherein the soluble mutated rSyn comprises the amino acid sequence of one of SEQ ID NOs: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23.
27. The method of claim 24, wherein detecting the presence of misfolded mutated rSyn aggregates comprises the use of fluorescence or thioflavin T (ThT).
28. (canceled)
29. The method of claim 24, wherein the biological sample is from a human.
30. The method of claim 24, wherein the biological sample is a nasal brushing, saliva, skin, blood, serum, plasma, cerebrospinal fluid, feces, urine or tissue sample.
31. The method of claim 24, wherein: agitating aggregates in step (ii) comprises agitating aggregates in the absence of sonication; and/or the period of rest and the period of shaking are substantially equal in the shaking cycle in step (ii).
32-35. (canceled)
36. The method of claim 24, wherein the amplification reaction is performed at temperature of about 30 to about 55 C.
37. (canceled)
38. The method of claim 24, wherein the amplification reaction comprises 0-0.1% sodium dodecyl sulfate.
39. (canceled)
40. The method of claim 24, wherein the presence of misfolded Syn indicates that the subject has a synucleinopathy.
41. The method of claim 40, wherein the synucleinopathy is Parkinson disease, Lewy body dementia, or multiple system atrophy.
42. (canceled)
43. The method of claim 24, wherein the reaction mix comprises 1 to 10 beads per 100 l.
44. The method of claim 43, wherein the beads are about 0.5 mm to about 3 mm in diameter.
45-46. (canceled)
47. The method of claim 24, wherein the rSyn is purified by elution from a column comprising an immobilized metal ion using between about 10 mM and about 500 mM imidazole, and/or wherein the rSyn is purified by anion exchange chromatography.
48. The method of claim 24, wherein the fraction of the biological sample is utilized in the method.
49. The method of claim 48, wherein the fraction is prepared by a purification method that comprises: a) contacting the biological sample with iron oxide particles; and b) collecting the iron oxide particles, thereby preparing the fraction.
50. The method of claim 2, wherein the rSyn is purified by elution from a column comprising an immobilized metal ion using between about 10 mM and about 500 mM imidazole, and/or wherein the rSyn is purified by anion exchange chromatography.
51. The method of claim 2, wherein the fraction of the biological sample is utilized in the method.
52. The method of claim 51, wherein the fraction is prepared by a purification method that comprises: a) contacting the biological sample with iron oxide particles; and b) collecting the iron oxide particles, thereby preparing the fraction.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024] Syn seeding activity was captured using 98 g of IO particles with an incubation of 2 hours at room temperature. At the end of the capture the particles were resuspended in PBS and briefly sonicated at 63% power prior to seeding four wells. The traces are the average of four replicate wells. The 10 mM ThT solution allowed for stronger fluorescence signals in the presence of the IO when testing CSF samples.
[0025] CBD brain tissue dilution or 10.sup.4 to 10.sup.7 DLBD brain tissue dilutions. Syn seeding activity was captured using 98 g of IO particles with an incubation of 2 hours at room temperature. At the end of the capture the particles were resuspended in 0.05% SDS in PBS and briefly sonicated at 63% power prior to seeding four wells. The traces are the average of four replicate wells. The use of 10 mM ThT solution allowed for a slightly stronger fluorescence signal with IO capture from plasma samples, although the improvement was not as significant as the one observed for the study using CSF. Thus, increased ThT concentration can, but does not necessarily, provide increased sensitivity.
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
SEQUENCE LISTING
[0033] The amino acid sequences listed below are shown using single letter code for amino acids, as defined in 37 C.F.R. 1.822. The Sequence Listing is submitted as an ASCII text file Sequence_Listing, Sep. 26, 2018, 34.3 KB], which is incorporated by reference herein. The following sequences are disclosed (X is any amino acid):
TABLE-US-00001 SNCA (SEQIDNO:1) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCA (SEQIDNO:2) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAK23E (SEQIDNO:3) MDVFMKGLSKAKEGVVAAAEKTEQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAK23E (SEQIDNO:4) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTEQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAK23Q (SEQIDNO:5) MDVFMKGLSKAKEGVVAAAEKTQQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAK23Q (SEQIDNO:6) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTQQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAdel12 (SEQIDNO:7) MKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQE GILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAdel12 (SEQIDNO:8) MGSSHHHHHHSSGLVPRGSHMKEGVVAAAEKTKQGVAEAAGKTKEGVLYV GSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAA ATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA SNCAD2X (SEQIDNO:9) MXVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAD2X (SEQIDNO:10) MGSSHHHHHHSSGLVPRGSHMXVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAK21X (SEQIDNO:11) MDVFMKGLSKAKEGVVAAAEXTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAK21X (SEQIDNO:12) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEXTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAK23X (SEQIDNO:13) MDVFMKGLSKAKEGVVAAAEKTXQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAK23X (SEQIDNO:14) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTXQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAK45X (SEQIDNO:15) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTXEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAK45X (SEQIDNO:16) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTXEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAT59X (SEQIDNO:17) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKXKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAT59X (SEQIDNO:18) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKXKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAG67X (SEQIDNO:19) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVXGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAG67X (SEQIDNO:20) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVXGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAV77X (SEQIDNO:21) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAXAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAV77X (SEQIDNO:22) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAXAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA SNCAA78X (SEQIDNO:23) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVXQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA 6XHisSNCAA78X (SEQIDNO:24) MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAA GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVXQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA
DETAILED DESCRIPTION OF SEVERAL EMBODIMENTS
[0034] Management of neurological diseases such as Parkinson disease and dementia with Lewy bodies remains a challenge, and would greatly benefit from a diagnostic test that is both practical and sensitive enough for early, ante-mortem identification of a patient affected by synucleinopathies. There is currently no objective test for Parkinson disease, and the current methods can have an up to 50% misdiagnosis rate. A hallmark of Parkinson disease is the accumulation of abnormal deposits of Syn in the brain, called Lewy bodies. Fibrils of misfolded Syn form through the process of seeded polymerization, whereby misfolded forms of Syn act as a template, or seed to propagate conversion of natively folded Syn into the misfolded form as the aggregates grow. This pathogenic self-propagation process can be used in detection methods. Disclosed in an amplification assay that uses mutated rSyn as a substrate. This assay allows rapid detection of misfolded Syn in biological samples, such as, but not limited to, cerebrospinal fluid, blood, serum, plasma, and olfactory mucosa samples. Fractions of these biological samples can be used in these assays. The disclosed methods can be used to diagnose synucleinopathies, select cohorts for therapeutic trials, monitor effects of therapies on misfolded Syn, and/or monitor subjects at risk, such as due to a genetic predisposition or environmental factors.
I. Terms
[0035] Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).
[0036] In order to facilitate review of the various embodiments of this disclosure, the following explanations of specific terms are provided:
[0037] Aggregate: A group of molecules in association, such as oligomers, multimers and polymers of Syn, such as amyloid fibrils of misfolded Syn protein. Co-aggregates are aggregates of more than one type of molecule, such as, but not limited to, mutated rSyn and misfolded Syn.
[0038] Alzheimer disease: A chronic neurodegenerative disease that is the cause of 60% to 70% of cases of dementia. The most common early symptom is difficulty in remembering recent events (short-term memory loss). As the disease advances, symptoms can include problems with language, disorientation (including easily getting lost), mood swings, loss of motivation, not managing self-care, and behavioral issues. Although the speed of progression can vary, the average life expectancy following diagnosis is three to nine years.
[0039] Alzheimer disease is characterized by loss of neurons and synapses in the cerebral cortex and certain subcortical regions of the brain. This loss results in gross atrophy of the affected regions, including degeneration in the temporal lobe and parietal lobe, and parts of the frontal cortex and cingulate gyrus. Degeneration is also present in brainstem nuclei like the locus coeruleus. Both amyloid plaques and neurofibrillary tangles are clearly visible by microscopy in brains of patients. The plaques are dense, mostly insoluble deposits of beta-amyloid peptide and cellular material outside and around neurons. Tangles (neurofibrillary tangles) are aggregates of the microtubule-associated protein tau that accumulate inside the cells themselves. Aggregates of misfolded Syn have been detected in the brains of a small minority of cases of Alzheimer disease, but this is not a consistent or defining feature of AD.
[0040] Agitation: Introducing any type of turbulence or motion into a mixture or reaction mix, for examples by sonication, stirring, or shaking. In some embodiments, agitation includes the use of force sufficient to fragment misfolded synuclein aggregates, which disperses the aggregates and/or polymers to facilitate further amplification. In some examples fragmentation includes complete fragmentation, whereas in other examples, fragmentation is only partial, for instance, a population of aggregates can be about 1%, 2%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% fragmented by agitation. Exemplary agitation methods are described in the Examples section below. In some embodiments, agitation includes shaking (and not sonication).
[0041] Amyloid: Fibrillar ultrastructure of protein aggregates that contains cross-beta structure and typically stains in characteristic ways with certain dyes such as thioflavin T (ThT). In the latter case, the fluorescence yield of the dye is enhanced by binding to amyloids. Many different proteins can form amyloids in association with a wide variety of diseases. Aggregates of Syn can take the form of amyloid.
[0042] Antibody: A polypeptide ligand comprising at least a light chain or heavy chain immunoglobulin variable region which specifically recognizes and binds an epitope of an antigen or a fragment thereof. An antibody can specifically bind Syn, such as misfolded Syn, or a particular mutant rSyn. Antibodies can be composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (V.sub.H) region and the variable light (V.sub.L) region. Together, the V.sub.H region and the V.sub.L region are responsible for binding the antigen recognized by the antibody.
[0043] The term antibody includes intact immunoglobulins and the variants and portions of them well known in the art, such as Fab' fragments, F(ab).sub.2 fragments, single chain Fv proteins (scFv), and disulfide stabilized Fv proteins (dsFv). A scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains. The term also includes genetically engineered forms such as chimeric antibodies (for example, humanized antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, Ill.); Kuby, J., Immunology, 3.sup.rd Ed., W.H. Freeman & Co., New York, 1997.
[0044] Typically, a naturally occurring immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds. There are two types of light chain, lambda () and kappa (k). There are five main heavy chain classes (or isotypes) which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE.
[0045] Each heavy and light chain contains a constant region and a variable region, (the regions are also known as domains). In combination, the heavy and the light chain variable regions specifically bind the antigen. Light and heavy chain variable regions contain a framework region interrupted by three hypervariable regions, also called complementarity-determining regions or CDRs. The extent of the framework region and CDRs have been defined (see, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference). The Kabat database is now maintained online. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three-dimensional space.
[0046] The CDRs are primarily responsible for binding to an epitope of an antigen, such as Syn. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located. Thus, a V.sub.H CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found, whereas a V.sub.L CDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found. An antibody that binds an antigen of interest has a specific V.sub.H region and the V.sub.L region sequence, and thus specific CDR sequences. Antibodies with different specificities (due to different combining sites for different antigens) have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
[0047] References to V.sub.H or VH refer to the variable region of an immunoglobulin heavy chain, including that of an Fv, scFv, dsFv or Fab. References to V.sub.L or VL refer to the variable region of an immunoglobulin light chain, including that of an Fv, scFv, dsFv or Fab.
[0048] A monoclonal antibody is an antibody produced by a single clone of B-lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected, or a progeny thereof. Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells. Monoclonal antibodies include humanized monoclonal antibodies.
[0049] Antibody binding affinity: Affinity of an antibody for an antigen, such as Syn. In one embodiment, affinity is calculated by a modification of the Scatchard method described by Frankel et al., Mol. Immunol., 16:101-106, 1979. In another embodiment, binding affinity is measured by an antigen/antibody dissociation rate. In yet another embodiment, a high binding affinity is measured by a competition radioimmunoassay. In several examples, a high binding affinity is at least about 110.sup.8 M. In other embodiments, a high binding affinity is at least about 1.510.sup.8M, at least about 2.010.sup.8M, at least about 2.510.sup.8M, at least about 3.010.sup.8M, at least about 3.510.sup.8M, at least about 4.010.sup.8M, at least about 4.510.sup.8M, or at least about 5.010.sup.8 M.
[0050] Antigen: A compound, composition, or substance that can stimulate the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous immunogens. The term antigen includes all related antigenic epitopes. Epitope or antigenic determinant refers to a site on an antigen to which B and/or T-cells respond. An antigen can be a tissue-specific antigen, or a disease-specific antigen, such as misfolded Syn.
[0051] Conservative variant: In the context of a protein, refers to a peptide or amino acid sequence that deviates from another amino acid sequence only in the substitution of one or several amino acids for amino acids having similar biochemical properties (so-called conservative substitutions). Conservative amino acid substitutions are likely to have minimal impact on the activity of the resultant protein, such as in an RT-QuIC assay. Further information about conservative substitutions can be found, for instance, in Ben Bassat et al. (J. Bacteriol., 169:751-757, 1987), O'Regan et al. (Gene, 77:237-251, 1989), Sahin-Toth et al. (Protein Sci., 3:240-247, 1994), Hochuli et al. (Bio/Technology, 6:1321-1325, 1988) and in widely used textbooks of genetics and molecular biology. In some examples, protein variants can have no more than 1, 2, 3, 4, 5, 10, 15, 30, 45 conservative amino acid changes.
[0052] In one example, a conservative variant protein is one that functionally performs substantially like a similar base component, for instance, a rSyn protein having conservative variations in the sequence as compared to a reference rSyn protein. For example, a conservative variant of a mutated rSyn protein, will aggregate with misfolded Syn, and will form aggregates with the same reaction kinetics under similar reaction conditions. In this example, a mutated rSyn protein and the conservative variant do not have the same amino acid sequences, but have changes at residues that do not substantially affect reaction kinetics. The conservative variant can have, for instance, one, two, three, four, or five substitutions in the amino acid sequence. However, a conservative variant of a mutant rSyn still contains, for example, a) the one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 (wherein the number is the position and the letter is the amino acid in the sequence) and/or b) the deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1. The conservative amino acid substitutions can occur in any domain of the mutated rSyn protein. However, generally the a) one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) a deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1, is/are maintained.
[0053] Conditions sufficient to detect: Any environment that permits the desired activity, for example, that permits an interaction to be detected, or such as conditions that allow a detectable label to be detected. For example, such conditions include appropriate temperatures, buffer solutions, and detection means such as fluorimeters and digital imaging equipment.
[0054] Detect: To determine if an agent (such as a signal or protein, for example misfolded Syn) is present or absent. In some examples, this can further include quantification, for example the quantification of the amount of Syn protein in a sample, such as a cerebrospinal fluid, brain tissue, nasal brushing, blood sample, serum sample, tissue sample, or any other sample or a fraction of a sample.
[0055] Diagnostic: Identifying the presence or nature of a pathologic condition, such as, but not limited to, identifying the presence of misfolded Syn protein and identifying a synucleinopathy. Diagnostic methods differ in their sensitivity and specificity. The sensitivity of a diagnostic assay is the percentage of diseased individuals (true positives) who test positive. The specificity of a diagnostic assay is 1 minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it provides a positive indication that aids in diagnosis. Prognostic is the probability of development (for example severity) of a pathologic condition.
[0056] Disaggregate: To partially or completely disrupt an aggregate, such as an aggregate of misfolded Syn protein.
[0057] Encode: Any process whereby the information in a polymeric macromolecule or sequence is used to direct the production of a second molecule or sequence that is different from the first molecule or sequence. As used herein, the term is construed broadly, and can have a variety of applications. In some aspects, the term encode describes the process of semi-conservative DNA replication, wherein one strand of a double-stranded DNA molecule is used as a template to encode a newly synthesized complementary sister strand by a DNA-dependent DNA polymerase.
[0058] In another aspect, the term encode refers to any process whereby the information in one molecule is used to direct the production of a second molecule that has a different chemical nature from the first molecule. For example, a DNA molecule can encode an RNA molecule (for instance, by the process of transcription incorporating a DNA-dependent RNA polymerase enzyme). Also, an RNA molecule can encode a peptide, such as Syn, as in the process of translation. When used to describe the process of translation, the term encode also extends to the triplet codon that encodes an amino acid. In some aspects, an RNA molecule can encode a DNA molecule, for instance, by the process of reverse transcription incorporating an RNA-dependent DNA polymerase. In another aspect, a DNA molecule can encode a peptide, where it is understood that encode as used in that case incorporates both the processes of transcription and translation.
[0059] Fluorophore: A chemical compound, which when excited by exposure to a particular stimulus, such as a defined wavelength of light, emits light (fluoresces), for example at a different wavelength (such as a longer wavelength of light). Fluorophores are part of the larger class of luminescent compounds. Luminescent compounds include chemiluminescent molecules, which do not require a particular wavelength of light to luminesce, but rather use a chemical source of energy. Therefore, the use of chemiluminescent molecules (such as aequorin) can eliminate the need for an external source of electromagnetic radiation, such as a laser. Thioflavin T and Thioflavin S are fluorophores of use for the detection of Syn aggregates.
[0060] Non-limiting examples of particular fluorophores that can attached to antibodies that specifically binds Syn, or Syn aggregates are provided in U.S. Pat. No. 5,866,366 to Nazarenko et al., such as 4-acetamido-4-isothiocyanatostilbene-2,2disulfonic acid, acridine and derivatives such as acridine and acridine isothiocyanate, 5-(2-aminoethyl)aminonaphthalene-1-sulfonic acid (EDANS), 4-amino-N-[3-vinylsulfonyl)phenyl]naphthalimide-3,5 disulfonate (Lucifer Yellow VS), N-(4-anilino-1-naphthyl)maleimide, anthranilamide, Brilliant Yellow, coumarin and derivatives such as coumarin, 7-amino-4-methylcoumarin (AMC, Coumarin 120), 7-amino-4-trifluoromethylcouluarin (Coumaran 151); cyanosine; 4,6-diaminidino-2-phenylindole (DAPI); 5, 5-dibromopyrogallol-sulfonephthalein (Bromopyrogallol Red); 7-diethylamino-3-(4-isothiocyanatophenyl)-4-methylcoumarin; diethylenetriamine pentaacetate; 4,4-diisothiocyanatodihydro-stilbene-2,2-disulfonic acid; 4,4-diisothiocyanatostilbene-2,2-disulfonic acid; 5-[dimethylamino]naphthalene-1-sulfonyl chloride (DNS, dansyl chloride); 4-dimethylaminophenylazophenyl-4-isothiocyanate (DABITC); eosin and derivatives such as eosin and eosin isothiocyanate; erythrosin and derivatives such as erythrosin B and erythrosin isothiocyanate; ethidium; fluorescein and derivatives such as 5-carboxyfluorescein (FAM), 5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF), 27-dimethoxy-45-dichloro-6-carboxyfluorescein (JOE), fluorescein, fluorescein isothiocyanate (FITC), and QFITC (XRITC); fluorescamine; IR144; IR1446; Malachite Green isothiocyanate; 4-methylumbelliferone; ortho cresolphthalein; nitrotyrosine; pararosaniline; Phenol Red; B-phycoerythrin; o-phthaldialdehyde; pyrene and derivatives such as pyrene, pyrene butyrate and succinimidyl 1-pyrene butyrate; Reactive Red 4 (CIBACRON Brilliant Red 3B-A); rhodamine and derivatives such as 6-carboxy-X-rhodamine (ROX), 6-carboxyrhodamine (R6G), lissamine rhodamine B sulfonyl chloride, rhodamine (Rhod), rhodamine B, rhodamine 123, rhodamine X isothiocyanate, sulforhodamine B, sulforhodamine 101 and sulfonyl chloride derivative of sulforhodamine 101 (Texas Red); N,N,N,N-tetramethyl-6-carboxyrhodamine (TAMRA); tetramethyl rhodamine; tetramethyl rhodamine isothiocyanate (TRITC); riboflavin; rosolic acid and terbium chelate derivatives; LightCycler Red 640; Cy5.5; and Cy56-carboxyfluorescein; 5-carboxyfluorescein (5-FAM); boron dipyrromethene difluoride (BODIPY); N,N,N,N-tetramethyl-6-carboxyrhodamine (TAMRA); acridine, stilbene, -6-carboxy-fluorescein (HEX), TET (Tetramethyl fluorescein), 6-carboxy-X-rhodamine (ROX), Texas Red, 2,7-dimethoxy-4,5-dichloro-6-carboxyfluorescein (JOE), Cy3, CyS, VIC (Applied Biosystems), LC Red 640, LC Red 705, Yakima yellow amongst others. In some examples, a fluorophore is detectable label, such as a detectable label attached to an antibody.
[0061] Immunoassay: A biochemical test that measures the presence or concentration of a substance in a sample, such as a biological sample, or fraction thereof, such as a nasal brushing or a blood sample, cerebrospinal fluid sample, brain tissue sample, or a serum sample obtained from a subject, using the reaction of an antibody to its cognate antigen, for example the specific binding of an antibody to a protein, such as misfolded Syn. Both the presence of antigen or the amount of antigen present can be measured.
[0062] Immunoprecipitation (IP): The technique of precipitating a protein antigen out of solution using an antibody or peptides that specifically binds to that particular protein. These solutions will often be in the form of a crude lysate of an animal tissue. Other sample types could be body fluids or other samples of biological origin. Generally, in IP the antibody or peptides are coupled to a solid substrate at some point in the procedure. Antibodies are commercially available that bind total synuclein, oligomeric synuclein and phosphosynuclein.
[0063] Isolated: An isolated biological component, such as a peptide or assembly of polypeptides (for example, soluble or misfolded Syn), cell, nucleic acid, or serum samples has been substantially separated, produced apart from, or purified away from other biological components in the cell of the organism in which the component naturally occurs, for instance, other chromosomal and extrachromosomal DNA and RNA, and proteins. Nucleic acids, peptides and proteins that have been isolated thus include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a cell as well as chemically synthesized peptide and nucleic acids. The term isolated or purified does not require absolute purity; rather, it is intended as a relative term. Thus, for example, an isolated peptide preparation is one in which the peptide or protein is more enriched than the peptide or protein is in its natural environment within a cell. Preferably, a preparation is purified such that the protein or peptide represents at least 50% of the total peptide or protein content of the preparation, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or even at least 99% of the peptide or protein concentration.
[0064] Misfolded: A protein, such as Syn, that no longer contains all or part of the structural conformation of the protein as it exists when involved in its typical, nonpathogenic normal function within a biological system. Misfolded Syn can take the form of oligomers and aggregates. A misfolded protein can be the pathogenic form.
[0065] Multiple System Atrophy: A neurodegenerative disease characterized by a combination of autonomic, cerebellar, parkinsonian and pyramidal symptoms, also known as olivopontocerebellar atrophy, striatonigral degeneration and Shy-Drager syndrome. MSA is divided into categories based on the motor phenotype; MSA is divided into the parkinsonian (MSA-P) and cerebellar (MSA-C) variants. MSA-P is only poorly L-DOPA-responsive. In most countries, MSA-P is more common than MSA-C. Like Parkinson disease, the onset of MSA is usually in the sixth decade of life, but it progresses faster than PD. The mean survival time of a patient with MSA from the onset of symptoms is usually 6-10 years.
[0066] Proteinaceous oligodendroglial cytoplasmic inclusions (Papp-Lantos bodies) are the major histological hallmark of MSA. Less often, oligodendroglial nuclear inclusions are present, as are neuronal cytoplasmic and nuclear inclusions. Schwann cell cytoplasmic inclusions are also a common feature
[0067] Nucleic acid molecule: A polymeric form of nucleotides, which can include both sense and anti-sense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. A nucleotide refers to a ribonucleotide, deoxynucleotide or a modified form of either type of nucleotide. A nucleic acid molecule as used herein is synonymous with nucleic acid and polynucleotide. A nucleic acid molecule is usually at least 10 bases in length, unless otherwise specified. The term includes single and double stranded forms of DNA. A nucleic acid molecule can include either or both naturally occurring and modified nucleotides linked together by naturally occurring and/or non-naturally occurring nucleotide linkages.
[0068] Parkinson disease: A degenerative disorder of the central nervous system that impairs motor skills, cognitive processes, and other functions. Parkinson disease is also referred to as Parkinson disease, Parkinson, PD and primary Parkinsonism. The most obvious symptoms of Parkinson disease are motor-related, including tremor, rigidity, slowness of movement and postural instability. Among non-motor symptoms are autonomic dysfunction and sensory and sleep difficulties. Cognitive and neurobehavioral problems, including dementia, are common in the advanced stages of the disease.
[0069] In subjects that develop Parkinson disease, symptoms typically begin around the age of 60, although there are young-onset cases. Symptoms result from insufficient formation and action of dopamine produced in the dopaminergic neurons of the midbrain (specifically the substantia nigra). Pathologically the disease is characterized by the accumulation of misfolded Syn forming inclusions called Lewy bodies. Such pathology can only be demonstrated at autopsy so diagnosis is mainly clinical (based on symptoms). Some tests such as neuroimaging techniques can also aid in diagnosis.
[0070] Pick Disease: A type of frontotemporal degeneration that is a rare neurodegenerative disease that causes progressive destruction of neurons in the brain. Symptoms include loss of language (aphasia), movement disorders and/or dementia. While some of the symptoms can initially be alleviated, the disease progresses and patients often die within two to ten years. A defining characteristic of the disease is build-up of tau proteins in neurons, accumulating into silver-staining, spherical aggregations known as Pick bodies. Pick bodies are almost always found in several regions in the brain, including the dentate gyms, the pyramidial cells of the CA1 sector and subiculum of the hippocampus, the neocortex, and a plurality of other nuclei. Changes in personality help Pick disease to be distinguished from Alzheimer disease. Symptoms include difficulty in language and thinking, efforts to dissociate from family, behavioral changes, unwarranted anxiety, irrational fears, impaired regulation of social conduct (e.g., breaches of etiquette, vulgar language, tactlessness, disinhibition, misperception), passivity, low motivation (aboulia), inertia, over-activity, pacing and wandering.
[0071] PMCA or Protein Misfolding Cyclic Amplification: A method for amplifying a protein, such as misfolded rSyn, in a sample by mixing a substrate with the sample, incubating the reaction mix to permit the substrate to initiate the conversion of a mutant rSyn protein to aggregates, fragmenting any aggregates formed during the incubation step by sonication, and repeating one or more cycles of the incubation and fragmentation steps.
[0072] Polypeptide: A polymer in which the monomers are amino acid residues that are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used, the L-isomers being preferred. The terms polypeptide or protein as used herein is intended to encompass any amino acid sequence and include modified sequences such as glycoproteins. The term polypeptide is specifically intended to cover naturally occurring proteins, as well as those that are recombinantly or synthetically produced.
[0073] The term polypeptide fragment refers to a portion of a polypeptide which exhibits at least one useful epitope. The term functional fragments of a polypeptide refers to all fragments of a polypeptide that retain an activity of the polypeptide. Biologically functional fragments, for example, can vary in size from a polypeptide fragment as small as an epitope capable of binding an antibody molecule to a large polypeptide capable of participating in the characteristic induction or programming of phenotypic changes within a cell.
[0074] QuIC or Quaking Induced Conversion: A particular type of rSyn seed detection assay, in which shaking of the reaction vessels is performed instead of sonication to agitate the reaction. An alpha (a) synuclein seeding assay or a seeded synuclein polymerization assay is an assay for misfolded Syn seeds that induces aggregate formation from mutated rSyn.
[0075] Real Time (RT)-QuIC: A type of QuIC assay that includes intermittent shaking without sonication to agitate the reaction and includes the use of a fluorescent readout, such as the fluorescent dye thioflavin T (ThT) of thioflavin S (ThS) to detect amyloid produced by a seeding assay. Exemplary protocols are disclosed, for example, in Wilham et al., PLOS Pathog. 6(12): e1001217, pages 1-15. In the presently disclosed methods, this assay can use a mutated rSyn protein as a substrate, intermittently shaken reactions, and can be predominantly detergent-free or use low levels of detergent (such as 0-0.1% of SDS or 0.001%-0.005% SDS). The assay includes fluorescent detection of Syn aggregates. Both QuIC and RT-QuIC can be used to detect misfolded Syn, with synuclein seeding activity, from a biological sample or fraction thereof. In some examples, misfolded Syn protein is detected by the production of ThT-reactive forms of Syn in this assay.
[0076] Sample: A biological sample obtained from a subject, such as a human or veterinary subject, which contains for example nucleic acids and/or proteins. As used herein, biological samples include all clinical samples useful for detection of misfolded Syn in subjects, including, but not limited to, nasal brushings, saliva, cells, tissues (e.g., brain tissue or skin tissue), and bodily fluids, such as: blood; derivatives and fractions of blood, such as serum; extracted galls; biopsied. A sample can be surgically removed tissue, including tissues that are, for example, unfixed, frozen, fixed in formalin and/or embedded in paraffin. Samples can be tears; milk; skin scrapes; surface washings; urine; sputum; cerebrospinal fluid; prostate fluid; pus; muscle; lymphoid tissues; olfactory mucosa; urine; feces; or bone marrow aspirates. A tissue sample can be any tissue of interest, such as brain tissue. The sample can be cerebrospinal fluid. In some embodiments, a sample may be contacted in solution with an agent, such as but not limited to a mutated form of rSyn protein or an antibody that specifically binds mutated rSyn protein. In other embodiments, a sample may be contacted in solid phase with an agent, such as but not limited to a mutated form of rSyn protein or an antibody that specifically binds mutated rSyn protein. In other embodiments, a sample may be contacted in solution and in solid phase with an agent, such as but not limited to a mutated form of rSyn protein or an antibody that specifically binds mutated rSyn protein. A fraction of a biological sample is any portion, component, concentrate, or purified element from a biological sample. An exemplary fraction can be prepared by contacting a biological sample with particles that bind Syn protein. These fractions, including the particles, are of use in the methods disclosed herein.
[0077] Sequence identity: The similarity between two nucleic acid sequences or between two amino acid sequences is expressed in terms of the level of sequence identity shared between the sequences. Sequence identity is typically expressed in terms of percentage identity; the higher the percentage, the more similar the two sequences. Methods for aligning sequences for comparison are described in detail below, in the Detailed Description.
[0078] Single Round: Performing a method wherein serial amplification reactions are not performed. For example, misfolded Syn can be amplified in a sample, by mixing the sample with purified mutant rSyn to make a reaction mix; performing an amplification reaction that includes (i) incubating the reaction mix to permit coaggregation of the soluble mutated rSyn with misfolded Syn that may be present in the reaction mix, and maintaining incubation conditions that promote coaggregation of the soluble mutated rSyn with the misfolded Syn and result in a conversion of the soluble mutated rSyn to misfolded rSyn aggregates initiated by the presence of misfolded Syn in the sample, while inhibiting development of spontaneously mutated rSyn aggregates; (ii) agitating aggregates formed during step (i) in shaking cycles; (iii) optionally repeating steps (i) and (ii) one or more times. Misfolded rSyn aggregates are detected in the reaction mix, wherein detection of misfolded rSyn aggregates in the reaction mix indicates that misfolded Syn was present in the sample. In a single round reaction, a portion of the reaction mix is not removed and incubated with additional mutated rSyn in a separate reaction mixture.
[0079] Sonication: The process of disrupting or dispersing biological materials using sound wave energy.
[0080] Specific binding agent: An agent that binds substantially only to a defined target. In some embodiments, a specific binding agent is an antibody that specifically binds misfolded Syn.
[0081] The term specifically binds refers to the preferential association of an antibody or other ligand, in whole or part, with an antigen. Specific binding may be distinguished as mediated through specific recognition of the antigen. Although selectively reactive antibodies bind antigen, they may do so with low affinity. On the other hand, specific binding results in a much stronger association between the antibody (or other ligand) and antigen (or cells bearing the antigen) than between the bound antibody (or other ligand) and another protein (or cells lacking the antigen). Specific binding typically results in greater than 2-fold, such as greater than 5-fold, greater than 10-fold, or greater than 100-fold increase in amount of bound antibody or other ligand (per unit time) to a cell or tissue expressing the target epitope as compared to a cell or tissue lacking this epitope. A variety of immunoassay formats are appropriate for selecting antibodies or other ligands specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See Harlow & Lane, Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York (1988), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity.
[0082] Synuclein: The synuclein family includes , and synuclein. Alpha synuclecin (Syn) is abundant in the human brain. It is believed to pay a role in maintaining a supply of synaptic vesicles in presynaptic terminals. The wild-type human Syn protein is made of 140 amino acids and is encoded by the SNCA gene. An exemplary wild-type human Syn sequence is shown in SEQ ID NO: 1. Exemplary mRNA and protein sequences for human Syn are provided in GENBANK Accession No. NM_000345.3, Sep. 15, 2017, incorporated herein by reference, and Accession Number: NP_000336.1, as available on Sep. 12, 2017. Exemplary mRNA and protein sequences for mouse Syn are provided in GENBANK Accession No. NM_001042451.2, Sep. 18, 2017, incorporated herein by reference. There are three domains of wild-type Syn. Residues 1-60 are an amphipathic N-terminal region dominated by four 11-residue repeats including the consensus sequence KTKEGV (amino acids 21-26 of SEQ ID NO: 1). This sequence has a structural alpha helix propensity similar to apolipoproteins-binding domains. Residues 61-95 are a central hydrophobic region which includes the non-amyloid- component (NAC) region, involved in protein aggregation. Residues 96-140 are a highly acidic and proline-rich region which has no distinct structural propensity.
[0083] In some embodiments, an Syn polypeptide includes 1-10 point mutations, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 point mutations as compared with SEQ ID NO: 1. Point mutation include, but are not limited to, mutations a K23, D2, K21, K45, T59, G67, V77, A78. An Syn polypeptide can also include a deletion of up to 11 amino acids, such as in residues 1-60. An exemplary Syn deletion of use has a deletion comprising, or consisting of, amino acids 2-11.
[0084] Misfolded Syn can aggregate or oligomerize to form insoluble aggregates and/or higher oligomers, leading to the formation of Syn aggregates that can be in the form of protofibrils, fibrils, plaques or inclusion bodies. Soluble Syn remains in solution in biological fluids and pharmaceutically acceptable carriers. Aggregates of misfolded Syn can precipitate and form fibrils, deposits, tangles, plaques, or other forms that are insoluble in biological fluids and pharmaceutically acceptable carriers. Seed refers to misfolded Syn aggregates with catalytic or templating activity for inducing further misfolding, oligomerization, and/or aggregation.
[0085] Synucleinopathy: A disease wherein Lewy bodies, including misfolded synuclein, are present. Synucleinopathies include, but are not limited to, Parkinson disease (PD), MSA and Lewy body dementia. A list of exemplary synucleinopathies is provided in a Table below. Lewy body dementia (LBD) is a progressive brain disorder in which Lewy bodies (abnormal deposits of Syn) build up in areas of the brain that regulate behavior, cognition, and/or movement. LBD is a term that includes two clinical diagnoses: Parkinson disease dementia and dementia with Lewy bodies (DLB). PD has a more dopamine associated deposition of Syn and DLB has a more diffuse deposition throughout the brain. Insoluble aggregates in brain tissue that include Syn (Lewy bodies) are associated with multiple neurological disorders, including neurodegenerative diseases, Parkinson disease and DLB. A disorder associated with a Syn aggregates in brain tissue is referred to as synucleinopathy. The presence of Lewy bodies in neurons of the substantia nigra is the histopathological hallmark of Parkinson disease, and Lewy bodies are found in brain tissue in DLB.
[0086] Truncated: A protein that is not the full length native sequence, and thus includes fewer amino acids than the native protein. In some embodiments, a truncated protein, such as a mutated rSyn protein, does not include N-terminal amino acids, such as amino acids 2-11 of a wild-type Syn.
[0087] Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of this disclosure, suitable methods and materials are described below. The term comprises means includes. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
[0088] Suitable methods and materials for the practice or testing of the disclosure are described below. However, the provided materials, methods, and examples are illustrative only and are not intended to be limiting. Accordingly, except as otherwise noted, the methods and techniques of the present disclosure can be performed according to methods and materials similar or equivalent to those described and/or according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification (see, for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, 1989; Sambrook et al., Molecular Cloning: A Laboratory Manual, 3d ed., Cold Spring Harbor Press, 2001; Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates, 1992 (and Supplements to 2000); Ausubel et al., Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, 4th ed., Wiley & Sons, 1999).
II. Overview of Several Embodiments
[0089] Methods are disclosed herein for determining whether a subject has a synucleinopathy. The subject can be a human. The synucleinopathy can be, for example, Parkinson disease, Dementia with Lewy Bodies, or multiple system atrophy. Additional synucleinopathies are disclosed below (see the Table).
[0090] In some embodiments, the methods include performing an Syn seeding assay on a biological sample from the subject, or a fraction thereof. The biological sample can be a nasal brushing, saliva, skin, blood, serum, plasma, cerebrospinal fluid, feces, urine or tissue sample, such as, but not limited to, a brain tissue sample. The fraction can be produced by incubating the biological sample with IO particles, optionally washing the particles, and using the IO particles in the reaction mix. In further embodiments, the assay includes: contacting a biological sample or fraction thereof with a soluble mutated rSyn to form a first reaction mixture, wherein the soluble mutated rSyn includes an amino acid sequence a) comprising one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) a deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1. Any amino acid can be inserted at amino acids K23, D2, K21, K45, T59, G67, V77, and A78. The reaction mixture is incubated to permit coaggregation of misfolded Syn aggregates present in the biological sample, or fraction thereof, with the mutated rSyn, and incubation conditions are maintained that promote coaggregation of the mutated rSyn with the misfolded Syn aggregates to result in a conversion of the soluble mutated rSyn to mutated rSyn aggregates while inhibiting spontaneous aggregation of soluble mutant rSyn. Mutated rSyn aggregates (that include misfolded mutated rSyn) that are formed are agitated wherein the conditions include shaking the reaction mixture in a shaking cycle, wherein each shaking cycle comprises a period of rest and a period of shaking. Misfolded mutated rSyn aggregates are detected in the reaction mixture. Detection of misfolded mutated rSyn aggregates in the reaction mixture indicates that the subject has the synucleinopathy.
[0091] In some embodiments, the soluble mutated rSyn can include the amino acid sequence of one of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. In further embodiments, the soluble mutated rSyn can consist of the amino acid sequence of one of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. In additional embodiments, the soluble misfolded rSyn can include the amino acid sequence of one of SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. In more embodiments, the soluble misfolded rSyn can consist of the amino acid sequence of one of SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. When the mutated rSyn includes at least six histidines, the protein can be purified using immobilized metal ion affinity chromatography, such as, but not limited to, nickel ion affinity chromatography.
[0092] In further embodiments, detecting the presence of misfolded mutated rSyn aggregates comprises the use of fluorescence. In some embodiments, the presence of mutated rSyn aggregates can be detected using an amyloid-sensing dye. The dye can be, for example, thioflavin T or thioflavin S. Thus, the reaction mix can include thioflavin T (ThT), and detecting mutated rSyn aggregates can include detecting fluorescence. In more embodiments, misfolded mutated rSyn aggregates can be detected within 24-48 hours. In other embodiments, misfolded mutated rSyn aggregates can be detected after 18-35 hours. Additional embodiments are disclosed below.
[0093] In additional embodiments, agitating aggregates can include agitating aggregates in the absence of sonication. In further embodiments, period of rest and the period of shaking are substantially equal in the shaking cycle. The shaking cycle can be 20 to 180 seconds in length. In some examples, the period of rest and the period of shaking are each 30-60 seconds in length, such as 60 seconds in length.
[0094] In further embodiments, the incubation conditions include the use of a temperature of about 30 to about 55 C. In some non-limiting examples, the incubation conditions include the use of a temperature of about 42 C.
[0095] The incubation conditions can include 0-0.1% sodium dodecyl sulfate (SDS). In some embodiments, the incubation conditions include SDS. In some non-limiting examples, the incubation conditions include 0.001%-0.005% SDS.
[0096] In more embodiments, the reaction mixture includes 1 to 10 beads per 100 l, such as wherein the reaction mixture comprises 6 beads per 100 . The beads can be about 0.5 mm to about 3 mm in diameter, such as about 1 mm in diameter. In some embodiments, the beads are glass.
[0097] Methods are also provided for detecting misfolded Syn in a biological sample or fraction thereof. The biological sample can be from a human. In some embodiments, the biological sample is a nasal brushing, saliva, skin, blood, serum, plasma, cerebrospinal fluid, feces, urine or tissue sample, such as a brain tissue sample. These methods include (a) mixing the biological sample or fraction thereof with a purified soluble mutated rSyn to make a reaction mix, wherein the soluble mutated rSyn includes an amino acid sequence a) comprising one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) with a deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1.
[0098] The methods also include (b) performing an amplification reaction that includes the steps of (i) incubating the reaction mix to permit coaggregation of the soluble mutated rSyn with misfolded Syn that may be present in the reaction mix, and maintaining incubation conditions that promote coaggregation of the soluble mutated rSyn with the misfolded Syn and result in a conversion of the soluble mutated rSyn to misfolded rSyn aggregates initiated by the presence of misfolded Syn in the sample, while inhibiting development of spontaneously arising rSyn aggregates; and (ii) agitating aggregates formed during step (i), in shaking cycles, wherein each shaking cycle of the shaking cycles comprises a period of rest and a period of shaking, wherein agitating is performed in the absence of sonication. Furthermore, the methods include (c) detecting misfolded rSyn aggregates in the reaction mix, and detection of misfolded rSyn in the reaction mix indicates that misfolded Syn was present in the biological sample.
[0099] In some embodiments, the presence of misfolded Syn in a biological sample or fraction thereof indicates that the subject from whom the sample was taken has a synucleinopathy. The synucleinopathy can be, for example, Parkinson disease, Lewy body dementia, or multiple system atrophy.
[0100] The soluble mutated rSyn can include the amino acid sequence of one of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. The soluble mutated rSyn can consist of the amino acid sequence of one of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. The soluble misfolded rSyn can include the amino acid sequence of one of SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. The soluble misfolded rSyn can consist of the amino acid sequence of one of SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. When the mutated rSyn includes at least six histidines, the protein can be purified using immobilized metal ion affinity chromatography, such as, but not limited to, nickel ion affinity chromatography.
[0101] In some embodiments, detecting the presence of misfolded mutated rSyn aggregates comprises the use of fluorescence. In some embodiments, the presence of mutated rSyn aggregates can be detected using an amyloid-sensing dye. The dye can be, for example, thioflavin T or thioflavin S. Thus, the reaction mix can include thioflavin T (ThT), and detecting mutated rSyn aggregates can include detecting fluorescence. In more embodiments, misfolded mutated rSyn aggregates can be detected within 24-48 hours. Other embodiments are disclosed below.
[0102] In further embodiments, agitating aggregates in step (ii) comprises agitating aggregates in the absence of sonication. In yet other embodiments, the period of rest and the period of shaking are substantially equal in the shaking cycle in step (ii). In some non-limiting examples, the shaking cycle in step (ii) is 20 to 180 seconds in length. In other non-limiting examples, the period of rest and the period of shaking are each 30-60 seconds in length. For example, the period of rest and the period of shaking can be each 60 seconds in length.
[0103] In yet other embodiments, the amplification reaction is performed at a temperature of about 30 to about 55 C., such as at a temperature of about 42 C.
[0104] In further embodiments, the amplification reaction comprises 0-0.1% SDS. The amplification reactions can include SDS. In some non-limiting examples, the amplification reaction comprises 0.001%-0.005% sodium dodecyl sulfate.
[0105] In additional embodiments, misfolded mutated rSyn aggregates can be detected within 24-48 hours.
[0106] In yet other embodiments, the reaction mix includes 1 to 10 beads per 100 l. In some non-limiting examples, the reaction mix includes 6 glass beads per 100 . In more embodiments, the beads are about 0.5 mm to about 3 mm in diameter, such as about 1 mm in diameter. In other non-limiting examples, the beads are glass.
III. Substrates
[0107] Disclosed herein are methods for determining whether a subject has a synucleinopathy using a seeded Syn polymerization assay, which is performed on a biological sample from the subject, or fraction thereof. Also disclosed herein are methods for determining if misfolded Syn is present in a sample, such as a biological sample. In these assays, the sample is contacted with a purified mutated recombinant -synuclein (rSyn), wherein the mutated rSyn has point mutations at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) a deletion of up to ten amino acids in amino acids 2-11 of the amino terminus.
[0108] A reference sequence for human Syn is provided as SEQ ID NO: 1. Thus, references to positions, such as K23, D2, K21, K45, T59, G67, V77, and/or A78, or deletion of amino acids 2-11, with regard to the sequence shown in SEQ ID NO: 1. Exemplary amino acid sequences of use in the disclosed assays are provided as SEQ ID NOs: 3-24.
[0109] In some embodiments, the mutated rSyn can include one of SEQ ID NO: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. While the mutated rSyn can consist of one of SEQ ID NOs: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23, it need not be limited to this sequence.
[0110] In one example, a conservative variant rSyn can be utilized, that functionally performs substantially like the reference mutant rSyn. For example, a conservative variant of a mutated rSyn protein, will aggregate with misfolded Syn, and will form aggregates with substantially the same kinetics under similar reaction conditions. In this example, a mutated rSyn protein and the conservative variant do not have the same amino acid sequences, but have changes at residues that do not substantially affect reaction kinetics. The conservative variant can have, for instance, one, two, three, four, or five substitutions in the amino acid sequence. However, a conservative variant of a mutant rSyn still contains, for example, a) the one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) the deletion of up to ten amino acids in amino acids 2-11. The conservative amino acid substitutions can occur in any domain of the mutated rSyn protein. However, generally the a) one to eight point mutations in SEQ ID NO: 1, wherein the point mutations are at residues K23, D2, K21, K45, T59, G67, V77, and/or A78 and/or b) a deletion of up to ten amino acids in amino acids 2-11 of SEQ ID NO: 1, is/are maintained.
[0111] In additional embodiments, 1-20 amino acids, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids can be added to the amino or carboxyl terminus of the mutated rSyn. These amino acids can be any amino acids. In some non-limiting examples, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 histidines can be added at either the amino or carboxyl terminus of a mutated rSyn for purification purposes. Linkers can also be added. The mutated rSyn protein can include for example, 6, 7, 8, 9 or 10 histidines at either the N or the C terminus. Exemplary mutated rSyn that include additional amino acids are shown in SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. Thus, the mutated rSyn can include the amino acid sequence of one of SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. The mutated rSyn can consist of the amino acid sequence of one of SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24. The embodiments are not mutually exclusive. Thus, additional amino acids can be added at the amino and/or carboxyl terminus, and conservative substitutions can also be included.
[0112] One of skill in the art can readily produce mutated rSyn protein that includes one or more amino acid substitutions at K23, D2, K21, K45, T59, G67, V77, and/or A78. In some embodiments, the mutated rSyn includes 2, 3, 4, 5, 6, 7 or all 8 of these mutations. As noted above, the mutated rSyn can also be a deletion mutant, wherein amino acids 2-11 are deleted. The mutated rSyn can also be a deletion mutant, wherein amino acids 2-11 are deleted, and also can include 1, 2, 3, 4, 5, 6, or 7 mutations at positions K23, D2, K21, K45, T59, G67, V77, and/or A78 (with reference to the wild-type sequence, e.g., SEQ ID NO: 1). Mutated rSyn or conservative variants that include these amino acid sequences are of use in the methods disclosed herein. Mutated rSyn or conservative variants that consist of these amino acid sequences are of use in the methods disclosed herein. As discussed above, an additional 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids can be added to the amino or carboxyl terminus of the mutated rSyn. These polypeptides are all of use in the methods disclosed herein.
[0113] The mutated rSyn disclosed herein can be obtained by methods well-known in the art for recombinant peptide expression and purification. A DNA molecule encoding a mutated rSyn can be generated. The DNA sequence is deduced from the protein sequence based on known codon usage. See, e.g., Old and Primrose, Principles of Gene Manipulation 3.sup.rd ed., Blackwell Scientific Publications, 1985; Wada et al., Nucleic Acids Res. 20: 2111-2118 (1992). In some embodiments, the DNA molecule includes additional sequence, for example recognition sites for restriction enzymes which facilitate its cloning into a suitable cloning vector, such as a plasmid. Nucleic acids are provided including the coding regions, non-coding regions, or both, either alone or cloned in a recombinant vector, as well as oligonucleotides and related primer and primer pairs corresponding thereto. Nucleic acids may be DNA, RNA, or a combination thereof. Vectors can be expression vectors. Nucleic acids encoding mutated rSyn polypeptides may be obtained by any method known within the art (e.g., by PCR amplification using synthetic primers hybridizable to the 3- and 5-termini of the sequence and/or by cloning from a cDNA or genomic library using an oligonucleotide sequence specific for the given gene sequence, or the like). Nucleic acids can also be generated by chemical synthesis.
[0114] Any of the methodologies known within the relevant art regarding the insertion of nucleic acid fragments into a vector may be used to construct expression vectors that contain a chimeric gene comprised of the appropriate transcriptional/translational control signals and peptide-coding sequences. Promoter/enhancer sequences within expression vectors can be plant, animal, insect, or fungus regulatory sequences. An inducible or constitutive promoter can be operably linked to a nucleic acid encoding an engineered chloride channel receptor. In some embodiments, the expression of the polypeptides encoded by the vectors are controlled by a constitutive promoter. Suitable promoters include, but are not limited to, the T7 promoter. In other embodiments, the expression of the polypeptides encoded by the vectors are controlled by an inducible or repressible promoter. Typically, the promoter is a constitutive promoter that results in high levels of transcription upon introduction into a host cell in the absence of additional factors. Optionally, the transcription control sequences include one or more enhancer elements, which are binding recognition sites for one or more transcription factors that increase transcription above that observed for the minimal promoter alone.
[0115] It may be desirable to include a polyadenylation signal to effect proper termination and polyadenylation of the gene transcript. Exemplary polyadenylation signals have been isolated from bovine growth hormone, SV40 and the herpes simplex virus thymidine kinase genes. Any of these or other polyadenylation signals can be utilized in the context of the adenovirus vectors described herein.
[0116] Thus, in one embodiment, the polynucleotide encoding a mutated rSyn is included in a vector for expression. Suitable viral vectors include retrovirus vectors, orthopox vectors, avipox vectors, fowlpox vectors, capripox vectors, suipox vectors, adenoviral vectors, herpes virus vectors, alpha virus vectors, baculovirus vectors, Sindbis virus vectors, vaccinia virus vectors and poliovirus vectors. Specific exemplary vectors are poxvirus vectors such as vaccinia virus, fowlpox virus and a highly attenuated vaccinia virus (MVA), adenovirus, baculovirus, yeast and the like. A vector can also be used for expression in bacterial cells. Such vectors are known in the art, and include, for example, plasmids such as pBR322.
[0117] Any of the disclosed vectors can be expressed in suitable host cells. Following expression in host cells, such as eukaryotic or prokaryotic host cell, the recombinant mutated rSyn is purified.
[0118] The inclusion of at least six histidines facilitates purification by immobilized metal ion affinity chromatography. Immobilized metal affinity chromatography (IMAC), also known as metal chelate affinity chromatography (MCHC), is a specialized aspect of affinity chromatography. The principle behind IMAC lies in the fact that many metal ions, i.e., nickel, zinc, cobalt and copper, can coordinate to the amino acids histidine, cysteine, and tryptophan via electron donor groups on the amino acid side chains. To utilize this interaction for chromatographic purposes, the metal ion must be immobilized onto an insoluble support. This can be done by attaching a chelating group to the chromatographic matrix. The most common chelating group used in this technique is iminodiacetic acid (IDA). It is coupled to a matrix such as SEPHAROSE 6B, via a long hydrophilic spacer arm. The spacer arm ensures that the chelating metal is fully accessible to all available binding sites on a protein. Another chelating group is tris(carboxymethyl)-ethylenediamine (TED). Cu.sup.++, Ni.sup.++, and Co.sup.++ are also applied for certain proteins. Interactions between immobilized metals and tryptophan, tyrosine, or cysteine residues of proteins have been reported, however, these are generally weaker interactions.
[0119] In some embodiments, a solution including he protein of interest, such as a mutated rSyn, is used at a physiological pH, such as a pH of about 7.2 to 7.8, such as about 7.4 to about 7.6, such as about 7.5. The solution is applied to an IMAC column, so that the protein binds to the column, and eluting the protein from the column, see U.S. Pat. No. 5,932,102, incorporated herein by reference. In some embodiments, the resin is washed with Tris buffer to remove proteins that do not specifically interact with the metal, such as a nickel ion. With nickel chromatography methods, washing efficiency can be improved by the addition of imidazole. One of skill in the art can readily use metal ion chromatography for the purification of proteins. The purification can use metal ion chromatography, and/or ion exchange chromatography.
[0120] In some embodiments, the column is washed, and then eluted with, for example, with 10 mM to 500 mM imidazole, such as about 50 mM imidazole to 500 mM imidazole, for example about 100 mM imidazole to about 500 mM imidazole or 150 mM imidazole to about 250 mM imidazole. One suitable, non-limiting buffer includes about 20 mM Tris, pH 7.5, and 500 mM imidazole. Another suitable, non-limiting buffer includes about 20 mM Tris, pH 7.5, and 50 mM imidazole.
[0121] In some embodiments, a solution including the protein of interest, such as a mutated rSyn, is used at a pH of about 7.2 to 7.8, such as about 7.4 to about 7.6, such as about 7.5. The solution is applied to an anion-exchange column, so that the protein binds to the column, and then the protein is eluted from the column, see Paslawski et al., Methods Mol Biol. 2016;1345:133-50. doi: 10.1007/978-1-4939-2978-8_9. In some embodiments, the resin is washed with Tris buffer to remove proteins that do not specifically interact with the resin, such as, but not limited to, Q-HP. With ion exchange chromatography methods, washing efficiency can be improved by the addition of salt, such as NaCl. One of skill in the art can readily use ion exchange chromatography for the purification of proteins.
[0122] In some embodiments, the column is washed, and then eluted with, for example, with up to 100 mM and up to 1000 mM NaCl, such as about 100 mM imidazole and 500 mM NaCl, for example about 50 mM imidazole to about 100 mM NaCl or 250 mM imidazole to about 1000 mM NaCl. One suitable, non-limiting buffer includes about 20 mM Tris, pH 7.5, and 1000 mM NaCl.
IV. Synuclein RT-QuIC
[0123] Methods are disclosed herein for detecting misfolded Syn in a biological sample, or fraction thereof, and determining whether a subject has a synucleinopathy. Synucleinopathies include, but are not limited to, the diseases listed in the table below (from Galvin et al., Arch Neurol. 2001;58(2):186-190):
TABLE-US-00002 Synucleinopathies* Parkinson disease Sporadic Familial with S mutations Familial with mutations other than S Dementia with Lewy bodies Pure Lewy body dementia Lewy body variant of Alzheimer disease Familial Alzheimer disease with APP mutations Familial Alzheimer disease with PS-1 mutations Familial Alzheimer disease with PS-2 mutations Down syndrome Multiple system atrophy Shy-Drager syndrome Striatonigral degeneration Olivopontocerebellar atrophy Neurodegeneration with brain iron accumulation, type 1 Hallervorden-Spatz syndrome Neuroaxonal dystrophy Other diseases that may have synuclein-immunoreactive lesions Traumatic brain injury Pick disease Amyotrophic lateral sclerosis *S Indicates -Synuclein; APP, amyloid precursor protein; and PS-1 and PS-2, presenilin-1 and -2.
[0124] Synucleinopathies include diseases wherein Lewy bodies are present. Synucleinopathies include, but are not limit to, Parkinson disease, multiple system atrophy (MSA) and Lewy body dementias. In some embodiments, the methods include selecting a subject suspected of having, or that has, a synucleinopathy, such as, but not limited to, Parkinson disease, MSA, and Lewy body dementias. Thus, the disclosed methods can be used to diagnose, or confirm the diagnosis of, a synucleinopathy. The disclosed methods can also be used to detect Syn in a sample from any subject of interest, including subjects that are at risk for developing a synucleinopathy, or a subject suspected of having a synucleinopathy.
[0125] These methods are of use with any biological sample of interest, or a fraction of the biological sample of interest. The biological sample from a subject can be, but not is not limited to, a brain homogenate and/or a cerebrospinal fluid sample. In some embodiments, the biological sample is a nasal brushing, skin, saliva, cerebrospinal fluid, blood, fecal, tissue, urine, or serum sample. If the biological sample is a tissue sample, it can be any tissue of interest, including a brain sample, or nasal brushing, saliva, skin, blood, serum, plasma, cerebrospinal fluid, feces, urine or tissue sample. The tissue can be fresh tissue or fixed tissue, such as formalin-fixed tissue. In some specific non-limiting examples, the same is a cerebrospinal fluid sample.
[0126] The sample can be diluted, such as in a buffer. In some embodiments, serial dilutions of the sample are tested. The sample can be diluted, for example, at 10.sup.1, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9 or 10.sup.10 dilution.
[0127] A fraction of the biological sample can be prepared. In some embodiments, to prepare the fraction, the biological sample can be contacted with particles comprising a paramagnetic material, such as, but not limited to, 10, that allows the separation of components that bind to the surface of the particles. The particles can allow the extraction or concentration of Syn from the biological sample, prior to performing an amplification reaction, such as QuIC or RT-QuIC. The particles can be, for example, composed of a polymer coated with an antibody or another protein ligand, or can be particles formed of IO itself (without another substrate).
[0128] The particles can be of any size, such as diameter of the particles from approximately 1 mm to approximately 0.001 mm. The mean diameter of the population of particles may be from approximately 1 mm to approximately 0.1 mm. For example, the mean diameter of the particles may be 1 mm, 0.5mm, or 0.01 mm. The population of particles may have a standard distribution of diameters of approximately plus or minus 10% from the mean diameter. In some embodiments, the diameter of the particles may be substantially homogeneous.
[0129] In some embodiments, the particles comprise iron oxide (IO), or another paramagnetic material, and the Syn binds the particles. This can be used to isolate and concentrate the Syn from the biological sample. The biological sample can be contacted with the particles, such as the IO particles, one, two, three or more times. The particles can be separated from the biological sample using a magnet or can be centrifuged or allowed to settle for separation. In some embodiments, about 10 g to about 500 g of particles, such as about 50 g, about 60 g, about 70 g, about 80 g, about 90 g, about 100 g, about 200 g, about 300 g, about 400 g or about 500 g of particles are contacted with the biological sample, such as about 100 L to about 1,000 L, or about 200 L to about 200 L of the biological sample, such as about 500 L of the biological sample. Exemplary non-limiting concentrations are provided in the Examples section.
[0130] In further embodiments, the particles, such as the IO particles, can be washed prior to performing the amplification reaction. The particles, such as the IO particles, can be washed one, two, three or more times. In some embodiments, washing the iron oxide particles includes contacting the iron oxide particles with a buffered saline solution, such as phosphate buffered saline, Hepes buffered saline or Tris buffered saline, and collecting the iron oxide particles. In some embodiments, the buffered saline solution has a pH of about 7.2 to about 7.8, such as about 7.4 to about 7.6, such as about 7.5. In one non-limiting example, the buffered saline is phosphate buffered saline.
[0131] In some embodiments, the buffered saline solution further comprises a detergent. The detergent can be any detergent of interest, such as, but not limited to, sodium dodecyl sulfate
[0132] (SDS). The detergent can be an anionic or a cationic detergent. In some non-limiting examples, the buffered saline solution comprises about 0.01 to about 1% SDS, such as about 0.01, about 0.02, about 0.03, about 0.04, about 0.05, about 0.06, about 0.07, about 0.08, about 0.09, about 0.1, about 0.2, about 0.3, about 0.4, about 0.5, about 0.6, about 0.7, about 0.8, about 0.9 or about 1.0% SDS. In a specific non-limiting example, about 0.05% SDS to about 0.1% SDS is included in the buffered saline solution, such as phosphate buffered saline.
[0133] In some embodiments, about 10 g to about 500 g of particles, such as about 50 g, about 60 g, about 70 g, about 80 g, about 90 g, about 100 g, about 200 g, about 300 g, about 400 g or about 500 g of particles are contacted with about 100 L of the biological sample. The mixture may comprise approximately 10, 20, 30, 40 or 50 mg of particles per 100 L of biological sample. For example, about 10 to about 50 mg of particles can be used per 100 L of biological sample, from about 20 to about 50 mg of beads per 100 L, or about 30 to about 50 mg of particles per 100 L.
[0134] In some embodiments, the fraction is resuspended in a buffered saline solution, optionally including a detergent, prior to performing the assay. Suitable detergent and concentration are listed in the paragraphs above.
[0135] In some non-limiting examples, the sample is a cerebral spinal fluid sample and the fraction is resuspended in buffered saline. In other non-limiting examples, the sample is a human plasma sample, and the fraction is suspended in buffered saline including a detergent such as SDS, such as, but not limited to, phosphate buffered saline including 0.05% SDS or 0.01% SDS. In further non-limiting examples, the sample is a plasma sample, and the fraction is resuspended in buffered saline, such as PBS. The biological sample can be urine, feces, saliva, skin, whole blood, a blood fraction, cerebral spinal fluid, or a nasal brushing.
[0136] QuIC and RT-QuIC methods generally involve mixing a biological sample, or fraction thereof, that can include misfolded Syn with a purified mutated rSyn to make a reaction mix, and performing a primary reaction to form and amplify specific forms of Syn protein the mixture, by using incubation conditions that promote coaggregation of the mutated rSyn protein with the misfolded Syn to result in a conversion of the mutated Syn protein to mutated rSyn aggregates. In these reactions, the development of spontaneously aggregated rSyn is inhibited or delayed relative to reactions seeded with misfolded Syn in a test sample.
[0137] Any of the substrates disclosed above can be used in the present methods. Without limitation, the substrate can be a mutated, truncated rSyn protein that does not include amino acids 2-11. Thus, the mutated rSyn protein can include amino acids 1 and 12-140 of an Syn, with reference to wild-type human Syn, for example see SEQ ID NO: 1. An exemplary amino acid sequence for this protein is provided as SEQ ID NO: 7. Thus the mutated rSyn can include SEQ ID NO: 7 or SEQ ID NO: 8. The mutated rSyn can consist of SEQ ID NO: 7 or SEQ ID NO: 8.
[0138] The substrate can be a mutated rSyn that includes one or more point mutations, such as at residues K23, D2, K21, K45, T59, G67, V77, and/or A78. Suitable substrates are disclosed above. The substrate can include 1, 2, 3, 4, 5, 6, 7 or all 8 of these mutations. In some non-limiting examples, the mutated rSyn includes only one mutation at K23, D2, K21, K45, T59, G67, V77, and/or A78. In specific non-limiting examples, the mutant rSyn comprises one of SEQ ID NOs: 3, 5, 9, 11, 13, 15, 17, 19, 21 or 23, or a conservative variant thereof. In other specific non-limiting examples, the mutant rSyn comprises, or consists of, one of SEQ ID NOs: 4, 6, 10, 12, 14, 16, 18, 20, 22 or 24, or a conservative variant thereof.
[0139] The mutated rSyn can also be a deletion mutant, wherein amino acids 2-11 are deleted, and also can include 1, 2, 3, 4, 5, 6, or 7 mutations at positions K23, D2, K21, K45, T59, G67, V77, and/or A78 (with reference to the wild-type sequence, e.g., SEQ ID NO: 1). The mutation can be a substitution of K23, D2, K21, K45, T59, G67, V77, and/or A78 with any amino acid that is not the native amino acid. Optionally, the mutated rSyn can include additional amino acids and the amino or carboxyl terminus.
[0140] In some embodiments additional substrate is added to the reaction mix. In other embodiments, additional substrate is not added to the reaction mix.
[0141] This primary reaction includes incubating the reaction mix to permit the misfolded Syn aggregates present in the same, to initiate the conversion of mutated rSyn to misfolded mutated rSyn aggregates, fragmenting any aggregates formed during the incubation step; and repeating the incubation and fragmentation steps one or more times. In some embodiments, the primary reaction is repeated over 12, 24, 36, 48, 60, 72, 84, 96, 108, 120 hours or more. For example, the primary reaction can be repeated for about 12 to about 120 hours, such as 24 to 72 hours, or more. In other examples, the reaction can be performed for no more than about 12 hours or 24 hours, no more than 36 hours, no more than 48 hours, no more than 60 hours, no more than 72 hours, no more than 96 hours or no more than 120 hours. In several specific non-limiting examples, the reaction is performed for about 24 to about 48 hours. The reaction can be performed for 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, or 72 hours. In specific non-limiting examples, the sample is a brain tissue sample or a CSF sample.
[0142] In other embodiments, misfolded rSyn aggregates can be detected at about 6 hours, 12 hours, 15 hours, 24 hours, 35 hours, 36 hours, or 48 hours. In other embodiments, misfolded rSyn aggregates can be detected at about 6 to about 48 hours, such as about 12 to about 48 hours, such as about 24 to about 48 hours. In other embodiments, misfolded mutated rSyn aggregates can be detected after 18-35 hours. In specific non-limiting examples, the sample is a CSF sample.
[0143] In some embodiments, the method is performed without serial amplification, such that substrate bound misfolded Syn aggregates are retained in a reaction vessel, and that substrate is replenished without removing potential misfolded Syn seeds. In other embodiments, serial amplification can be performed.
[0144] In further embodiments, misfolded Syn aggregates can be amplified in a sample, by mixing the sample with purified mutated rSyn n to make a reaction mix; performing an Syn seeding assay that includes the steps of (i) contacting the biological sample or fraction thereof with a soluble mutated rSyn to form a reaction mixture; ii) incubating the reaction mixture to permit coaggregation of misfolded Syn aggregates present in the biological sample or fraction thereof with the mutated rSyn; iii) maintaining incubation conditions that promote coaggregation of the mutated rSyn with the misfolded Syn aggregates to result in a conversion of the soluble mutated rSyn to mutated rSyn aggregates while inhibiting spontaneous aggregation of soluble mutant rSyn; iv) agitating mutated rSyn aggregates formed during step iii), wherein the conditions comprise shaking the reaction mixture in a shaking cycle, wherein each shaking cycle comprises a period of rest and a period of shaking; and b) detecting misfolded mutated rSyn aggregates in the reaction mixture, and wherein detection of misfolded mutated rSyn aggregates in the reaction mixture indicates that the subject has the synucleinopathy.
[0145] Detection of misfolded mutated rSyn aggregates in the reaction mix indicates that misfolded Syn was present in the sample. Additional mutated rSyn can be added during the reaction, such as during the lag phase between the addition of the sample and the detection of mutated rSyn aggregates formation. However, in some embodiments, a portion of the reaction mix is not removed and incubated with additional mutated rSyn.
[0146] In some embodiments, the mutated rSyn can be replenished at any time by adding additional mutated rSyn to the reaction mix. In other embodiments, the mutated rSyn is not replenished by adding additional mutated rSyn to the reaction mix.
[0147] In some embodiments, the reaction includes the use of shaking in the absence of sonication. In other embodiments, the reaction uses shaking and sonication.
[0148] In either of these embodiments, the reaction can include cycles of shaking/rest that are 1:10 to 10:1 in duration, such as 1:5 to 5:1 in duration, for example, 1:2 to 2:1 in duration, or about 1:1 in duration.
[0149] The shaking cycle can be, for example, about 20 to about 180 seconds in length, such as about 30 to about 180 seconds in length, about 40 to about 180-seconds in length, about 50 to about 180 seconds in length, or about 60 to about 180 seconds in length. In some embodiments of these cycle times, the period of rest and the period of shaking are equal. In other embodiments of these cycle times, the period of rest and the period of shaking are unequal.
[0150] In some embodiments, the shaking and rest cycle are equal. In one non-limiting example, the reaction alternates 60 seconds of shaking and 60 seconds of no shaking (rest). In another non-limiting example, the reaction alternates 30 seconds of shaking and 30 seconds of no shaking (rest). However, the times can be varied, such as 45 seconds of shaking and 45 seconds of no shaking or 70 seconds of shaking and 70 seconds of no shaking.
[0151] In some embodiments, the period of rest and the period of shaking are about 120 seconds in length for the total cycle. In other embodiments, the total cycle time is about 60 to 180 seconds in length, such as, but not limited to 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, or 180 seconds in length. In non-limiting examples, the period of shaking and rest in each cycle can be equal, as discussed above.
[0152] In other embodiments, the period of rest and the period of shaking are unequal. For example, the reaction includes 90 seconds of shaking and 30 seconds of no shaking, or 100 seconds of shaking and 20 seconds of no shaking, or 80 seconds of shaking and 40 seconds of rest. In additional embodiments, the total cycle time is about 60, 70, 80, 90, 100, 110 or 120 seconds in length and includes at least 30 seconds, at least 40, or at least 50, or at least 60 seconds of shaking. In specific non-limiting examples, the total cycle time is 60 to 180 seconds in length, such as, but not limited to 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, or 180 seconds in length.
[0153] Reactions can be performed at 30-55 C., for example 35-50 C., such as 37-42 C., such as about 37 C., 42 C., or at about 42 C. to 55 C., such as 42 C. to about 50 C.
[0154] In some embodiments, the reaction is performed using sodium chloride (NaCl) at a concentration of about 50 mM to about 500 mM, such as about 100 to about 700, or about 100 mM to about 500 mM NaCl. In additional embodiments, about 100 mM, 200 mM, 300 mM, 400 mM NaCl. In other embodiments, the reaction is performed using 200 to 400 mM NaCl, such as using 170 mM NaCl. In some embodiments, the reaction does not include an added detergent, such as an anionic, cationic, and/or zwitterionic detergent. In some examples, the reaction does not include any added detergent. In further embodiments, the reaction does not include added anionic detergent, such as, but not limited to, sodium dodecyl sulfate (SDS).
[0155] In other embodiments, the reaction includes an anionic detergent, such as SDS. In some embodiments, anionic detergent at a concentration up to about 0.1% is included in the reaction. The anionic detergent concentration, such as the SDS concentration, can be, for example, about 0.0001% to about 0.005%. The anionic detergent concentration can be, for example, less than 0.005%. The detergent concentration can be, for example, about 0.0001%, 0.0002%, 0.0003%, 0.0004%, 0.0005%, 0.0006%, 0.0007%, 0.0008%, 0.0009% of an anionic detergent, such as, but not limited to, SDS. In other embodiments, the detergent concentration can be, for example, about 0.001%, 0.002%, 0.003%, 0.004%, 0.005%, 0,006%, 0.007%, 0.008%, 0.009%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09% or 0.1% of an anionic detergent, such as, but not limited to, SDS.
[0156] A solid substrate, such as a bead, such as beads can be used in the reaction. The beads can be any solid substrate, and include, but are not limited to, glass, polystyrene, silica, silica/zirconia, or metal beads. In some specific non-limiting examples, glass beads are utilized. The beads can be spherical, and have a diameter of about 0.5 mm to about 3 mm in diameter, such as about 0.5 to about 2 mm in diameter, such as about 1 to about 2 mm in diameter. In some non-limiting examples, the beads have a diameter of about 1 mm.
[0157] The beads can be included in a reaction at a concentration of 1 to 10 beads per 100 microliters (l), such as 2 to 8 beads per 100 l, such as 4 to 6 beads per 100 l. In some embodiments, the reaction includes 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 beads per 100 l. In some non-limiting examples, the beads are glass.
[0158] In an RT-QuIC assay, a reaction product, such as misfolded rSyn aggregates, is detected in real time (RT). There is generally a lag phase in a QuIC reaction, wherein amyloid cannot be detected. The lag phase is considered to end when a statistically significant amount of amyloid can be detected, as compared to the background level of fluorescence. The present methods result in a short lag time. In some embodiments, the misfolded rSyn aggregates can be detected, using fluorescence, at about 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 60 hours, 72 hours, 84 hours or 90 hours. In additions embodiments, misfolded rSyn aggregates can be detected at about 6 to about 24 hours, such as about 12 to about 24 hours, such as about 18 to about 24 hours. In other embodiments, misfolded rSyn aggregates can be detected at about 6 to about 48 hours, such as about 12 to about 48 hours, such as about 24 to about 48 hours. In further embodiments, misfolded rSyn aggregates can be detected at about 6 to about 72 hours, such as about 12 to about 72 hours, such as about 24 to about 72 hours, such as about 48 to 72 hours or 60 to 72 hours. In further embodiments, misfolded rSyn aggregates can be detected at about 6 to about 90 hours, such as about 12 to about 90 hours, such as about 24 to about 90 hours, 48 to 90 hours, 60 to 90 hours or 72 to 90 hours. In specific non-limiting examples, the sample is a CSF sample.
[0159] Thus, QuIC reaction can be an RT-QuIC reaction, and thus can include an amyloid-sensing dye, such as thioflavin T (ThT) or thioflavin S (ThS), or any other substrate which allows detection of the amyloid. Exemplary dyes include P-FTAA (quadro-formylthiophene acetic acid), HS-68, HS-67, HS-72, P-HTAA, P-HTAA-Se, P-FTAA-Se, and HS-53. The structure of these dyes is shown in Klingstedt et al., Chemistry 2013 Jul 29;19(31):10179-92. doi: 10.1002/chem.201301463, Epub 2013 Jun. 18, which is incorporated herein by reference.
[0160] The RT-QuIC assay incorporates mutated rSyn as a substrate, intermittent shaking of the reactions such as in multi-well plates, largely detergent- and chaotrope-free reaction conditions and, in some embodiments, ThT- or ThS-based fluorescence detection of any resulting amyloid protein generated by the reaction. One advantage of using ThT (or ThS) is that it can be included in the reaction mixture. However, any of the dyes disclosed above can also be utilized.
[0161] In some embodiments, ThT is utilized. Thioflavin T is a benzothiazole dye that exhibits enhanced fluorescence upon binding to amyloid fibrils (see Khurana et al., J. Structural Biol. 151: 229-238, 2005), and is commonly used to detect amyloid fibrils.
##STR00001##
[0162] Following amplification, the misfolded rSyn aggregates in the reaction mix is detected. If ThT is included in the reaction (RT-QuIC), then can be detected using fluorescence at 450+/10 nm excitation and 480+/10 nm emission (see for example, Wilham et al., PLOS Pathogens 6(12): 1-15, 2010, incorporated herein by reference.) ThT can be included directly in the amplification mixture. In some embodiments, if ThT is included, the reaction mix does not include high concentrations of chaotropes or detergents.
[0163] In one non-limiting example, in RT-QuIC reactions the final concentration of ThT in each reaction is 1 mM. In other examples, ThT is used at a final concentration of about 0.001 to 10 mM in the reaction.
[0164] Other dyes can be used in place of ThT, such as Thioflavin S, Congo red and Congo red-derived fluorescent probe (trans, trans),-1-bromo-2,5-bis-(3-hydroxycarbonyl-4-hydroxy)styrylbenzene (BSB). One of skill in the art can readily utilize these dyes.
[0165] The fluorescence emitted by ThT (or ThS) can be measured in real time (RT). There is usually a lag phase in a RT-QuIC reaction, wherein ThT fluorescence cannot be detected. At some point, a statistically significant amount of fluorescence can be measured that is above background fluorescence. The time of initiation of the reaction to the time of appearance of a statistically significant amount of detectable fluorescence, which represents the presence of misfolded rSyn aggregates, can be measured as the lag phase. The length of the lag phase can vary when different substrates are used. In some embodiments, the use of the mutated rSyn substrates, disclosed above, shortens the lag time for the presently disclosed reactions, thus allowing misfolded rSyn aggregates to be detected quickly.
[0166] If standard QuIC is utilized, misfolded rSyn aggregates can be detected by means other than ThT fluorescence, for example, using an antibody (see below).
[0167] Two types of misfolded Syn protein can be generated in QuIC reactions, one arising spontaneously without seeding and the other initiated by the presence of misfolded Syn in the test sample. An unexpectedly superior decrease in the speed and amount of spontaneously arising rSyn aggregates formed is achieved with the QuIC assays disclosed herein. Thus, the RT-QuIC (which includes thioflavin T) reactions disclosed herein provides sensitive and specific detection of misfolded Syn, and allows diagnosis of synucleinopathies.
V. Methods for Detecting in the Absence of a Dye
[0168] Once aggregates have been generated, the aggregates can be detected in the reaction mixture. Direct and indirect methods can be used for detection of aggregates in a reaction mixture. Detection using a fluorescent dye is described above. However, other methods can be utilized.
[0169] A. Western Blot
[0170] In some examples, reaction mixtures are then subjected to Western blot for detection of aggregates. Typical Western blot procedures begin with fractionating proteins by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) under reducing conditions. The proteins are then electroblotted onto a membrane, such as nitrocellulose or PVDF and probed, under conditions effective to allow immune complex (antigen/antibody) formation, with an anti-Syn antibody. Exemplary antibodies for detection of Syn include Purified Mouse Anti-Syn Clone 42/-Synuclein (BD Transduction Laboratories). Following complex formation, the membrane is washed to remove non-complexed material.
[0171] An exemplary washing procedure includes washing with a solution such as PBS/Tween, or borate buffer. The immunoreactive bands are visualized by a variety of assays known to those in the art. For example, the enhanced chemoluminesence assay (Amersham, Piscataway, N.J.) can be used.
[0172] If desired, Syn concentration can be estimated by Western blot followed by densitometric analysis, and comparison to Western blots of samples for which the concentration of Syn is known. For example, this can be accomplished by scanning data into a computer followed by analysis with quantitation software. To obtain a reliable and robust quantification, several different dilutions of the sample generally are analyzed in the same gel.
[0173] B. ELISA, Immunochromatographic Strip Assay, and Conformation Dependent Immunoassay
[0174] As described above, immunoassays in their most simple and direct sense are binding assays. Specific non-limiting immunoassays of use include various types of enzyme linked immunosorbent assays (ELISAs), immunochromatographic strip assays, radioimmunoassays (RIA), and specifically conformation-dependent immunoassays.
[0175] In one exemplary ELISA, anti-Syn antibodies are immobilized onto a selected surface exhibiting protein affinity, such as a well in a polystyrene microtiter plate. Then, a reaction mixture suspected of containing Syn is added to the wells. After binding and washing to remove non-specifically bound immune complexes, the bound Syn can be detected. Detection generally is achieved by the addition of another anti-Syn antibody that is linked to a detectable label. This type of ELISA is a simple sandwich ELISA. Detection also can be achieved by the addition of a second anti-Syn antibody, followed by the addition of a third antibody that has binding affinity for the second antibody, with the third antibody being linked to a detectable label.
[0176] In another exemplary ELISA, the reaction mixture suspected of containing the Syn is immobilized onto the well surface and then contacted with the anti-Syn antibodies. After binding and washing to remove non-specifically bound immune complexes, the bound anti-Syn antibodies are detected. Where the initial anti-Syn antibodies are linked to a detectable label, the immune complexes can be detected directly. Again, the immune complexes can be detected using a second antibody that has binding affinity for the first anti-Syn antibody, with the second antibody being linked to a detectable label.
[0177] Another ELISA in which protein of the reaction mixture is immobilized involves the use of antibody competition in the detection. In this ELISA, labeled antibodies against Syn are added to the wells, allowed to bind, and detected by means of their label. The amount of Syn protein in a given reaction mixture is then determined by mixing it with the labeled antibodies against Syn before or during incubation with coated wells. The presence of Syn in the sample acts to reduce the amount of antibody against Syn available for binding to the well and thus reduces the ultimate signal. Thus, the aggregates of rSyn in the sample can be quantified.
[0178] Irrespective of the format employed, ELISAs have certain features in common, such as coating, incubating or binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.
[0179] In coating a plate with either antigen or antibody, one generally incubates the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate are then washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then coated with a nonspecific protein that is antigenically neutral with regard to the test antibodies. These include bovine serum albumin, casein, and solutions of milk powder. The coating allows for blocking of nonspecific adsorption sites on the immobilizing surface, and thus reduces the background caused by nonspecific binding of antibodies onto the surface.
[0180] It is customary to use a secondary or tertiary detection means rather than a direct procedure with ELISAs, though this is not always the case. Thus, after binding of a protein or antibody to the well, coating with a non-reactive material to reduce background, and washing to remove unbound material, the immobilizing surface is contacted with the biological sample or fraction thereof to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, or a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or third binding ligand.
[0181] Under conditions effective to allow immune complex (antigen/antibody) formation means that the conditions preferably include diluting the antigens and antibodies with solutions such as BSA, bovine gamma globulin, milk proteins, and phosphate buffered saline (PBS)/Tween. These added agents also tend to assist in the reduction of nonspecific background. Suitable conditions also mean that the incubation is at a temperature and for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours, at temperatures preferably on the order of 25 C. to 27 C., or can be overnight at about 4 C. or so.
[0182] Following all incubation steps in an ELISA, the contacted surface is washed so as to remove non-complexed material. An exemplary washing procedure includes washing with a solution such as PBS/Tween or borate buffer. Following the formation of specific immune complexes between the test sample and the originally bound material, and subsequent washing, the occurrence of even minute amounts of immune complexes can be determined.
[0183] To provide a detecting means, the second or third antibody generally will have an associated label to allow detection. In some examples, this is an enzyme that will generate color development upon incubating with an appropriate chromogenic substrate. Thus, for example, the first or second immune complex is contacted and incubated with a urease, glucose oxidase, alkaline phosphatase or hydrogen peroxidase-conjugated antibody for a period of time and under conditions that favor the development of further immune complex formation (for instance, incubation for two hours at room temperature in a PBS-containing solution such as PBS-Tween).
[0184] After incubation with the labeled antibody, and subsequent to washing to remove unbound material, the amount of label is quantified, for instance, by incubation with a chromogenic substrate such as urea and bromocresol purple or 2,2-azino-di-(3-ethyl-benzthiazoline-6-sulfonic acid) and H.sub.2O.sub.2, in the case of peroxidase as the enzyme label. Quantification is then achieved by measuring the degree of color generation, for instance, using a visible spectra spectrophotometer.
[0185] C. Recombinant Syn Protein Labeling
[0186] In certain embodiments, the mutated rSyn protein can be labeled to enable high sensitivity of detection of protein that is converted into aggregates. For example, the mutated rSyn can be radioactively labeled, epitope tagged, or fluorescently labeled. The label can be detected directly or indirectly. Radioactive labels include, but are not limited to .sup.125I, .sup.32P, .sup.33P, and .sup.35S.
[0187] The mixture containing the labeled protein is subjected to a Syn seeding assay, such as QuIC, and the product detected with high sensitivity by following conversion of the labeled protein to aggregates, and after removal of the unconverted protein. Alternatively, the protein can be labeled in such a way that a signal can be detected upon the conformational changes induced during conversion. An example of this is the use of FRET technology, in which the protein is labeled by two appropriate fluorophores, which upon refolding become close enough to exchange fluorescence energy (see for example U.S. Pat. No. 6,855,503).
[0188] In certain other embodiments, the use of a fluorescently-tagged substrate for the reaction is combined with the use an immunochromatographic strip test with an immobilized Syn specific antibody. Binding of the rSyn to the antibody is then detected with a fluorescence detector.
[0189] D. Protease Treatment
[0190] Misfolded Syn and rSyn can also be are separated by protease treatment. In some embodiments, the total protein concentration in the reaction is measured, such as using Coomassie blue. The reaction mixtures are incubated with, for example, Proteinase K (PK). An exemplary protease treatment includes digestion of the protein in the reaction mixture with 1-20 g/ml of PK for about 1 hour at 37 C. Reactions with PK can be stopped prior to assessment of prion levels by addition of PMSF or electrophoresis sample buffer. Depending on the nature of the sample, incubation at 37 C. with 1-50 g/ml of PK generally is sufficient to remove rSyn. The amount of protein remaining in the sample can then be measured.
[0191] rPrP-res.sup.(Sc) also can be separated from the rPrP.sup.sen by the use of ligands that specifically bind and precipitate the misfolded form of the protein, including conformational antibodies, certain nucleic acids, plasminogen, PTA and/or various peptide fragments.
EXAMPLES
[0192] Assays called Real-Time Quaking Induced Conversion (RT-QuIC) have provided ultrasensitive, specific and quantitative diagnostic tests for prion diseases (Wilham et al., 2010, PLoS Path 6:e1001217; Atarashi et al., 2011, Nat Med 17:175-178). RT-QuIC assays are multi-well plate-based reactions that can rapidly amplify oligomeric/multimeric prion seeds by as much as a trillion-fold (Wilham et al., 2010, PLoS Path 6:e1001217; Orru et al., 2011, mBio 2:e00078-11; Foutz et al., 2017, Ann Neurol 81:79-92). Prion RT-QuIC assays have been applied successfully to a variety of biological samples including brain (Wilham et al., 2010, PLoS Path 6:e1001217; Peden et al., 2012, J Gen Virol 93:438-44), cerebrospinal fluid (CSF) (Orru et al., 2015, J Gen Virol 93:438-44; McGuire et al., 2012, Ann Neurol 72:278-285; Cramm et al., 2015, Mol Neurobiol 51:396-405; Sano et al., 2013, LoS One 8:e54915), whole blood and plasma (Orru et al., 2011, mBio 2:e00078-11; Vascellari et al., 2012, PLoS One 7:e48969), urine (John et al., 2013, Prion 7:253-8), and nasal brushings (Orru et al., 2014; New Engl J Med 371:519-529; Zannusso et al., 2014, N Engl J Med 371:1842-3) and are being widely implemented for the diagnosis of prion diseases in humans and animals. Notably, recent studies demonstrated 100% diagnostic sensitivity and specificity in diagnosing human sporadic Creutzfeldt-Jakob disease using CSF and/or nasal swabs (Bongianni et al., 2017, JAMA Neurology 74:1-8). A need remains for adapting these methods for other proteins, such as Syn.
[0193] An RT-QuIC approach for synucleinopathies was developed and applied to total of 137 PD and DLB cases and controls (Fairfoul et al., 2016, Ann Clin Transl Neurol 3:812-818). This Syn RT-QuIC gave 95% and 92% sensitivity for PD and DLB patients, respectively, with 100% specificity. Another assay, an Syn protein misfolding cyclic amplification (Syn PMCA), provided 89% sensitivity for PD and 97% specificity in analyses of 173 total cases and controls (Shahnawaz et al., 2017, JAMA Neurol 74:163-172). In both of these assays, small volumes of CSF are added to reactions containing excesses of recombinant wild-type Syn. Any Syn seeds in the sample initiates fibril formation by the recombinant Syn which, in turn, enhances the fluorescence of thioflavin T. However, these reactions are slow, and must be performed over 5 to 13 days.
[0194] It is disclosed herein that using a mutant rSyn substrate, a more rapid Syn RT-QuIC assay was developed, wherein misfolded Syn present in a sample was quickly detected. Thus, the assay can be completed within 2 days with excellent diagnostic sensitivity and specificity.
Example 1
Materials and Methods
[0195] Alpha-synuclein osmotic shock protein purification protocol: Five ml of media were inoculated from a glycerol stock of E. coli bacteria containing the vector for K23Q Syn protein expression. Following a 4-5-hour incubation with continuous 225 rpm agitation at 3TC, 1L of the auto-induction media was prepared and the 5 mL starter culture was added. The cells were grown in a shaking incubator at 37 C., 225 rpm, overnight. The next day cells were harvested by splitting the 1 L culture into 4 250 ml conical tubes and centrifuging at 3273g, 4 C., 10 min.
[0196] Next, the cell pellets were resuspended in 10% volume of room temperature osmotic shock buffer, (25 mL per 250 mL of cell culture before centrifugation) and incubated at room temperature for 10 min. This was resuspended gently with a 25 mL serological pipette. Next the suspension was centrifuged at 9000g, 20 C., 20 min. The supernatant was discarded and the pellet was resuspended gently in ice-cold water, using 10 mL of water per pellet. This step was done very gently using a 25 mL serological pipette. The samples were pooled into two tubes of 20 ml and 20 L of saturated MgCl.sub.2 were added per 20 mL of cell suspension. The solution was then mixed and incubated on ice with mild rocking for 3 min. Next, the suspension was centrifuged at 9000g, 4 C., 30 min. The supernatant was collected in a 100 ml glass beaker that contained a stir bar for continuous mixing. The pH was changed using 800-900 uL of a 1 M HCl solution to pH 3.5. The HCl was added in boluses, while monitoring the pH carefully to adjust appropriately.
[0197] This generated a large amount of white precipitate. The suspension was then incubated with gentle stirring at room temperature for 10 min. The formation of air bubbles was avoided during this step. Next the samples were centrifuged at 9000g, 4 C., 30 min, and the supernatant was collected in a 100 ml beaker with a stir bar for continuous agitation. This step was followed by the addition of 800-900 uL of 1 M NaOH to change to pH to 7.5. As described previously, a bolus of NaOH was added with systematic monitoring of the pH to adjust appropriately.
[0198] The protein extract was then filtered through a pore size filter of 0.45 m, or lower. At this stage, the extract could be stored at 4 C. for an hour or so if needed. Next, the extract was loaded onto a 5 ml Ni-NTA column and washed with Buffer A (20 mM Tris, pH 7.5). The column was further washed with 10% buffer B1 (20 mM Tris, 500 mM imidazole, pH 7.5) which generated a peak that was not collected. Next, a peak was collected between 30 and 75% Buffer B1. This peak was then loaded onto a Q-HP column and washed with Buffer A. The column was further washed with 10% buffer B1 (20 mM Tris, 500 mM imidazole, pH 7.5). A peak was recovered between 30 and 45% Buffer B2 (20 mM Tris, 1000 mM NaCl, pH 7.5) and filtered through 0.22 m filter.
[0199] The protein was then dialyzed against water overnight at 4 C. using a 3 kDa MWCO dialysis membrane. The next day, the protein was moved into fresh water for another 4 h dialysis.
[0200] The protein concentration was determined with a UV-VIS spectrophotometer using a theoretical extinction coefficient at 280 nm of 0.36 (mg/mL).sup.1 cm.sup.1. The obtained protein was lyophilized in aliquots and stored it for a final concentration of 1.0 mg/ml once resuspended in 500 L of 40 mM phosphate buffer (pH 8.0). These aliquots were stored at 80 C. until further analysis.
[0201] Brain homogenate preparations: Brain homogenates (BH; 10% w/v) were prepared by homogenizing the tissue in PBS using a Bead beater (1 min at maximum speed). The homogenate was then spun at 2000g for 2 min at room temperature and the supernatant was transferred to a new tube and stored at 80 C. for Syn RT-QuIC analysis. For Syn RT-QuIC testing, BHs were serially diluted in PBS.
[0202] RT-QuIC protocol: RT-QuIC reactions were performed in a black 96-well plate with a clear bottom (Nunc) preloaded with 6 glass beads (1 mm in diameter; BioSpec Products) per well. For brain homogenate seeded reactions, the reaction mix was composed of 40 mM phosphate buffer (pH 8.0), 170 mM NaCl, 0.1 mg/ml rSyn, 10 M thioflavin T (ThT). Aliquots of the reaction mix (98 L) were loaded into each well of the 96-well plate and seeded with 2 L of indicated BH dilutions. The plate was then sealed with a plate sealer film (Nalgene Nunc International) and incubated at 42 C. in a BMG FLUOstar Omega plate reader with cycles of 1 min shaking (400 rpm double orbital) and 1 min rest throughout the indicated incubation time. ThT fluorescence measurements (450+/10 nm excitation and 480+/10 nm emission; bottom read) were taken every 45 min.
[0203] In the case of CSF seeded reactions a plate pre-loaded with 6 glass beads per well was loaded with a reaction mix containing 40 mM phosphate buffer (pH 8.0), 170 mM NaCl, 0.1 mg/ml rSyn, 10 M thioflavin T (ThT) and 0.0015% sodium dodecyl sulfate (SDS) detergent (in a final 100 L reaction volume). In this case aliquots of the reaction mix (85 L) were loaded into each well of the 96-well plate and seeded with 15 L of CSF or CSF dilutions.
[0204] Reactions were classified as RT-QuIC positive based on criteria similar to those previously described for RT-QuIC analyses of brain specimens (Wilham 2010, PLoS Pathog; Orru 2014; NEJM).
Example 2
Sodium Dodecyl Sulfate (SDS) Titration in CSF Seeded Syn RT-QuIC
[0205] The results presented in
Example 3
Sodium Dodecyl Sulfate (SDS) and CSF Titration in Syn RT-QuIC
[0206] The results presented in
Example 4
Blinded Testing of CSF Samples by Syn RT-QuIC
[0207] These results shown in
Example 5
Comparison the Performance of Wild Type and K23Q Syn Recombinant Protein in the Syn RT-QuIC
[0208] A wild type Syn recombinant protein or a protein containing the K23Q amino acid substitution was used as the rSyn substrate for the reactions. As shown in
[0209] A similar phenomenon was observed with CSF-seeded reactions, with significantly faster amplification (20 hours) of Syn seeding activity observed when using the K23Q mutant substrate (
Example 6
Glass Beads
[0210] Each sample trace represents the average ThT signal of quadruplicate wells. The results show that increasing the number of beads in the reaction decreases the time of amplification, with reactions containing 10 beads being the fastest. However, these same reactions also show evidence of spontaneous conversion of the substrate in synucleinopathy-negative control reactions. Six beads per well was selected for use. Additional results are shown in
Example 7
Analysis of Blood Plasma Samples by Syn RT-QuIC
[0211] Blood plasma samples, or dilutions thereof, are used as test specimens in Syn RT-QuIC reactions using the present methods. In some cases, the plasma dilutions are added directly to the Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the plasma samples are first captured by binding to beads or other particles coated with antibodies or other ligands that bind to Syn seeds, and then rinsed prior to being added to the Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the plasma samples are first concentrated, for example by phosphotungstate anion (PTA) precipitation or exosome isolation, and then processed prior to being added to the Syn RT-QuIC reactions. Plasma samples from synucleinopathy patients, concentrates, or beads that are incubated with the synucleinopathy plasma samples, cause more rapid increase in ThT fluorescence in the reactions than analogous samples from non-synucleinopathy cases, allowing discrimination between synucleinopathy and non-synucleinopathy patients.
Example 8
Analysis of Blood Buffy Coat Samples by Syn RT-QuIC
[0212] Buffy coat cell fractions from blood samples, or dilutions thereof, are treated to disrupt cellular membranes, for example with freeze-thaw cycles, sonication, bead beaters, nuclease, protease and/or lipase treatments, and added to Syn RT-QuIC reactions. When protease treatments are used, protease inhibitors are added prior to performing the Syn RT-QuIC. In some cases, the disrupted buffy coat cell preparations are added directly to the Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the disrupted buffy coat preparations are first captured by binding to beads or other particles coated with antibodies or other ligands that bind to synucleinopathy-associated Syn seeds. The beads are then rinsed prior to being added to Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the buffy coat samples are first concentrated, for example by phosphotungstate anion (PTA) precipitation or exosome isolation, processed, then added to the Syn RT-QuIC reactions. Buffy coat, concentrates or buffy coat-treated bead samples from synucleinopathy patients cause more rapid increase in ThT fluorescence in the reactions than samples from non-synucleinopathy cases, allowing discrimination between synucleinopathy and non-synucleinopathy patients.
Example 9
Analysis of Whole Blood Samples by Syn RT-QuIC
[0213] Anti-coagulant-treated whole blood samples, or dilutions thereof, are treated to disrupt cellular membranes, for example with freeze-thaw cycles, sonication, bead beaters, nuclease, protease and/or lipase treatments, and added to Syn RT-QuIC reactions. When protease treatments are used, the protease inhibitors are added prior to performing the Syn RT-QuIC reaction. In some cases, the disrupted whole blood preparations are added directly to the Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the disrupted whole blood samples are first captured by binding to beads or other particles coated with antibodies or other reagents that bind to synucleinopathy-associated Syn seeds. The beads are then rinsed prior to being added to Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the whole blood samples are first concentrated, for example by phosphotungstate anion (PTA) precipitation or exosome isolation, and then processed prior to being added to the Syn RT-QuIC reactions. The blood, concentrates or blood-treated bead samples from synucleinopathy patients cause more rapid increase in ThT fluorescence in the reactions than samples from non-synucleinopathy cases, allowing discrimination between synucleinopathy and non-synucleinopathy patients.
Example 10
Detection of Syn Seeding Activity in Olfactory Mucosa Samples
[0214] In order to identify additional tissue specimens that can be collected from living patients and, therefore, brushings of the olfactory mucosal (OM) layer that lines the upper nasal vault were used. Spiking experiments were first performed to determine if the components, or matrix, of OM samples interfered with Syn RT-QuIC assays. Dilutions of brain tissue from synucleinopathy [diffuse Lewy body disease (DLBD)] or non-synucleinopathy [corticobasal degeneration (CBD)] were added to phosphate buffered saline (PBS) or to an OM sample from a non-synucleinopathy patient. Comparisons of these preparations in Syn RT-QuIC assays indicated that there was no major interference by OM components (
[0215] In some protocols, brushings or swabbings of the nasal mucosa or olfactory neuroepithelium, for example collected as described in Bongianni et al., JAMA Neurology 74: 155-162, are processed as described in Orr et al, New Engl J Med 371:519-529, and added to Syn RT-QuIC reactions. In some cases, the samples are treated to disrupt cellular membranes, for example with freeze-thaw cycles, sonication, bead beaters, nuclease, mucinase, protease and/or lipase treatments prior to addition to Syn RT-QuIC reactions. When protease treatments are used, the protease inhibitors are added prior to the next step in the protocol. In some cases, the resulting disrupted samples are added directly to the Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the nasal brushing samples are first captured by binding to beads or other particles coated with antibodies or other reagents that bind to synucleinopathy-associated Syn seeds. The beads are then rinsed prior to being added to Syn RT-QuIC reactions. In other cases, synucleinopathy-associated Syn seeds in the nasal brushing samples are first concentrated, for example by phosphotungstate anion (PTA) precipitation or exosome isolation, and then processed prior to being added to the Syn RT-QuIC reactions. The samples from synucleinopathy patients cause more rapid increase in ThT fluorescence in the reactions than samples from non-synucleinopathy cases, allowing discrimination between synucleinopathy and non-synucleinopathy patients.
Example 11
Relative Syn Seeding Activities in CSF and Brain Tissue from PD and DLB Cases
[0216] To quantify the Syn RT-QuIC seeding activities in samples from synucleinopathy cases, end-point dilution analyses were preformed of frontal cortex brain tissue from representative PD (n=1) and DLB (n=3) cases and CSF samples from 5 DLB cases. All 4 cases indicated that positive reactions were obtained out to 10-5-10-6 dilutions of either the PD and DLB brain tissues (
Example 12
Analytical Sensitivity Using Synthetic Syn Fibrils
[0217] To obtain an indication of the analytical sensitivity of Syn RT-QuIC, synthetic rSyn fibrils were prepared, spiked into non-synucleinopathy CSF and assayed using serial dilutions. As little as 100 ag of the synthetic fibril preparations gave at least 2/4 positive replicate reactions (
Example 13
Use of IO Particles to Capture Syn Seeds from Biological Specimens
[0218] To improve the sensitivity of Syn RT-QuIC assays of biological specimens and reduce the potential for assay interference by components of those specimens, IO particles were tested as a vehicle of binding and sequestering Syn seeds from human plasma and CSF samples. IO particles are useful for capturing transmissible spongiform encephalopathy prions that can then be detected by protein misfolding cyclic amplification (PMCA), RT-QuIC and other techniques (Miller M B et al. J Virol, 2011 March; 85(6):2813-7. doi: 10.1128/JVI.02451-10. Epub 2011 Jan. 12; Jacobson K H et al., Environmental Sci and Technol, 2013 Jul. 2; 47(13):6925-34. doi: 10.1021/es3045899. Epub 2013 May 30; Denkers N D et al., J Gen Virol, 2016 August; 97(8):2023-9. doi: 10.1099/jgv.0.000515. Epub 2016 May 27, incorporated herein by reference). Iron has a potential role in PD and is present in the Lewy bodies of PD. It was determined that IO was useful for capturing Syn aggregates from tissues or fluids, which can then be used in the methods disclosed herein.
[0219]
Example 14
Differential Effects of 0.05% SDS on Detection Syn Seeding Activity Captured with IO from Human CSF and Plasma
[0220] To try to further improve the sensitivity of Syn RT-QuIC when testing samples subjected to IO capture, the effect of resuspending the IO particles (after the capture step) in either 0.05% SDS in PBS was compared to PBS alone. It was determined that, with human CSF samples, resuspension in PBS alone was preferable for maximal sensitivity (
Example 15
Improved Fluorescence Detection in the Presence of IO by Increasing the Thioflavin T (ThT) Concentration
[0221] The Syn RT-QuIC assays containing IO particles tended to have lower maximal ThT fluorescence in synucleinopathy-seeded reactions. To increase sensitivity, the effects of increasing the ThT concentration 10-fold was determined. It was possible that the IO was impeding ThT fluorescence.
Example 16
Improved Syn RT-QuIC Detection of DLBD Seeding Activity in Human Plasma with PBS Washes and 0.05-0.1% SDS
[0222] It was possible that Syn seeds captured on IO beads could have inhibitory substances bound to them. Thus, the effects of post-capture PBS washes and resuspension in SDS solutions were tested.
Example 17
End-Point Dilution Analysis of Captured Syn Seeding Activity in Human Plasma
[0223] In order to determine the sensitivity of Syn RT-QuIC with IO capture for detecting Syn seeds spiked into normal human plasma, serial 10-fold dilutions of DLBD brain homogenate in plasma were assessed. The results shown in
Example 18
Efficiency of IO Capture from Human Plasma and CSF
[0224] To assess the proportion of DLBD seeding activity that is captured from plasma and CSF, serial IO capture steps (up to 3) were performed and the IO particles were assessed after each step. The results shown in
[0225] In view of the many possible embodiments to which the principles of our invention may be applied, it should be recognized that illustrated embodiments are only examples of the invention and should not be considered a limitation on the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.