Antigen detection of Trichinella
20200232976 ยท 2020-07-23
Assignee
Inventors
Cpc classification
G01N33/5308
PHYSICS
International classification
G01N33/53
PHYSICS
Abstract
Trichinella can be detected in a tissue extract sample. A suitable kit includes (a) a detection carrier containing a first antibody against one or more antigens of Trichinella, and (b) (i) a second antibody against one or more antigens of Trichinella, wherein the second antibody is bound to a signal molecule, or (b) (ii) contains one or more antigens of Trichinella bound to a signal molecule, wherein the antigens of (b) (ii) are configured so as to dissolve binding of the antigens of (a) to the first antibody by competitive displacement.
Claims
1. A method of detecting Trichinella in a tissue extract sample, said method comprising: comminuting the tissue extract sample from a human or animal to form particles, wherein at least 90% of the particles have a diameter of 6 m to 300 m; and detecting an antigen of Trichinella in said tissue extract sample by detecting the binding between an antibody to the antigen of Trichinella and the antigen, wherein the antigen is at least one of tyvelose, an excretory-secretor antigen, and a Trichinella spiralis lysate, wherein the detecting comprises: contacting the particles with a first antibody that is bound to one of beads, a membrane, a microtiter plate, a slide, a filter material, a thin layer chromatography material, and a test strip, wherein the first antibody recognizes the antigen of Trichinella; contacting the particles with a second antibody that recognizes the antigen of Trichinella, the second antibody being bound to a signal molecule; and detecting the antigen of Trichinella via the signal molecule.
2. The method according to claim 1, wherein the tissue extract sample is a mammalian sample.
3. The method according to claim 1, wherein 90% of the particles in the tissue extract sample have a diameter of 250 m or less.
4. The method according to claim 1, wherein the tissue extract sample is from musculature of said human or animal.
5. The method according to claim 1, wherein in the preparation of the tissue extract sample (a) a temperature of 45 C. is not exceeded; and/or (b) no enzymatic and/or chemical cleavage of the tissue takes place.
6. The method according to claim 1, wherein the method (a) does not comprise a microscopy step; (b) is used in meat inspection; and/or (c) has a detection limit of 7 ng antigen per ml of tissue extract.
7. The method according to claim 1, wherein the method is performed by an immunoassay.
8. The method according to claim 1, wherein Trichinella is Trichinella spiralis.
9-13. (canceled)
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION OF THE INVENTION
[0028] The inventors of the present invention have surprisingly found that Trichinella detection can be achieved by immunoassay by means of (mechanical) comminution of Trichinella-infected tissue.
[0029] Such an assay allows the detection of 7 ng Trichinella antigen per ml of tissue extract or less. In particular, it was possible to show that as soon as 90% of the particles contained in the tissue extract sample have a diameter of 300 m or less (D90300 m), efficient detection of Trichinella can take place.
[0030] In a first aspect, therefore, the present invention is directed at a method of detecting Trichinella in a tissue extract sample, wherein 90% of the particles in the tissue extract sample have a diameter of 300 m or less (D90300 m). Trichinella is preferably detected by immunoassay, by detecting an antigen of Trichinella, preferably an antigen specific for Trichinella in the tissue extract sample.
[0031] In preferred embodiments of the invention, the tissue extract sample is a mammalian sample, preferably a sample from a pig.
[0032] In preferred embodiments, in the tissue extract sample 90% of the particles have a diameter of 100 m or less (D90100 m), preferably 20 m or less (D9020 m).
[0033] In other preferred embodiments, the tissue extract sample is derived from musculature.
[0034] In preferred embodiments of the method according to the invention, (a) a temperature of 45 C., preferably 40 C., is not exceeded in the preparation of the tissue extract sample and/or (b) there is no enzymatic and/or chemical cleavage of the tissue.
[0035] Furthermore, in preferred embodiments (a), the method does not comprise a microscopy step; (b) use in the context of meat inspection and/or (c) has a detection limit of 7 ng antigen per ml of tissue extract.
[0036] In further preferred embodiments, the method of the invention is performed by means of an immunoassay, more preferably by means of an ELISA, line blot assay, Western blot assay, bead-based assay, lateral flow assay, vertical filtration assay, or 3D immunofiltration assay.
[0037] In preferred embodiments, Trichinella is Trichinella spiralis.
[0038] In a second aspect, the present invention is directed at use of a detection system for the detection of Trichinella, preferably in the context of meat inspection, wherein the detection system comprises (a) a detection carrier comprising a first antibody against one or more antigens of Trichinella, and (b) (i) a second antibody against one or more antigens of Trichinella, wherein the second antibody is bound to a signal molecule, or (b) (ii) comprises one or more antigens of Trichinella that are bound to a signal molecule, wherein the antigens of (b) (ii) are configured in such a manner that they dissolve binding of the antigens of (a) to the first antibody by competitive displacement.
[0039] In a third aspect, the present invention is directed at a kit comprising (a) a detection carrier comprising a first antibody against one or more antigens of Trichinella, and (b) (i) a second antibody against one or more antigens of Trichinella, wherein the second antibody is bound to a signal molecule, or (b) (ii) comprises one or more antigens of Trichinella bound to a signal molecule, wherein the antigens of (b) (ii) are configured so as to dissolve binding of the antigens from (a) to the first antibody by competitive displacement.
[0040] In a preferred embodiment, the kit further includes a description of a method according to the invention for detecting Trichinella.
[0041] As already described, the first aspect of the present invention is directed at a method of detecting Trichinella in a tissue extract sample, wherein 90% of the particles in the tissue extract sample have a diameter of 300 m or less (D90300 m).
[0042] The term detection or detecting as used equivalently herein describes the qualitative or quantitative determination of Trichinella. Qualitative determination means that only the presence or absence of Trichinella is determined. Quantitative determination refers to determination of the relative or absolute amount of Trichinella in a sample.
[0043] The term Trichinella or trichinae as used equivalently herein refers to a genus of nematode worms (strain Nematoda) with a parasitic lifestyle. Mammals, and therefore humans, and birds serve as intermediate and final hosts. The main carriers to humans are infected pigs or their raw meat, for example consumed as ground pork, or insufficiently cooked meat. Taxonomically, trichinae are classified as follows: Strain: nematodes (Nematoda); Class: Adenophorea (Adenophorea); Subclass: Enoplea (Enoplea); Order: Trichocephalida; Family: Trichinellidae; Genus: Trichinella. In preferred embodiments of the invention, Trichinella is selected from the group consisting of Trichinella spiralis, Trichinella nativa, Trichinella britovi, Trichinella murrelli, Trichinella T6, Trichinella T7, Trichinella nelsoni, Trichinella T8, Trichinella T9, Trichinella pseudospiralis, Trichinella papuae, and Trichinella zimbabwensis. In further preferred embodiments, the Trichinella species is an organism that forms a collagen capsule in a muscle cell of the host organism and is permanently encapsulated by it. In a still further preferred embodiment, Trichinella is Trichinella spiralis. Trichinella spiralis is a nematode and, in Central Europe, the most important representative of trichinae. It occurs worldwide, but it does not have much significance in tropical regions. T. spiralis causes the clinical picture of trichinellosis.
[0044] The term tissue extract sample as used herein refers to a mixture of various substances of biological origin. The material of biological origin may be epithelial tissue (cell layers covering all internal and external surfaces), connective and supporting tissue (tissue that provides structural cohesion and fills spaces), specialized tissue (such as blood, free cells, etc.), muscle tissue (cells that are specialized for active movement by contractile filaments), nerve tissue (cells that make up the brain, spinal cord, and peripheral nerves), and tissue fluid, such as the lymph system. More preferably, the tissue is muscle tissue. The muscle tissue may be smooth musculature, cardiac musculature and/or skeletal musculature. In further preferred embodiments, the sample is taken from the diaphragm, tongue or intercostal muscles of the subject to be examined. Preferably, the tissue is a solid tissue.
[0045] A tissue extract sample can be either heterogeneous or homogeneous. A heterogeneous tissue extract sample includes tissues of various tissue types. A homogeneous tissue extract sample comprises only a given tissue. A homogeneous tissue extract sample is preferred. In alternative embodiments, the sample is a pooled sample, i.e. the sample material comes from different individuals. Or the sample comes exclusively from a single individual.
[0046] The extract can be obtained from pieces of tissue or viable cells. These are comminuted and mixed with an aqueous solution, such as buffer solutions, H.sub.2O, cell media and mixtures thereof. Preferably, the manufacturing process does not involve cell cultivation.
[0047] In preferred embodiments of the invention, the tissue extract sample is a mammalian sample. In further preferred embodiments, the sample is from pigs, horses, bears, cats, dogs, rodents or humans. Even more preferably, the sample comes from a domestic pig (Sus scrofa domesticus), a wild boar (Sus scrofa), Pomeranian pig (Sus salvanius), bearded pig (Sus barbatus), Palawan bearded pig (Sus ahoenobarbus), Annamite pustule pig (Sus bucculentus), Visayas pustule pig (Sus cebifrons), Sulawesi pustule pig (Sus celebensis), Mindoro pustule pig (Sus oliveri), Philippine pustule pig (Sus philippensis), Javanese pustule pig (Sus verrucosus) or Bawean pustule pig (Sus blouchi).
[0048] The term particle diameter as used herein refers to a volumetric or length measurement of the particles being examined in the tissue extract. The particles studied may have a roughly roundish shape or an elongated fibrous structure. In preferred embodiments, 90% of the particles in the tissue extract sample have a diameter of 300 m or less (D90300 m), 290 m or less (D90290 m), 280 m or less (D90280 m), 270 m or less (D90270 m), 260 m or less (D90260 m), 250 m or less (D90250 m), 240 m or less (D90240 m), 230 m or less (D90230 m), 220 m or less (D90220 m), 210 m or less (D90210 m), 200 m or less (D90200 m), 190 m or less (D90190 m), 180 m or less (D90180 m), 170 m or less (D90170 m), 160 m or less (D90160 m), 150 m or less (D90150 m), 140 m or less (D90140 m), 130 m or less (D90130 m), 120 m or less (D90120 m), 110 m or less (D90110 m), 100 m or less (D90100 m), 95 m or less (D9095 m), 90 m or less (D9090 m), 85 m or less (D9085 m), 80 m or less (D9080 m), 75 m or less (D9075 m), 70 m or less (D9070 m), 65 m or less (D9065 m), 60 m or less (D9060 m), 55 m or less (D9055 m), 50 m or less (D9050 m), 45 m or less (D9045 m), 40 m or less (D9040 m), 35 m or less (D9035 m), 30 m or less (D9030 m), 25 m or less (D9025 m), 20 m or less (D9020 m), 17 m or less (D9017 m), 15 m or less (D9015 m), 13 m or less (D9013 m), 10 m or less (D9010 m), 8 m or less (D908 m) or 6 m or less (D906 m).
[0049] The particle diameter measurement may take place by devices using dynamic image analysis (e.g., Camsizer XT from Retsch) or devices based on the principle of static laser scattering (e.g., LA-960 from HORIBA). The particle size can be measured in x.sub.c min and is defined in accordance with DIN 66141 as follows: Shortest particle diameter of the measurements of the maximum diameters within a particle projection (English: particle diameter which is the shortest chord of the measured set of maximum chords of a particle projection) [10]. Alternatively, the particle size can be measured using the Feret diameter (x.sub.Fe). The Feret diameter is a measure of the object size along a particular direction. In general, it can be defined as the distance between the two parallel planes that constrain the object perpendicular to that direction. It is therefore also called the caliber diameter, based on the measurement of the object size with a caliper. When analyzing particle sizes, for example in microscopy, where the Feret diameter is applied to projections of a three-dimensional (3D) object on a 2D plane, this is defined as the distance between two parallel tangential lines instead of two planes. For a convex particle, the mean Feret diameter (mean of all directions) is equal to the diameter of a circle of equal circumference. The maximum Feret diameter is the longest Feret diameter within the measured set of Feret diameters. The minimum Feret diameter is the shortest Feret diameter within the measured set of Feret diameters.
[0050] Alternatively, the diameter refers to an average diameter, wherein the sum of the diameter measurements of all measured measurable particles is divided by the total number of particles measured. In another alternative embodiment, the diameter, when used in relation to the size of the particles, may refer to D50 such that about 50% of all particles measured have a particle diameter smaller than the defined mean particle diameter value, and that about 50% of all measurable particles measured have a particle diameter larger than the defined mean particle diameter value.
[0051] In preferred embodiments of the method according to the invention, in the preparation of the tissue extract sample (a) a temperature of 100 C., 90 C., 80 C., 70 C., 60 C., 55 C., 50 C., 45 C., 44 C., 43 C., 42 C., 41 C., 40 C., 39 C. or 38 C. and/or (b) there is no enzymatic and/or chemical cleavage of the tissue.
[0052] The term preparation of the tissue extract sample as used herein refers to a multi-step process wherein a tissue sample is taken from an organism to be examined, this tissue sample (mechanically) minced, and the minced tissue sample treated by filtration and/or centrifugation. Subsequently, the antigen detection can be carried out in the process according to the invention.
[0053] The comminution of the tissue sample is preferably carried out purely mechanically, i.e., for example, no enzymatic and/or chemical cleavage of the tissue. Mechanical comminution can take place by cutting, ripping or crushing, but is preferably achieved by cutting (for example via a knife mill). By comminution of the tissue sample, Trichinella larvae also located in the tissue sample are comminuted. The comminuted Trichinella larvae have a size corresponding to the comminuted tissue after comminution.
[0054] In a preferred embodiment, the term no enzymatic cleavage as used herein refers to the fact that no enzymes are used to comminute the tissue sample. In particular, no proteases (e.g., pepsin), lipases, amylases, cutinases, cellulases, or hemicellulases are used to comminute the tissue sample.
[0055] In a preferred embodiment, the term no chemical cleavage as used herein refers to the fact that no chemical substances such as acids, bases, oxidants, etc. are used to comminute the tissue sample.
[0056] Furthermore, in preferred embodiments (a), the method does not comprise a microscopy step; (b) use in meat inspection and/or (c) has a detection limit of <20 ng, <15 ng, <10 ng, <9 ng, <8 ng, <7 ng, <6 ng, <5 ng, <4 ng, <3 ng, <2 ng, <1 ng, <0.5 ng, <0.25 ng, <0.1 ng, <0.05 ng, <0.01 ng, <0.005 ng or <0.001 ng of antigen per ml of tissue extract.
[0057] The term no microscopy step as used herein refers to the evaluation of a method for Trichinella detection, wherein no microscope or microscopic evaluation, in particular a manual microscopic evaluation, is necessary for the evaluation of the method according to the invention.
[0058] The term meat inspection or inspection before slaughter and after slaughter, as used herein, refers to a process intended to ensure that the meat of certain species of animals is put into commerce as food only if it is considered fit for consumption by humans. This investigation is an integral part of measures to ensure meat hygiene. The examination is usually carried out by official veterinarians or meat inspectors in two stages, namely the examination of the animal and the examination of the meat.
[0059] In a preferred embodiment, the term detection limit as used herein indicates the least amount of a substance (antigen) that can be distinguished from the absence of that substance with a specific probability. Alternatively, the term detection limit may refer to the concentration of an antigen in a solution, where the measured value is greater than the associated uncertainty. The detection limit can be arbitrarily defined as 3 standard deviations (SD) away from the zero concentration.
[0060] In further preferred embodiments, the method of the invention is performed by means of an immunoassay, more preferably by an ELISA, line blot assay, Western blot assay, bead-based assay, lateral flow assay, vertical filtration assay, or 3D immunofiltration assay.
[0061] In a preferred embodiment, the term immunoassay as used herein refers to the detection or quantification of an analytesuch as a given antigen of Trichinellacomprising an immune reaction between an antibody and the antigen. In the context of the invention, the analyte to be detected or quantified may comprise a peptide, a post-translationally modified peptide, preferably a glycoprotein, a sugar, a lipid, a nucleic acid and/or another molecule of Trichinella.
[0062] In a preferred embodiment, the term ELISA as used herein stands for Enzyme-linked Immunosorbent Assay and refers to an antibody-based detection method (assay). The ELISA belongs to the group of immunoassay methods based on an enzymatic color reaction and thus belongs to the enzymatic immunoadsorption methods (EIA). Preferred embodiments include direct ELISA, indirect ELISA, direct sandwich ELISA, bridging ELISA, indirect sandwich ELISA, and competitive ELISA. A person skilled in the art is familiar with the stated form and other forms and derivatives of ELISA.
[0063] In a preferred embodiment, the term lateral flow assay as used herein (English for lateral flow test) is a biochemical method for the qualitative detection of materials/substances/antigens with antibodies. The lateral flow assay is a combination of thin layer chromatography and immunostaining. The lateral flow assay can be used in the form of a test strip.
[0064] In a preferred embodiment, the term vertical filtration assay as used herein is based on contacting ligands/antigens to be tested with a membrane on which captor antibodies are immobilized. This is followed by a washing process to remove weakly bound molecules and detection of bound ligands. The difference between lateral flow assay and vertical filtration assay is the lateral and vertical flow of the test fluid. Vertical flow technology has several advantages over the lateral flow assay, for example shorter assay times may occur.
[0065] In a preferred embodiment, the term 3D immunofiltration assay as used herein refers to an immunological rapid assay in flow-through assay format based on the same biochemical principle of analyte recognition by receptor structures as the lateral flow assay. The difference is that the addition of the sample/antigen, conjugate and additional wash solutions occurs sequentially on a three-dimensional porous shaped body on which captor antibodies are immobilized. All solutions and their constituents, such as analytes/antigens and detection reagents, flow into the depth of the shaped body by means of through-flow. By utilizing enrichment effects, it is possible to increase detection limits.
[0066] In a preferred embodiment, the term line blot refers to a test strip to which at least one purified antigen is applied by printing on a precisely predetermined position on the strip. The preparation of such test strips is described in the prior art. If antibodies are present in the sample, its complex can be detected colorimetrically with the antigen. The reading is done visually or by intensity measurement of resulting bands. The test strip may contain a positive control in the form of a band that appears when the strip has been incubated with serum, irrespective of whether or not it contains the analyte to be detected.
[0067] In a preferred embodiment, the term bead-based assay refers to a test in which the carrier used is a bead, preferably a magnetic bead, on which a reagent for the detection, preferably an antibody against an antigen of Trichinella, is immobilized. Detection of the antibody-antigen complex can be carried out by chemiluminescence, preferably by means of a second antibody which carries a signal molecule detectable by chemiluminescence. The bead is preferably chemically inert and comprises slow-reacting carbohydrates.
[0068] In preferred embodiments of the method according to the invention, this method comprises the following steps:
(a) providing a detection carrier comprising a first antibody against one or more antigens of Trichinella;
(b) contacting the detection carrier with the sample;
(c) (i) contacting the detection carrier and any sample material bound thereto with a second antibody against one or more antigens of Trichinella, wherein the second antibody is bound to a signal molecule and wherein the presence of a signal of the signal molecule indicates the presence of Trichinella in the sample; or
(c) (ii) contacting the detection carrier and, if applicable, any sample material bound thereto with one or more antigens of Trichinella, wherein the antigens of (c) (ii) are bound to a signal molecule and configured so as to dissolve binding of the antigens from (a) to the first antibody by competitive displacement, wherein the presence of a signal of the signal molecule indicates the presence of Trichinella in the sample.
[0069] In further preferred embodiments, in each case a washing step takes place after the contacting steps (b), (c) (i) and (c) (ii).
[0070] Furthermore, in preferred embodiments of the method, of use and of the kit, the signal molecule can be observed using analytical techniques such as fluorescence measurement, chemiluminescence measurement, radioactivity measurement, electron spin resonance measurement, ultraviolet/visible absorption spectroscopy, mass spectrometry, nuclear magnetic resonance, magnetic resonance and electrochemical measurement methods.
[0071] Suitable antigens of Trichinella are known from the state of the art. Preferably, the antigen is tyvelose.
[0072] In preferred embodiments, the first and second antibodies are directed against different epitopes of the same antigen.
[0073] In further preferred embodiments, the first and/or second antibody is selected from the group consisting of an antibody which is directed against a post-translational modification (possibly bound to a substrate protein), preferably a molecule comprising tyvelose, an antibody which is directed against an excretory-secretory (E/S) antigen of Trichinella, and an antibody prepared using a lysate of Trichinella spiralis.
[0074] The term antibody as used herein refers to proteins from the class of globulins that are formed in vertebrates in response to certain substances called antigens. Antibodies are components of the immune system. Antibodies are produced by a class of white blood cells called B lymphocytes. They can be differentiated using different classes, namely immunoglobulin A, immunoglobulin D, immunoglobulin E, immunoglobulin G, immunoglobulin M, immunoglobulin W, and immunoglobulin Y. In preferred embodiments, the first and/or the second antibody is/are immunoglobulin G.
[0075] In preferred embodiments, the antibodies used are selected from the group consisting of an antibody comprising a VH sequence according to SEQ ID NO: 1 and a VL sequence according to SEQ ID NO: 2, an antibody comprising a VH sequence according to SEQ ID NO: 3 and a VL sequence according to SEQ ID NO: 4, antibody 18H1 (IgG2a), which binds tyvelose and is described in [11], and variants of these.
[0076] The term variant as used herein refers to antibodies and VH and VL sequences that possess at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% homology with the reference antibody or with the reference sequence. Preferably, only those variants are used which have biological activity. Biological activity as used in this context means, in particular, that the corresponding peptides have at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the specific binding activity of their reference antibody or of the reference sequence. Functional fragments or derivatives of antibodies or variants thereof, for example Fab, F (ab), Fr, ScTv and dAb or aptamers with corresponding binding activity, can be used.
[0077] In a preferred embodiment of the method according to the invention, comminution of the tissue extract sample is carried out exclusively mechanically. In other words, in this embodiment there is no comminution step that is carried out chemically and/or enzymatically by molecules or compounds externally added to the process. In other preferred embodiments, no additional external chemical and/or enzymatic molecules are added to the method in an amount such that the proteolytic activity achieves more than four times, more than three times or more than twice the background proteolytic activity.
[0078] In a further preferred embodiment of the process according to the invention, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% of all protease cleavage sites are not cleaved in the tissue extract sample. These proteases possess a hydrolytic activity with regard to peptide bonds and belong to EC class 3.4.
[0079] In other preferred embodiments of the process according to the invention, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% cleavage sites of pepsin, chymosin, cathepsin E, papain, cathepsin K, caspase, calpain, scytalidoglutamic peptidase, thermolysin, collagenases, carboxypeptidase A and B, chymotrypsin, plasmin, thrombin, trypsin, granzymes and/or kallikrein are not cleaved in the tissue extract sample.
[0080] In a further preferred embodiment of the process according to the invention, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% cleavage sites of pepsin, chymosin, chymotrypsin and/or trypsin are not cleaved in the tissue extract sample. In particular, in the tissue extract sample, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% cleavage sites of pepsin are not cleaved.
[0081] The cleavage sites of the above peptidases are sufficiently known from the state of the art, for example https://web.expasy.org/peptide_cutter/peptidecutter_enzymes.html#Peps, and are hereby incorporated in the description by reference.
[0082] The identity/homology of nucleic acid or amino acid sequences is determined by sequence comparison. This sequence comparison is based on the BLAST algorithm established in the prior art and commonly used (compare [12] and [13]) and is principally achieved by assigning similar sequences of nucleotides or amino acids in the nucleic acid or amino acid sequences to one another. A tabular assignment of the relevant positions is referred to as alignment. Another algorithm available in the prior art is the FASTA algorithm. Sequence comparisons (alignments), in particular multiple sequence comparisons, are created with computer programs. Frequently used, for example, are the Clustal series (see, for example, [14]), T-Coffee (see, for example, [15]) or programs based on these programs or algorithms. Furthermore, sequence comparisons (alignments) are possible using the computer program Vector NTI Suite 10.3 (Invitrogen Corporation, 1600 Faraday Avenue, Carlsbad, Calif., USA) with the predetermined default parameters; the AlignX module of this program for sequence comparisons is based on ClustalW.
[0083] Such a comparison also allows a statement about the similarity of the compared sequences to each other. It is usually given in percent identity, that is, the proportion of identical nucleotides or amino acid radicals at the same position or in positions corresponding to one another in an alignment. The broader term of homology takes preserved amino acid substitutions in amino acid sequences into consideration, in other words amino acids with similar chemical activity, since these usually perform similar chemical activities within the protein. Therefore, the similarity of the sequences compared may also be stated as percent homology or percent similarity. Identity and/or homology information can be made about whole polypeptides or genes or only about individual regions. Homologous or identical regions of different nucleic acid or amino acid sequences are therefore defined by matches in the sequences. Such areas often have identical functions. They can be small and comprise only a few nucleotides or amino acids. Often, such small regions perform essential functions for the overall activity of the protein. It may therefore be useful to relate sequence matches only to individual, possibly small areas. Unless otherwise indicated, however, identity or homology information in the present application refers to the total length of the nucleic acid or amino acid sequence indicated.
[0084] The phrase configured so as to dissolve binding of the antigens to the antibody by competitive displacement, as used herein, refers to antigens that compete with already bound antigens for binding to a given antibody. The competitive antigens are structurally similar to each other and therefore the antigens can be referred to as structural analogs. The displacing antigen may have a higher affinity for the antibody than the displaced antigen and/or the displacing antigen is present in higher concentration than the displaced antigen.
[0085] The term antigen as used herein preferably refers to substances to which antibodies and certain lymphocyte receptors can specifically bind. Antigens can be proteins, but also glycoproteins, carbohydrates, lipids or other substances. In the present case, the antigens are preferably proteins or post-translationally modified proteins.
[0086] In a second aspect, the present invention is directed at use of a detection system for the detection of Trichinella, preferably for meat inspection, wherein the detection system comprises (a) a detection carrier comprising a first antibody against one or more antigens of Trichinella, and (b) (i) a second antibody against one or more antigens of Trichinella, wherein the second antibody is bound to a signal molecule, or (b) (ii) comprises one or more antigens of Trichinella bound to a signal molecule, wherein the antigens from (b) (ii) are configured so as to dissolve binding of the antigens of (a) to the first antibody by competitive displacement.
[0087] The term detection system as used herein preferably comprises (a) a detection carrier as defined herein and (b) an antigen or antibody bound to a signal molecule. The components of (a) and (b) act synergistically in such a way that addition of an antigen to be examined results in a binding complex of all the molecules involved, which allows detection of the antigen to be investigated in a sample by way of the presence of a signal.
[0088] The term detection carrier as used herein preferably refers to a substance to which an antibody against one or more antigens of Trichinella is bound. The carrier can be a solid article such as a slide, a 6-well, 12-well, 96-well or 384-well plate, a membrane, preferably a nitrocellulose membrane, a filter material, a bead, preferably a magnetic bead, or a thin-layer chromatography material. Alternatively, the detection carrier may also be a bead, the diameter of such a bead preferably being smaller than 1000 m, 800 m, 600 m, 400 m, 200 m, 100 m, 90 m, 80 m, 70 m, 60 m, 50 m, 40 m, 30 m, 20 m, 10 m or 5 m. The detection carrier can preferably comprise plastic, glass, metal or a combination thereof.
[0089] In a third aspect, the present invention is directed at a kit comprising (a) a detection carrier comprising a first antibody against one or more antigens of Trichinella, and (b) (i) a second antibody against one or more antigens of Trichinella, wherein the second antibody is bound to a signal molecule, or (b) (ii) comprises one or more antigens of Trichinella bound to a signal molecule, wherein the antigens of (b) (ii) are configured so as to dissolve binding of the antigens from (a) to the first antibody by competitive displacement.
[0090] The term kit as used herein preferably refers to a package provided with containers (e.g. bottles, plates, tubes, cups, etc.), each containing a specific material, in the present case especially a detection carrier as defined herein, and an antigen or antibody bound to a signal molecule. Preferably, the kit is accompanied by instructions for use of the aforementioned material. The instruction manual may be written or printed on paper or another medium, or may be provided in the form of electronic media such as magnetic tape, a computer-readable disk or tape, or CD-ROM. The kit preferably contains a positive control, preferably with an antigen to be detected and/or samples for calibration or creation of a calibration curve.
[0091] In a preferred embodiment, the kit furthermore comprises a description of a method according to the invention for detecting Trichinella.
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
Sequences:
[0103] In the present invention, various peptide sequences are disclosed, in particular
TABLE-US-00001 (Anti-[TRISP][B7] VH): SEQIDNO:1 AVTLDESGGGLQTPRGGLSLVCKASGYTFSSHNMAWVRQAPGKGLEFVAG ISNTGSFTLYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKHA GVGLYSIDAWGHGTEVIVSS (Anti-[TRISP][B7] VL): SEQIDNO:2 ALTQPSSVSANLGGTVKITCSGGTSDYGWYQQKAPGSAPVTLIYDNTNRP SDIPSRFSGSLSGSTNTLTITGVQAEDEAVYFCGSADRTYAGVFGAGTTL TVL (ANTI-[TRISP][C9] VH): SEQIDNO:3 AVTLDESGGGLQTPGGALSLVCKASGFSISSYSMQWVRQAPGKGLEWVAG IYYDGNTWYAPAVKGRATISRDNGQSTVRLRLNNLRAEDTATYFCAKYAG GYSIDAWGHGTEVIVSS (ANTI-[TRISP][C9] VL): SEQIDNO:4 ALTQPSSVSANPGETVKITCSGSSGSYGWYQQKSPGSGPVTVIYYNDKRP SDIPSRFSGSASGSTATLTITGVQAEDEAVYFCGGYDSSTYVGIFGAGTT LTVL (ANTI-[TRISP][18H1] VH): SEQIDNO:5 QVQLKESGPGLVQPSQTLSLTCTVSGLSLTSNSVGWIRQPPGKGLEWMGI IWSNGGIDYNSAIKSRLSISRDTSKSQVFLKMHSLQTEDTAMYFCARGPY YGSYRLGYFDYWGQGVMVTVSS (ANTI-[TRISP][18H1] VL): SEQIDNO:6 DVVMTQSPSSLAVSAGETVTLNCQSSQSLLYSGTQNNYLAWYQQKPGQSP KLLISWASTRQSGVPLRFIGSGSGTDFTLTITSVQAEDLAIYYCQQFYDT PLTFGSGTKLEIK
[0104] The present invention is further illustrated by the non-limiting examples, from which further features, embodiments, aspects, and advantages of the present invention can be derived.
EXAMPLES
Example 1: Material and Methods
Material
[0105]
TABLE-US-00002 Product Material Name number Manufacturer Equipment Automated PerkinElmer Chemiluminescent Analyzer SuperFlex Biometra WT 15 042-400 Biometra shaker Centro XS.sup.3 LB 960 Berthold Technologies Microplate Luminometer GM 200 Accessories: 03 045 0050 Retsch Grinding container, stainless steel GM 200 Accessories: Knife, 02 446 0057 Retsch serrated HydroFlex Microplate Tecan Washer, Magnetic Beads Incubator WTB BINDER Knife mill GRINDOMIX GM 20 253 0001 Retsch 200 MTS 2/4 digital microtiter 3208001 IKA shaker Novex Mini Cell Invitrogen Photometer: Sunrise Tecan Power Pac HV Bio-Rad Table centrifuge: Biofuge Heraeus Fresco Washer Columbus Tecan XCell SureLock Mini-Cell ThermoFisher Scientific Electrophoresis System Zentrifuge Avanti J-E Beckman Coulter (Rotor: JA-10) Tilt/roll mixer IKA Consumables iD PAGE Gel, 4-20% ID-PA4201-015 Eurogentec Dynabeads M-280 Tosyl- 14203 ThermoFisher Scientific activated Microtiter plate LockWell 446475-EUR ThermoFisher Scientific Maxisorb Nitrocellulose membrane 11306 Sartorius Nunc F96 MicroWell 136101 ThermoFisher Scientific Polystyrene Plate, white Reagent Cartridges PerkinElmer (SuperFlex) Protective caps for magnetic PerkinElmer rod (SuperFlex) Media, Ammonium sulphate Sigma-Aldrich Solutions, solution and Buffers (3M) Antibody dilution buffer EUROIMMUN Blocking buffer ELISA EUROIMMUN Chromogen/substrate ZE 1200-0112 T EUROIMMUN solution ELISA TMB/H2O2 Enzyme Conjugate Alkaline AE 142 1030 EUROIMMUN Phosphatase-labeled Anti- Human-IgG (Goat) Extravidin/acridinium EUROIMMUN reagent Beads coating buffer EUROIMMUN PBS ZF 1100-1000 T EUROIMMUN PBS + 0.05% Tween-20 ZF 1110-0102 T EUROIMMUN (PBST) StabilCoat Plus SC01 Surmodics Stop solution ELISA (0.5M ZE 1210-0112 T EUROIMMUN sulfuric acid) Substrate Solution Blot Nitro ZW 1020-0130 T EUROIMMUN Blue Tetrazolium Chloride/5- Bromo-4-chloro-3-indolyl Phosphate (NBT/BCIP) Trigger A for CLIA EUROIMMUN Trigger B for CLIA EUROIMMUN Tris buffer (1M) #1218 Gerbu Biotechnik Wash Buffer Blot ZW 1100-1005 T EUROIMMUN Wash Buffer ELISA ZE 1120-1000 T EUROIMMUN Wash Buffer Plus Blot ZW 1110-1005 EUROIMMUN Ready-to-use Color Prestained Protein P7712S New England BioLabs Solutions and Standard, Broad Range (11- Kits 245 kDa) NuPAGE LDS Sample Buffer ThermoFisher Scientific (4) NuPAGE MOPS SDS NP0001 ThermoFisher Scientific Running Buffer (20) Antigens Ascaris suum Prof. Dr. Christina Strube, University of Veterinary Medicine Hanover, DE Salmonella typhimurium Prof. Dr. Michael Salmonella cholerasuis strain Hensel A microbiology Salmonella cholerasuis strain University of Osnabrck B Salmonella typhisuis Strongyloides ratti EUROIMMUN Toxocara cati EUROIMMUN Toxoplasma gondii BA110VS Virion/Serion Trichinella spiralis E/S EUROIMMUN antigen Trichinella spiralis lysate EUROIMMUN Trichuris suis Prof. Dr. Eva Liebau Molecular Physiology University of Mnster Trypanosoma cruzi Virion/Serion Antibodies Anti-[TRISP][B7] EUROIMMUN Anti-[TRISP][C9] EUROIMMUN Anti-[TRISP][18H1] EUROIMMUN/Prof. Dr. Judith Appleton, Cornell University, Ithaca, USA Other EZ-Link NHS-PEG12 biotin 21312 ThermoFisher Scientific Materials IIFT Trichinella spiralis EUROIMMUN Encapsulated Larva IIFT Trichinella spiralis EUROIMMUN Muscle larva Pork samples mixed with a [German] Federal defined number of Institute for Risk Trichinella muscle larvae Assessment (BfR) Pork diaphragm muscles Butcher Prsch, Krummesse Spectra Multicolor Broad ThermoFisher Scientific Range Protein Ladder Streptavidin-PolyHRP80, #SP80C SDT (Stereospecific stock 1 mg/ml solution Detection Technologies) Trichinous pork infected [German] Federal with 20 to 50 larvae per Institute for Risk gram Assessment (BfR) Zeba Spin Desalting 87772 ThermoFisher Scientific Columns, 40K MWCO, 10 mL
Methods
Method for Obtaining Tissue Extract Samples
[0106] In the present detection method, the meat is not supposed to be enzymatically digested, but rather mechanically comminuted. In this regard, a particle size of the meat of <200 m is to be achieved. The larvae, together with the collagen capsule, are approx. 200-600 m long and 200-300 m wide, so that with a desired particle size of <200 m, it can be assumed that the encapsulated Trichinella larvae would have to be caught at least once by the cutting knife of the comminution device. The capsule contains numerous E/S proteins, which are released during comminution and then freely present in the sample material (
[0107] Following comminution, antigen detection is performed in the form of an antigen capture ELISA or a manually incubated or automated chemiluminescence immunoassay.
[0108] Sample Preparation
[0109] At the slaughterhouse, removal of about 5 g of meat per animal is usual. As a standard procedure, the sample is taken from the muscular part of the diaphragm of an animal that has already been killed. For the Trichina inspection, 1 g of sample material is used per pig. For other parts of the body, such as the tongue or intercostal muscles, the amount of the sample may vary. As a rule, 100 pig samples are pooled, resulting in a sample volume of 1001 g. The sample is cooled down to 4 C.
[0110] Comminution of the Meat Samples
[0111] The sample material (1001 g meat) was added to the grinding bowl of a crusher, which was pre-chilled to 4 C. The knife mill Grindomix GM 200 from Retsch was used for this purpose. The comminution principle is based on cutting of the sample. The knife mill can be equipped with a serrated knife, so that even fibrous materials such as muscle tissue can be finely comminuted. 200 ml of PBS at a temperature of 4 C. were added to the sample. At 10,000 rpm and thus maximum power, the sample material was comminuted as indicated, e.g. for 9 min.
[0112] In order to check whether comminution of the meat was successful, a particle size measurement was carried out using the CamsizerXT from Retsch and the LA-960 from HORIBA. The LA-960 is based on the functional principle of static laser scattering, whereas the CamsizerXT is based on dynamic image analysis. In each case, three meat samples were taken after 6 minutes or 9 minutes, and measured directly afterwards. An average of 60 million particles were measured. The particle size was measured in x.sub.c min and defined according to DIN 66141 as follows: Shortest particle diameter of the measurements of the maximum diameter within a particle projection (English: particle diameter which is the shortest chord of the measured set of maximum chords of a particle projection) [8].
Centrifugation
[0113] After comminution, 1 ml to 15 ml of sample were taken from the grinding bowl using a pipette. This was followed by sedimentation of the coarse particles in the sample by centrifugation at 5,000g and 4 C. for 10 minutes. The supernatant after sedimentation is the sample material for subsequent antigen detection and is referred to as a tissue extract.
Method of Detecting Trichinella spiralis from Tissue Extract Samples
Production of the Sample Material
[0114] T. spiralis Lysate
[0115] T. spiralis muscle larvae (ML) were provided by Justyna Bie from the Witold Stefaski Institute PAS in Warsaw. 120,000 ml were centrifuged for 10 min at 16,000g and room temperature (RT), so that all larvae were pelleted. The supernatant was discarded and 1 ml of PBS was added. The larvae were exposed to five cycles of freezing and thawing, and then comminuted using a hand-held homogenizer. Finally, the samples were treated with ultrasound: 20 cycles of 5 sec each at medium strength and 5 sec rest periods between treatments, on ice. This was followed by 20 minute centrifugation at 16,000g and 4 C. The supernatant represents the antigen T. spiralis lysate.
E/S Antigen
[0116] The T. spiralis ML E/S antigen was provided by Justyna Bie from the Witold Stefaski Institute PAS in Warsaw.
Production of Antibodies
[0117] The antibodies used for the antigen-capture ELISA were prepared using a phage display method [9]. The sequences of the heavy and light chain variable regions (VH and VL) of the two antibodies anti-[TRISP][B7] and anti-[TRISP][C9] (abbreviated as Ab B7 and Ab C9) are as follows:
TABLE-US-00003 Anti-[TRISP][B7] VH(SEQIDNO:1): AVTLDESGGGLQTPRGGLSLVCKASGYTFSSHNMAWVRQAPGKGLEFVAG ISNTGSFTLYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKHA GVGLYSIDAWGHGTEVIVSS Anti-[TRISP][B7] VL(SEQIDNO:2): ALTQPSSVSANLGGTVKITCSGGTSDYGWYQQKAPGSAPVTLIYDNTNRP SDIPSRFSGSLSGSTNTLTITGVQAEDEAVYFCGSADRTYAGVFGAGTTL TVL ANTI-[TRISP][C9] VH(SEQIDNO:3): AVTLDESGGGLQTPGGALSLVCKASGFSISSYSMQWVRQAPGKGLEWVAG IYYDGNTWYAPAVKGRATISRDNGQSTVRLRLNNLRAEDTATYFCAKYAG GYSIDAWGHGTEVIVSS ANTI-[TRISP][C9] VL(SEQIDNO:4): ALTQPSSVSANPGETVKITCSGSSGSYGWYQQKSPGSGPVTVIYYNDKRP SDIPSRFSGSASGSTATLTITGVQAEDEAVYFCGGYDSSTYVGIFGAGTT LTVL
Biotinylation of Antibody Anti-[TRISP][B7]
[0118] The Ab B7 was incubated, for antigen-capture ELISA, using EZ-Link NHS-PEG12-biotin in a 20-times molar excess, for one hour at room temperature, on the rotary shaker. To remove excess biotin, the antibody (Ab) was purified according to the manufacturer's instructions, by way of a size exclusion chromatography column (Zeba Spin Desalting Columns).
SDS PAGE and Western Blot Analysis
[0119] For SDS PAGE, in each case 5 g of T. spiralis lysate or lysate from Trypanosoma cruzi, Ascaris suum, Strongyloides ratti, Toxocara cati, Toxoplasma gondii, Salmonella typhimurium, Salmonella cholerasuis strain A, Salmonella cholerasuis strain B, Salmonella typhisuis, and Trichuris suis were loaded onto a polyacrylamide gel, and electrophoresis was performed at 175V in MOPS buffer for 50 min. Transfer to a nitrocellulose membrane took place for 60 min at 400 mA, in transfer buffer. The membrane was incubated for blocking on the rocker shaker, in Wash Buffer Plus, for 30 min. Subsequently, antibodies B7 and C9 in Wash Buffer Plus were applied at a concentration of 0.4 g/ml, and incubated overnight on the rocker shaker. After washing with washing buffer, the membrane was incubated with the enzyme conjugate Alkaline Phosphatase-labeled Anti-Human IgG from EUROIMMUN, diluted in Wash Buffer Plus. Finally, after another washing step, the substrate solution (NBT/BCIP) was applied and incubated until a clear color change was seen.
Indirect Immunofluorescence Test
[0120] In order to examine which structures bind the developed antibodies, an indirect immunofluorescence test for T. spiralis was developed. The BIOCHIPS were loaded with frozen sections of T. spiralis muscle larvae and encapsulated larvae. Incubation and microscopy were carried out following the instructions of the EUROIMMUN Anti-Schistosoma Mansoni IIFT (P/N FI 2300-1005 G). As a sample, the antibodies B7 and C9 were applied to the BIOCHIPS at a concentration of 2 g/ml.
Antigen Detection by Means of Antigen Capture ELISA
[0121] For antigen detection, an enzyme-linked immunosorbent assay (ELISA) was used as the detection method. A 96-well microtiter plate was coated with 0.25 g/ml antibody C9 in PBS overnight at 4 C. The next day, the microtiter plate was washed once with PBST (PBS+0.05% Tween-20), blocked with blocking buffer for 2 hours, and then dried for 2 hours.
[0122] For detection of the antigens bound to Ab C9, the Ab B7, at a concentration of 0.05 g/ml, and streptavidin-polyHRP80, at a concentration of 0.1 g/ml, were mixed together in antibody dilution buffer and incubated overnight.
Incubation of the Samples
[0123] The incubation was carried out as in the schematic shown in
[0124] After washing with washing buffer six times, the 100 l volume conjugate was also incubated for one hour at room temperature, on a rotary shaker. It was then washed again six times and the substrate was applied. After 15 min, the reaction was stopped with stop solution, and the optical density (O.D.) of the samples was determined using a photometer at a wavelength of 450 nm.
Example 2: Results
Comminution of the Meat Samples
[0125] Immediately following comminution of the pork using the GM200 knife mill, particle size determination was carried out using the CamsizerXT and the HORIBA LA-960. Sampling took place after 6 or 9 min, respectively. The results of the mass distribution can be seen in
[0126] The results of the measurement with the HORIBA LA-960 show that 95% of the particles are <26 m and all particles are <100 m. With the CamsizerXT measurement, 95% of the particles are <300 m. Only 70% of the meat particles are <100 m.
[0127] In any case, the collagen capsule of a Trichinella larva, if present, would be statistically cut at least once by the knife, so that E/S proteins can be released. These released proteins can be detected in the next step, using an antigen-capture ELISA.
Preparation of the Sample Material and the Antibodies
[0128] To check whether the antibodies anti-[TRISP][B7] and anti-[TRISP][C9] are suitable for T. spiralis antigen detection, an indirect immunofluorescence test (IIFT) and a Western blot were performed as functional tests. The results are shown in
[0129] When antibody B7 is used, the cut capsule fluoresces most strongly (
[0130] In the cross-section of the encapsulated larva, the entire larva fluoresces most strongly when incubated with the Ab C9 (
[0131] In the Western blot, clear reactions for the antibodies B7 and C9 can also be seen (
[0132] In order to check whether the antibodies bind exclusively to specific structures of T. spiralis and not to other antigen structures of other parasites and/or bacteria, a Western blot was performed. Lysates of pathogens found in pigs were applied. The result can be seen in
Antigen Capture ELISA
[0133] For the functional test of the developed T. spiralis ELISA, various concentrations of E/S antigen were used in the test (
[0134] In
[0135] The T. spiralis antigen concentration in the tissue extract sample corresponds to approximately 30 ng/ml E/S antigen. Consequently, 100 comminuted encapsulated larvae release approximately that amount of protein into the meat juice, and this can be detected by the antigen capture ELISA.
Antigen-Capture ELISA with Differently Comminuted Sample Material
[0136]
[0137] The reaction in the ELISA is lower in the case of the sample material which was comminuted for 3 minutes than after comminution for 9 minutes. Prolonged comminution of the sample material consequently results in a higher amount of released T. spiralis antigen. During prolonged comminution, it is likely that all encapsulated Trichinella larvae will be caught at least once and, in general, multiple times by the cutter blade, so that more detectable antigens are available for ELISA in the sample, as compared with shortened comminution.
Example 3: Antigen Detection by Means of a Manually Incubated and Automated Chemiluminescence Immunoassay
[0138] For the manually incubated and bead-based chemiluminescence immunoassay (CLIA), the capture antibodies were coupled to magnetic beads rather than to a microtiter plate. Tosyl-activated Dynabeads were used for this purpose. The hydrophobic polyurethane surface was activated with tosyl groups, which allowed the antibodies to be covalently bound to the beads. 4 mg of the beads were equilibrated with 1 ml of a 1 M Tris buffer. 30 mM Tris, 0.4 M ammonium sulfate, and 28 g anti-[TRISP][18H1] antibody (abbreviated as Ab 18H1) were added to the equilibrated beads. The incubation was carried out overnight at 37 C., on a roller mixer. The next day, the beads were washed three times with 1 ml each of StabilCoat Plus, and then incubated overnight at 37 C., on the roller mixer, to block any remaining reactive functional groups. After blocking, the beads were taken up in fresh StabilCoat Plus and stored at a concentration of 1 mg/ml at 4 C. until use.
[0139] The beads coated with 18H1 antibody were pipetted into a microtiter plate well (Nunc polystyrene plate) for the CLIA, at 10 g each. 100 l of the undiluted tissue extract sample were added, and incubated for 30 min on a rotary shaker. After automated washing three times using the HydroFlex Microplate Washer, 100 l of the biotinylated B7 antibody at a concentration of 0.1 g/ml were incubated for 30 minutes on a rotary shaker. This was followed by three times automated washing. For the chemiluminescence reaction, the extravidin/acridinium reagent, at a concentration of 80 ng/ml and a volume of 100 l, was added to the beads and incubated for 15 min. After washing three times, the measurement was carried out using the Centro XS.sup.3 microplate luminometer. The luminometer automatically added 100 l of each of the triggers A and B to every batch, to start the chemiluminescence reaction. The light emission was measured at 425 nm wavelength for 1 sec and reported in Relative Light Units (RLU). The incubation schematic of the manually incubated CLIA is shown in
[0140] The automated and bead-based chemiluminescence immunoassay is based on the structure of the manually incubated CLIA. The difference is that the test is performed using an Automated Chemiluminescence Analyzer (SuperFlex, PerkinElmer). The beads are successively immersed in the various reagents by a magnetic rod. The magnetic rod is able to generate an electric field and can thereby pick up the beads, drop them, and mix the reagents at a predefined interval.
[0141] For the automated CLIA, the tissue extract samples were loaded into the sample compartment of the analyzer. The reagent cartridges were filled as shown in
Results of the Manually Incubated Chemiluminescence Immunoassay (CLIA)
[0142] Different concentrations of T. spiralis lysate samples were incubated with the manually incubated CLIA. The detection limit was 1 ng/ml T. spiralis lysate.
Results of the Automated Chemiluminescence Immunoassay (CLIA)
[0143] Different concentrations of T. spiralis lysate samples were also incubated using the automated chemiluminescence immunoassay. The detection limit was 10 g/ml T. spiralis lysate. In addition to the meat samples infected with Trichinella, meat samples that were mixed with a defined amount of Trichinella muscle larvae were also comminuted. They contained 3 to 30 larvae. The detection limit of the automated CLIA was 3 larvae per 100 grams of meat for the defined amount of muscle larvae.
[0144]
[0145] The invention is described generically and generally herein. Each of the narrower types and subgroups covered by the generic disclosure also forms part of the invention. This includes the general description of the invention with a reservation or negative restriction that removes every object from a (sub)group, whether or not the cut-out object is specifically cited here. Other embodiments are contained in the following claims.
[0146] A person skilled in the art will readily appreciate that the present invention is well suited for accomplishing the tasks and achieving the stated advantages and goals connected with them. Furthermore, it will be readily apparent to a person skilled in the art that various substitutions and modifications can be made to the invention disclosed herein, without departing from the scope and spirit of the invention. The methods, uses, treatments, molecules, and kits described herein are representative of preferred embodiments, which are exemplary and are not intended to restrict the scope of the invention. Changes therein and other uses will occur to persons skilled in the art, and these are included within the scope of the invention and defined by the scope of the claims. Listing or discussion of a previously published document in this description should not necessarily be understood as proof that the document belongs to the prior art or is generally known.
[0147] The invention illustratively described herein can be suitably carried out in the absence of any element or restrictions not specifically disclosed herein. For example, the terms comprising, including, containing, etc., are read comprehensively and without restriction. Accordingly, the word comprise or variations such as comprises or comprising are to be understood as being implicit; i.e., for example, numbers that are given are included, but not excluded. In addition, the terms and expressions used herein have been used as expressions of description and not of restriction, and there are no intentions to restrict such terms and expressions, so as to restrict any equivalents of the features shown or described, or parts thereof. In other words, various modifications are possible within the scope of protection of the claimed invention. This should be understood to mean that while the present invention has been specifically disclosed by means of exemplary embodiments and optional features, which are disclosed herein, modifications and variations of the inventions disclosed herein can be used by persons skilled in the art, and that such modifications and variations should be viewed as being within the scope of protection of this invention.
[0148] The contents of all documents and patent documents cited herein are incorporated by reference, in their entirety.
TABLE-US-00004 Abbreviations Abbreviation English German g microgram Mikrogramm l microliter Mikroliter German: AG antigen Antigen English: Ag German: AK antibody Antikrper English: Ab CLIA Chemiluminescence Chemilumineszenz Immunoassay Immunassay E/S Excretory/Secretory Exkretorisch/Sekretorisch ELISA Enzyme-linked Immunosorbent Assay EU European Union Europaische Union g gram Gramm IIFT indirect immono- Indirekter fluorescence test Immunfluoreszenztest l liter Liter mg milligram Milligramm Min. minute Minute ml milliliter Milliliter ML muscle larva Muskellarven NBL New Born Larva Neugeborene Larven NBT/BCIP nitro-blue tetrazolium Nitroblautetrazoliumchlorid/ chloride/5-bromo-4- 5-Brom-4- chloro-3-indolylophos- chlor-3-indolylphosphat phate p-toluidine salt Ng nanogram Nanogramm nm nanometer Nanometer O.D. Optical Density Optische Dichte rpm revolutions per minute Umdrehungen pro Minute RT room temperature Raumtemperatur Sek. second Sekunde SDS PAGE Sodium Dodecyl Natriurndodecylsulfat- Sulfate Polyacrylamide Polyacrylamidgel- Gel Electrophoresis elektrophorese
Literature
[0149] 1. Dupouy J, Murrell K D: FAO/WHO/OIE guidelines for the surveillance, management, prevention and control of trichinellosis; 2007. [0150] 2. Mitreva M, Jasmer D P: WormBook: Biology and genome of Trichinella spiralis; 2006. [0151] 3. Zarlenga D S, La Rosa G, Pozio E, Rosenthal B: Identification and classification within the genus Trichinella, with special emphasis on non-encapsulated species. Vet Parasitol 2004, 125: 75-78. [0152] 4. Liu M, Boireau P: Trichinellosis in China: epidemiology and control. Trends Parasitol 2002, 18(12): 553-556. [0153] 5. BfR [German Federal Institute for Risk Assessment]: TrichinelloseErkennung, Behandlung und Verhtung [Trichinellasisdetection, treatment, and prevention]. Information BfR 2007 [Information from the BfR, 2007]. [0154] 6. Kapel C M: Changes in the EU legislation on Trichinella inspectionnew challenges in the epidemiology. Vet Parasitol 2005, 132 (1-2): 189-194. [0155] 7. Nckler K, Serrano F J, Boireau P, Kapel C M, Pozio E: Experimental studies in pigs on Trichinella detection in different diagnostic matrices. Vet Parasitol 2005, 132(1-2): 85-90. [0156] 8. RKI [Robert Koch Institute]: Ringversuch zum Nachweis von Trichinellen in Fleisch [collaborative trial to detect Trichinella in meat]. In: Robert Koch Institute; 2016. [0157] 9. Report on the Validation of the Trichin-L antigen test kit of the Bio-Rad Company In: European Union Reference Laboratory for Parasites; 2010. [0158] 10. Retsch GmbH: CAMSIZER CharacteristicsBasis of definition DIN 66141. 2009. [0159] 11. Appleton J A, Schain L R, and McGregor D D. 1988. Rapid expulsion of Trichinella spiralis in suckling rats: mediation by monocional antibodies. Immunology 65: 487-492. [0160] 12. Altschul S F, Gish W, Miller W, Myers E W & Lipman D J. (1990) Basic local alignment search tool. J. Mol. Biol. 215: 403-410 [0161] 13. Altschul S F, Madden T L, Schaffer A A, Zhang J, Zhang H, Miller W, and Lipman D J. (1997): Gapped BLAST and PSI-BLAST: a new generation of protein database search programs; Nucleic Acids Res., 25, pp. 3389-3402 [0162] 14. Chenna et al. (2003): Multiple sequence alignment with the Clustal series of programs. Nucleic Acid Research 31, 3497-3500 [0163] 15. Notredame et al. (2000): T-Coffee: A novel method for multiple sequence alignments. J. Mol. Biol. 302, 205-217