Hexon protein hypervariable region gene sequence of adenovirus and its application
20200231631 ยท 2020-07-23
Inventors
- Ping CHEN (Jiaxing, CN)
- Na LI (Jiaxing, CN)
- Xintao ZHONG (Jiaxing, CN)
- Tingting ZHANG (Jiaxing, CN)
- Nan LI (Jiaxing, CN)
Cpc classification
C12N2710/10022
CHEMISTRY; METALLURGY
C12N2710/10322
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C12N2710/10334
CHEMISTRY; METALLURGY
International classification
Abstract
The invention provides a gene sequence which can encode and express adenovirus hexon protein in vitro, and is represented as SEQ ID NO: 3. Also invented a protein which was translated and expressed by the gene sequence according to the invention, and the invention also relates to the use of the protein as an antigen to immunize rabbits to obtain a polyclonal antibody. The antibody mentioned above can detect adenovirus with high sensitivity and specificity.
Claims
1. A method for producing an adenovirus hexon protein, comprising the following steps: using two primers to amplify Hexon-HVR full-length gene sequence as to get a nucleotide sequence consisting of SEQ ID NO:3; wherein the two primers are SEQ ID NO:1 and SEQ ID NO:2; inserting the nucleotide sequence into a plasmid vector; and transferring the vector with the nucleotide sequence into Escherichia coli as to express the adenovirus hexon protein.
2. The method according to claim 1, wherein the Hexon-HVR full-length gene sequence is the serial number of AC_000008.1 in NCBI.
3. The method according to claim 1, wherein after the adenovirus hexon protein is expressed, it is purified by the following steps: i) the inclusion body which have expressed is collected by centrifuging at 8000 rpm for 10 min; ii) the obtained inclusion body is resuspended with 15 ml inclusion body washing solution, and slowly stirred at 37 C. for 30 min, then centrifuged at 4000 rpm for 30 min, and rewashing again after collecting the inclusion body pellet; iii) after centrifugation and washing twice with washing solution, the inclusion body is resuspended with 15 ml inclusion body purification solution A, slowly stirred at 37 C. for 30 min, then centrifuged at 8000 rpm for 10 min, and collecting the supernatant; iv) the supernatant is added to a well-balanced nickel column (nickel column was balanced by 3 times of column volumes of ddH.sub.2O and 3 times of column volumes of inclusion body purification solution A), thoroughly mixed with the nickel column and incubated at room temperature for 30 min after closing the bottom of the nickel column; v) opening the bottom of the column, collecting the liquid which flows out from the column, and the loading is repeated for three times; vi) washing the impure protein by 5 times of column volume of the inclusion body purification solution A which containing 20 mM imidazole; vii) eluting the protein by the inclusion body purification solution A containing 250 mM imidazole, collecting protein every 1 ml and collecting 7 tubes altogether; viii) eluting the protein by the inclusion body purification solution A containing 500 mM imidazole, collecting protein every 1 ml, a total of 4 tubes are collected; and ix) washing the nickel column with 3 times of column volumes of inclusion body purification solution A containing 500 mM imidazole, 3 times of column volume of ddH.sub.2O and 3 times of column volume of 20% ethanol, and finally soaking the nickel column in ethanol; wherein the inclusion body washing solution is comprised by 50 mM Tris-base, 10 mM EDTA, 100 mM NaCl and 0.5% (v/v) Triton X-100; the inclusion body purification solution A is comprised by 20 mM Tris-HCl (pH 7.9), 0.5 M NaCl, 8 M Urea and 20-500 mM Imidazole.
4. The method according to claim 1, wherein the adenovirus hexon protein has the amino acid sequence of SEQ ID NO:4.
5. The method according to claim 1, further comprising using the expressed protein to immunize rabbits as to get an antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014]
[0015]
[0016]
[0017]
[0018]
DETAILED DESCRIPTION OF THE INVENTION
[0019] The structures involved in the present invention or the technical terms used in the present invention are further described below. These descriptions are merely to illustrate how to implement the present invention and they cannot constitute any limitation to the present invention.
Example 1: Amplification of the AD5-Hexon-HVR Gene Sequence
[0020] A pAd/CMV/V5-DEST plasmid (purchased from ThermoFish Scientific, catalog number V49420) with adenovirus type 5 genomic DNA was used as a template for AD5-Hexon-HVR gene amplification. Designing specific primers named Ad5hexon-HVR-F/Ad5hexon-HVR-R, and using Q5 PCR MasterMix high-fidelity enzyme (purchased from Kitai, made by NEB with batch No. 0111512) to amplify the Hexon-HVR gene (Human adenovirus 5 with full-length 35881 bp and NCBI sequence number AC_000008.1, the obtained sequence position was located at 19250 bp-20188 bp). The specific operation was performed with reference to the instructions.
[0021] PCR reaction conditions are as follows:
TABLE-US-00001 TABLE 1 PCR reaction conditions STEP TEMP TIME Initial Denaturation 98 C. 30 seconds 35 Cycles 98 C. 10 seconds 56 C. 30 seconds 72 C. 20 seconds Final Extension 72 C. 2 minutes Hold 4 C.
Primer sequence:
TABLE-US-00002 Ad5hexon-HVR-F: CCCAAGCTTGAAGCTGCTACTGCTCTTG (SEQIDNO:1) Ad5hexon-HVR-R: CCGCTCGAGTTTATCTGAAAATTCTGTAGCAT (SEQIDNO:2)
Specific reagent ratios for PCR amplification:
TABLE-US-00003 Q5 High-Fidelity 2 Master Mix 25 L F-Primer 1 L R-Primer 1 L pAd/CM/V5-DEST 1 L Nuclease-Free Water 22 L
[0022] The amplified product was sequenced to obtain the following sequence: AD5-Hexon-HVR gene sequence
TABLE-US-00004 (SEQIDNO:3) GAAGCTGCTACTGCTCTTGAAATAAACCTAGAAGAAGAGGACGATGACAA CGAAGACGAAGTAGACGAGCAAGCTGAGCAGCAAAAAACTCACGTATTTG GGCAGGCGCCTTATTCTGGTATAAATATTACAAAGGAGGGTATTCAAATA GGTGTCGAAGGTCAAACACCTAAATATGCCGATAAAACATTTCAACCTGA ACCTCAAATAGGAGAATCTCAGTGGTACGAAACTGAAATTAATCATGCAG CTGGGAGAGTCCTTAAAAAGACTACCCCAATGAAACCATGTTACGGTTCA TATGCAAAACCCACAAATGAAAATGGAGGGCAAGGCATTCTTGTAAAGCA ACAAAATGGAAAGCTAGAAAGTCAAGTGGAAATGCAATTTTTCTCAACTA CTGAGGCGACCGCAGGCAATGGTGATAACTTGACTCCTAAAGTGGTATTG TACAGTGAAGATGTAGATATAGAAACCCCAGACACTCATATTTCTTACAT GCCCACTATTAAGGAAGGTAACTCACGAGAACTAATGGGCCAACAATCTA TGCCCAACAGGCCTAATTACATTGCTTTTAGGGACAATTTTATTGGTCTA ATGTATTACAACAGCACGGGTAATATGGGTGTTCTGGCGGGCCAAGCATC GCAGTTGAATGCTGTTGTAGATTTGCAAGACAGAAACACAGAGCTTTCAT ACCAGCTTTTGCTTGATTCCATTGGTGATAGAACCAGGTACTTTTCTATG TGGAATCAGGCTGTTGACAGCTATGATCCAGATGTTAGAATTATTGAAAA TCATGGAACTGAAGATGAACTTCCAAATTACTGCTTTCCACTGGGAGGTG TGATTAATACAGAGACTCTTACCAAGGTAAAACCTAAAACAGGTCAGGAA AATGGATGGGAAAAAGATGCTACAGAATTTTCAGATAAA
[0023] The AD5-Hexon-HVR amino acid sequence deduced from the above gene sequence:
TABLE-US-00005 (SEQIDNO:4) EAATALEINLEEEDDDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQI GVEGQTPKYADKTFQPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGS YAKPTNENGGQGILVKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVL YSEDVDIETPDTHISYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGL MYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYFSM WNQAVDSYDPDVRIIENHGTEDELPNYCFPLGGVINTETLTKVKPKTGQE NGWEKDATEFSDK
Example 2 The Transformation of pET24b by AD5-Hexon-HVR Gene Sequence and Its Identification and Expression
[0024] The PCR product (SEQ ID NO: 3) was double-digested by restriction enzyme XhoI and HindIII and ligated with the vector pET24b plasmid (given by Hebei Chuangyue Company, Mr. Liu Jilai) digested by the same enzyme and transformed into E. coli BL21 (purchased from TransGen Biotech Company). The positive clones were analyzed by PCR and identified by restriction enzyme digestion and nucleotide sequencing. The results indicating that the sequence of SEQ ID NO: 3 was successfully inserted into the plasmid vector and successfully transformed into the E. coli BL21
Example 3: Induced Expression of AD5-Hexon-HVR Gene
[0025] The positive strains with the correct gene sequence were inoculated in fresh LB medium and activated for expansion. The LB medium was consisted by 10 g tryptone, 5 g yeast extract, 10 g sodium chloride (NaCl), and add water to 1 L. After activation, the culture was expanded at 37 C. until the OD600 was about 0.6. The target protein expression was induced by 1 mmol/L IPTG at 37 C. for 4 h.
Example 4: Purification of Protein AD5-Hexon-HVR-His
[0026] 2.1 Reagents
[0027] 2.1.1 Inclusion body washing solution: 50 mM Tris-base, 10 mM EDTA, 100 mM NaCl, 0.5% (v/v) Triton X-100.
[0028] 2.1.2 Inclusion body purification solution A: 20 mM Tris-HCl (pH 7.9), 0.5M NaCl, 8M Urea, 20500 mM Imidazole.
[0029] 2.2 Methods
[0030] 2.2.1 The bacterial pellets were collected after centrifuging at 8000 rpm for 10 minutes.
[0031] 2.2.2 The obtained inclusion body was resuspended with 15 ml inclusion body washing solution, and slowly stirred at 37 C. for 30 min, then centrifuged at 4000 rpm for 30 min, and rewashing again after collecting the inclusion body pellet.
[0032] 2.2.3 After centrifugation and washing twice with washing solution, the inclusion body was resuspended with 15 ml inclusion body purification solution A, slowly stirred at 37 C. for 30 min, then centrifuged at 8000 rpm for 10 min, and collecting the supernatant.
[0033] 2.2.4 The supernatant was added to a well-balanced nickel column (nickel column which was balanced by 3 times of column volumes of ddH.sub.2O and 3 times of column volumes of inclusion body purification solution A), thoroughly mixed with the nickel column and incubated at room temperature for 30 min after closing the bottom of the nickel column.
[0034] 2.2.5 Opening the bottom of the column, collecting the liquid which flew out from the column, and the loading was repeated for three times.
[0035] 2.2.6 Washing the impure protein by 5 times of column volume of the inclusion body purification solution A which containing 20 mM imidazole.
[0036] 2.2.7 Eluting the protein by the inclusion body purification solution A containing 250 mM imidazole, collecting protein every 1 ml and collecting 7 tubes altogether.
[0037] 2.2.8 Eluting the protein by the inclusion body purification solution A containing 500 mM imidazole, collecting protein every 1 ml, a total of 4 tubes were collected.
[0038] 2.2.9 Washing the nickel column with 3 times of column volumes of inclusion body purification solution A containing 500 mM imidazole, 3 times of column volume of ddH.sub.2O and 3 times of column volume of 20% ethanol, and finally soaking the nickel column in ethanol.3. The concentration of the purified Ad5hexon-HVR-His protein was determined quantitatively by the BCA method.
[0039] 3.1 Reagents
[0040] 3.1.1 Reagent A: containing 1% BCA disodium salt, 2% anhydrous sodium carbonate, 0.16% sodium tartrate, 0.4% sodium hydroxide, and 0.95% sodium bicarbonate. Mixing the above liquid and then adjusting the pH to 11.25.
[0041] 3.1.2 Reagent B: 4% copper sulfate.
[0042] 3.1.3 BCA Working Solution: 100 mL Reagent A and 2L Reagent B, and well mixed.
[0043] 3.1.4 Protein standard solution: the 1.5 mg/mL bovine serum albumin standard solution was prepared by dissolving its crystals of 150 mg in 100 mL of distilled water.
[0044] 3.1.5 The samples to be tested.
[0045] 3.2 Operation (Table 2):
TABLE-US-00006 TABLE 2 Operation and Measurement Results Tube number Reagents (ml) 1 2 3 4 5 6 7 protein standard 0.02 0.04 0.06 0.08 0.1 solution distilled water 0.1 0.08 0.06 0.04 0.02 Purified Adenovirus 0.1 Hexon Protein Hypervariable Region Protein BCA working fluid 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Protein content 30 60 90 120 150
[0046] 3.2.1 After the tubes in the above table were mixed thoroughly and incubated at 37 C. for 30 minutes, the absorbance of the solutions were measured in the wavelength of 562 nm with colorimetric method.
[0047] 3.2.2 The standard curve was drawn with the protein content as the abscissa and the light absorbance as the ordinate (
[0048] 3.2.3 The corresponding protein content was calculated according to the absorbance value of the assay tubes and the standard curve, and then the protein concentration (g/L) in the serum was calculated.
[0049] Results: The concentration of purified Ad5hexon-HVR-His protein was quantified using the BCA method and the protein concentration was calculated according to the standard curve. After the protein concentration was measured by the BCA method, about 2.4 mg of Ad5HVR-His protein was obtained (
Example 5: The Western Blot Hybridization Test was Carried Out by using Ad5 Anti Rabbit Polyclonal Antibody and His Anti Rat Polyclonal Antibody
[0050] 10 ul 5SDS loading buffer was added to the protein solution which was obtained in example 3, and then boiling for ten minutes to make the protein denatured. Loading the sample to SDA-PAGE (the concentration of separation gel was 8%), and incubating at room temperature for 1 hour by using his antibody (purchased from ZSGB,17AW0307) and Ad5 Anti rabbit polyclonal antibody (purchased from Abcam, GR269446-1) as Primary antibodies respectively, and Goat anti-mouse (purchased from ZSGB, ZDR-5307) with 1:3000 dilutability as secondary antibody after western transfer.
[0051] As shown in
Example 6: Immunizing Rabbits by the Protein Obtained in Example 4
[0052] The immune method was conducted as follows: using back muscles multi-point injection to immunize rabbits, ten points one time, and the dose are listed in the table 3.
[0053] The experimental rabbits were immunized four times following the method listed in table 3.
TABLE-US-00007 TABLE 3 Immunological test Time work node work content Before Collecting Negative blood Negative blood immunization before immunization 0.5 ml each one First immunization First immunization 200 g of antigen First immunization, Second immunization 200 g of antigen day 14 First immunization, Third immunization 200 g of antigen day 28 First immunization, Forth immunization 200 g of antigen day 42 First immunization, Blood serum collection Positive blood serum day 52 40 ml each one
Example 6: The Fourth Serum Antibody Titers were Detected by ELISA
Experimental Design:
[0054] 6.1 Coating proteantigen: the amount of the proteantigen was 0.2 g per hole, diluting the Ad5hexon-HVR-His protein(obtained in example 4) to 2 g/ml with PBST solution respectively, and the protein which have been diluted were added to the ELISA96 plates with the amount of 100 0 per hole, then sealing the ELISA96 orifice plates and placed in 4 C. for the night.
[0055] 6.2 Removing the coating solution and washing the proteantigen with PBST solution for three times. After drying, 3% BSA solution (served as sealing solution) was added to the ELISA96 plates with the amount of 50 l per hole, and then incubating at 37 C. for 2 h.
[0056] 6.3 After removing the sealing solution and drying, the ELISA96 plates were covered with membrane and conserved under 20 C. for use.
[0057] 6.4 washing the ELISA plate with PBST solution for three to five times before loading samples. The dilution rates of selected serum were 1:100, 1:500, 1:2500, 1:12500, 1:25000, 1:50000, 1:100000 and 1:200000.
[0058] Negative blood serum was with the same dilution and Ad5hexon rabbit polyclonal antibody served as positive contrast was with 1:5000 dilution rate. Add PBST solution and serum to each hole according to tables 4 and 5.
[0059] 6.5 adding 50 l HRP-IgG with 1:2000 dilution to the ELISA 96 plates, and then incubating at 37 C. for 45 min.
[0060] 6.6 Washing with PBST solution for three to five times, and drying.
[0061] 6.7 adding 50 l TMB Substrate to the ELISA96 plates, color developing at 37 C. for 10 to 15 minutes.
[0062] 6.8 adding 50 l stop buffer (2M H.sub.2SO.sub.4).
[0063] 6.9 The corresponding OD values at 450 nm were measured.
[0064] Results are shown in tables 4 and 5; the immune serum before first immunization (negative) and after fourth immunization and fifth immunization were selected;
[0065] The immune serum of the two rabbits was selected for parallel experiments. The only difference is times of immunization.
TABLE-US-00008 TABLE 4 Serum Negative Serum Negative of serum of of serum of rabbit rabbit rabbit rabbit A, A, B, B, after after after before Pos- PBST three first three first itive Blank dilut- immuni- immuni- immuni- immuni- con- con- ability zations zation zations zation trast trast 1:10 0.7606 0.3984 0.723 0.4354 0.1818 0.0727 1:50 0.7352 0.1849 0.7641 0.1918 0.1494 0.0616 1:250 0.7944 0.083 0.7992 0.0874 0.1317 0.063 1:1250 0.7575 0.0653 0.7818 0.0671 0.1368 0.0517 1:2500 0.7127 0.0566 0.7208 0.056 0.0774 1:5000 0.5933 0.058 0.6327 0.0538 0.0599 1:10000 0.5068 0.0596 0.4987 0.0562 0.0503 1:20000 0.3567 0.0568 0.3272 0.049 0.0813
TABLE-US-00009 TABLE 5 Serum Negative of serum of Negative raabblt rabbit A, Serum of serum of A, after before rabbit B, rabbit B, four first after four before first PBST dilut- immuni- immuni- immuni- immuni- Positive blank ability zations zation zations zation contrast contrast 1:10 0.7834 0.118 0.8263 0.1083 0.2028 0.0576 1:50 0.7762 0.0843 0.8078 0.0784 0.1964 0.0581 1:250 0.7785 0.0755 0.7735 0.0775 0.0633 1:1250 0.7291 0.055 0.6932 0.057 0.0542 1:2500 0.5876 0.0766 0.5165 0.0697 0.0539 1:5000 0.5463 0.0597 0.4082 0.0606 0.0579 1:10000 0.3347 0.0992 0.266 0.067 0.0591 1:20000 0.3016 0.0516 0.1875 0.0508 0.0742
[0066] The results are as follows:
[0067] The results of PBST as blank control and positive contrast are corresponding with the experimental requirements, and the experimental data are reliable. The antibody titer of AD5-Hexon-HVR-His polyclonal albumen is high to 1:200000, and P/N2.1 after four immunizations using AD5 Rabbit polyclonal antibody (purchased from AbcamPLC with batch number GR269446-1) as positive contrast. The antibody titer of the serum from the rabbits immunized by AD5-Hexon-HVR-His protein was significantly higher than that of the positive control ADS Rabbit polyclonal antibody (abcam6982)
Example 7: The Detection of Ad5 by Western Blot Using the Serum of Rabbits Which was Immunized by AD5-Hexon-HVR-His Protein
[0068] 7.1 The Antigens were 293-tx cells containing type 5 adenovirus, and the culture medium were abandoned after cell centrifugation. The supernatant was collected after cell lysis by cell lysis solution. Adding a certain amount of 5*SDS loading buffer to the supernatant and boiling for ten minutes, and then loading the sample to 15% albumen glue for electrophoresis.
[0069] 7.2 Adding the serum from rabbit A after three immunizations to the positive serum immunized by AD5-Hexon-HVR-His protein, and it was diluted to 1:5000 by PBST solution. The Ad5 Rabbit polyclonal antibody (Abcam 6982) with 1:5000 dilutability was served as positive control.
[0070] The results showed that Ad5 protein can be detected in both serum and positive control serum. The Hexon band (about 110 KDa, the band 3 and 4 in picture 5) can be detected in serum with 1:5000 dilution, and which have higher brightness.
CONCLUSIONS
[0071] Both ELISA and WB results showed that the serum obtained from rabbits after four immunizations by the purified AD5-Hexon-HVR-His protein have high sensibility (more than 1:200,000 in ELISA test) and specificity (it can be used to detect Ad5hexon protein specifically). Ad5 HVR protein has good immunogenicity and can be used as a detection antibody for detection of Ad5 in future studies.
[0072] At the same time, the rabbit polyclonal antibody produced by the protein in this invention can be used to detect human adenovirus 1-57 including A, B, C, D, E adenovirus through ELISA (the specific experiments are omitted), but not all of the human adenovirus 1-57 including A, B, C, D, E adenovirus can be detected by using the control antibodies (Ad5 rabbit polyclonal antibody (Abcam 6982)). It further proved that the antibody of this invention could also help prevent the problem of failing to detect any adenovirus because of its wide detection coverage. The antibody can detect various types of adenovirus antigens with high sensitivity. The invention illustratively described herein may be practiced in the absence of any element or elements, limitation or limitations that are not specifically disclosed herein. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by various embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims.
[0073] The content of the articles, patents, patent applications, and all other documents and electronically available information mentioned or cited herein, are hereby incorporated by reference in their entirety to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference. The applicant reserves the right to incorporate into this application any and all materials and information from any such articles, patents, patent applications or other documents.