Compositions and methods for regulating thermogenesis and muscle inflammation using metrnl and metrn

10717992 ยท 2020-07-21

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides compositions and methods for regulating thermogenesis and muscle inflammation through modulation of Metrnl and/or Metrn activity and/or expression. Also provided are methods for preventing or treating metabolic disorders and muscle inflammation disorders in a subject through modulation of Metrnl and/or Metrn activity and/or expression. Further provided are methods for identifying compounds that are capable of treating metabolic disorders and muscle inflammation disorders by modulating Metrnl and/or Metrn activity and/or expression.

Claims

1. A method for increasing thermogenic gene expression in adipose tissue or decreasing expression of at least one inflammation-related gene in skeletal muscle, wherein the inflammation-related gene is selected from the group consisting of tumor necrosis factor alpha (TNF-), interleukin-6 (IL-6), and interleukin beta (IL-), in an obese subject in need thereof comprising directly administering to a site of the adipose tissue or the skeletal muscle of the subject an agent, wherein the agent comprises: (i) a Metrnl polypeptide having the amino acid sequence of residues 46-311 of SEQ ID NO: 4; or (ii) a nucleic acid molecule encoding a Metrnl polypeptide having the amino acid sequences of residues 46-311 of SEQ ID NO: 4, wherein the nucleic acid molecule is operatively linked to a promoter.

2. The method of claim 1, wherein the agent is the Metrnl polypeptide that further comprises a heterologous polypeptide fused thereto.

3. The method of claim 2, wherein the heterologous polypeptide is selected from the group consisting of an Fc domain, a signal peptide, a peptide tag, a dimerization domain, an oligomerization domain, an antibody, and an antibody fragment.

4. The method of claim 3, wherein the heterologous polypeptide is the signal peptide.

5. The method of any one of claims 1-4, wherein a) the thermogenic gene is selected from the group consisting of TNF-, IL-6, IL-P, IL-10, TGF-P, ucp-1, cidea, dio2, pgcip, err-a, pgcla, pgcla isoforms, bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdml6, cytochrome C, cox4il, coxIII, cox5b, cox7al, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufsl, GRP109A, acylCoA-thioesterase 4, EARA1, claudinl, PEPCK, fgf21, and acylCoA-thioesterase 3; and/or b) the subject is a human.

6. The method of claim 1, wherein the agent is the nucleic acid molecule that encodes the Metrnl polypeptide and that further encodes a heterologous polypeptide fused thereto.

7. The method of claim 6, wherein the heterologous polypeptide is selected from the group consisting of an Fc domain, a signal peptide, a peptide tag, a dimerization domain, an oligomerization domain, an antibody, and an antibody fragment.

8. The method of claim 7, wherein the heterologous polypeptide is the signal peptide.

9. The method of any one of claims 6-8, wherein a) the thermogenic gene is selected from the group consisting of TNF-, IL-6, IL-P, IL-10, TGF-P, ucp-1, cidea, dio2, pgcip, err-a, pgcla, pgcla isoforms, bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdml6, cytochrome C, cox4il, coxIII, cox5b, cox7al, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufsl, GRP109A, acylCoA-thioesterase 4, EARA1, claudinl, PEPCK, fgf21, and acylCoA-thioesterase 3; and/or b) the subject is a human.

Description

BRIEF DESCRIPTION OF FIGURES

(1) FIG. 1 shows quantitative polymerase chain reaction (qPCR) results of thermogenic gene expression in subcutaneous inguinal fat depots from myogenin promoter-driven PGC-14 transgenic mice and littermate controls (n=4).

(2) FIG. 2 shows the results of protein and gene expression analyses of plasma and adipose tissue obtained from obese C57/BL6 mice intravenously injected with 110.sup.10 LacZ- or Metrnl-expressing adenoviral particles and sacrificed 5 days later (n=5 for each group). FIG. 2A shows Metrnl protein expression levels in plasma, as determined by Western blot analysis, from mice injected with the LacZ- or Metrnl-expressing adenoviral particles. FIG. 2B shows quantitative polymerase chain reaction (qPCR) results of thermogenic gene expression in subcutaneous inguinal fat from mice injected with the LacZ- or Metrnl-expressing adenoviral particles. Data shown are representative of two independent experiments and bar graphs are mean+/standard error of the mean (S.E.M.).

(3) FIG. 3 shows the results of inflammation-related gene expression analyses of skeletal muscle tissue obtained from C57/BL6 mice intravenously injected with 110.sup.10 LacZ- or Metrnl-expressing adenoviral particles and sacrificed 5 days later (n=5 for each group). Data shown are representative of two independent experiments and bar graphs are mean+/standard error of the mean (S.E.M.).

DETAILED DESCRIPTION OF THE INVENTION

(4) The present invention is based in part on the discovery that Metrnl, Metrn, and biologically active fragments thereof are secreted polypeptides that have the ability to induce significant induction of thermogenesis and brown fat gene programs in adipose tissue and inhibit inflammation in skeletal muscle. Brown fat gene programs can be induced in white adipose tissue in order to promote thermogenesis upon myokine signaling received by white adipose cells from the expression and/or activity of Metrnl, Metrn, or biologically active fragments thereof. The compositions and methods described herein are capable of activating a distinct set of target genes (including, for example but not limited to, TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3) characteristic of brown fat cells or downstream effects of brown fat cells. Increased brown fat cell program induction in mammals using Metrnl, Metrn, and biologically active fragments thereof can result in many therapeutically beneficial endpoints for regulating metabolic disorders, such as the ability to induce the expression of mitochondrial genes (including, for example but not limited to, cytochrome c, cox 4i1, cox III, cox 5b, cox8b, atpase b2, cox II, atp5o and ndufb5); increase cellular respiration (i.e., total and uncoupled respiration); increase insulin sensitivity and thermogenesis of adipose cells; increase insulin sensitivity of muscle and hepatic cells; decrease hepatosteatosis, obesity, type II diabetes, and appetite; increase insulin secretion of pancreatic beta cells; increases cardiac function to combat cardiac hypertrophy; improve muscle hypoplasia; and reduce the growth and effects of obesity-associated cancer, cachexia, and anorexia. Muscle-related inflammation can also be inhibited via myokine signaling received by muscle cells (e.g., skeletal muscle cells) resulting from the expression and/or activity of Metrnl, Metrn, or biologically active fragments thereof. The compositions and methods described herein are capable of significantly altering the expression of pro-inflammatory genes, such as TNF-, IL-6, and IL-, as well as anti-inflammatory genes, such as IL-10 and TGF-, in such treated muscle cells.

(5) In order that the present invention may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description. The term altered amount of a marker or altered level of a marker refers to increased or decreased copy number of the marker and/or increased or decreased expression level of a particular marker gene or genes in a cancer sample, as compared to the expression level or copy number of the marker in a control sample. The term altered amount of a marker also includes an increased or decreased protein level of a marker in a sample, e.g., a cancer sample, as compared to the protein level of the marker in a normal, control sample.

(6) The amount of a marker, e.g., expression or copy number of a marker or MCR, or protein level of a marker, in a subject is significantly higher or lower than the normal amount of a marker, if the amount of the marker is greater or less, respectively, than the normal level by an amount greater than the standard error of the assay employed to assess amount, and preferably at least twice, and more preferably three, four, five, ten or more times that amount. Alternately, the amount of the marker in the subject can be considered significantly higher or lower than the normal amount if the amount is at least about two, and preferably at least about three, four, or five times, higher or lower, respectively, than the normal amount of the marker.

(7) The term altered level of expression of a marker refers to an expression level or copy number of a marker in a test sample e.g., a sample derived from a subject suffering from cancer, that is greater or less than the standard error of the assay employed to assess expression or copy number, and is preferably at least twice, and more preferably three, four, five or ten or more times the expression level or copy number of the marker or chromosomal region in a control sample (e.g., sample from a healthy subject not having the associated disease) and preferably, the average expression level or copy number of the marker or chromosomal region in several control samples. The altered level of expression is greater or less than the standard error of the assay employed to assess expression or copy number, and is preferably at least twice, and more preferably three, four, five or ten or more times the expression level or copy number of the marker in a control sample (e.g., sample from a healthy subject not having the associated disease) and preferably, the average expression level or copy number of the marker in several control samples.

(8) The term altered activity of a marker refers to an activity of a marker which is increased or decreased in a disease state, e.g., in a cancer sample, as compared to the activity of the marker in a normal, control sample. Altered activity of a marker may be the result of, for example, altered expression of the marker, altered protein level of the marker, altered structure of the marker, or, e.g., an altered interaction with other proteins involved in the same or different pathway as the marker, or altered interaction with transcriptional activators or inhibitors.

(9) The term altered structure of a marker refers to the presence of mutations or allelic variants within the marker gene or maker protein, e.g., mutations which affect expression or activity of the marker, as compared to the normal or wild-type gene or protein. For example, mutations include, but are not limited to substitutions, deletions, or addition mutations. Mutations may be present in the coding or non-coding region of the marker.

(10) The term altered subcellular localization of a marker refers to the mislocalization of the marker within a cell relative to the normal localization within the cell e.g., within a healthy and/or wild-type cell. An indication of normal localization of the marker can be determined through an analysis of subcellular localization motifs known in the field that are harbored by marker polypeptides.

(11) The term amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids. Exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing. The names of the natural amino acids are abbreviated herein in accordance with the recommendations of IUPAC-IUB.

(12) The term antisense nucleic acid refers to oligonucleotides which specifically hybridize (e.g., bind) under cellular conditions with a gene sequence, such as at the cellular mRNA and/or genomic DNA level, so as to inhibit expression of that gene, e.g., by inhibiting transcription and/or translation. The binding may be by conventional base pair complementarity, or, for example, in the case of binding to DNA duplexes, through specific interactions in the major groove of the double helix.

(13) The term binding or interacting refers to an association, which may be a stable association, between two molecules, e.g., between a polypeptide of the invention and a binding partner, due to, for example, electrostatic, hydrophobic, ionic and/or hydrogen-bond interactions under physiological conditions. Exemplary interactions include protein-protein, protein-nucleic acid, protein-small molecule, and small molecule-nucleic acid interactions.

(14) The term biological sample when used in reference to a diagnostic assay is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject.

(15) As used herein, the term inhibit includes the decrease, limitation, or blockage, of, for example a particular action, function, or interaction. For example, muscle inflammation is inhibited if at least one symptom of muscle inflammation, such as overexpression of pro-inflammatory genes or underexpression of anti-inflammatory genes, is alleviated, terminated, slowed, or prevented. As used herein, cancer is also inhibited if recurrence or metastasis of the cancer is reduced, slowed, delayed, or prevented.

(16) The term isolated polypeptide refers to a polypeptide, in certain embodiments prepared from recombinant DNA or RNA, or of synthetic origin, or some combination thereof, which (1) is not associated with proteins that it is normally found within nature, (2) is isolated from the cell in which it normally occurs, (3) is isolated free of other proteins from the same cellular source, (4) is expressed by a cell from a different species, or (5) does not occur in nature.

(17) The terms label or labeled refer to incorporation or attachment, optionally covalently or non-covalently, of a detectable marker into a molecule, such as a polypeptide. Various methods of labeling polypeptides are known in the art and may be used. Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes, fluorescent labels, heavy atoms, enzymatic labels or reporter genes, chemiluminescent groups, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags). Examples and use of such labels are described in more detail below. In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.

(18) As used herein, the term inflammatory-associated myopathy disorders refers to any condition in which inflammation of muscle itself or in a location involving muscle cells is undesired. Included within the scope of such disorders are muscular dystrophies, which collectively refers to a group of degenerative muscle diseases characterized by gradual weakening and deterioration of skeletal muscles and sometimes the heart and respiratory muscles. Muscular dystrophies are genetic disorders characterized by progressive muscle wasting and weakness that begin with microscopic changes in the muscle. As muscles degenerate over time, the person's muscle strength declines. Moreover, declining muscle mass and diminishing physical activity contribute to an imbalance between caloric intake and energy expenditure, leading to unhealthy storage of excess energy as white adipose tissue. Exemplary muscular dystrophies that can be treated with the compositions and methods described herein include, without limitation, Duchenne Muscular Dystrophy (DMD), Becker Muscular Dystrophy (BMD), Emery-Dreifuss Muscular Dystrophy (EDMD), Limb-Girdle Muscular Dystrophy (LGMD), Facioscapulohumeral Muscular Dystrophy (FSH or FSHD) (also known as Landouzy-Dejerine), Myotonic Dystrophy (MMD) (also known as Steinert's Disease), Oculopharyngeal Muscular Dystrophy (OPMD), Distal Muscular Dystrophy (DD), and Congenital Muscular Dystrophy (CMD).

(19) The terms metabolic disorder and obesity related disorders are used interchangeably herein and include a disorder, disease or condition which is caused or characterized by an abnormal or unwanted metabolism (i.e., the chemical changes in living cells by which energy is provided for vital processes and activities) in a subject. Metabolic disorders include diseases, disorders, or conditions associated with aberrant or unwanted (higher or lower) thermogenesis or aberrant or unwanted levels (high or low) adipose cell (e.g., brown or white adipose cell) content or function. Metabolic disorders can be characterized by a misregulation (e.g., downregulation or upregulation) of PGC-1 activity. Metabolic disorders can detrimentally affect cellular functions such as cellular proliferation, growth, differentiation, or migration, cellular regulation of homeostasis, inter- or intra-cellular communication; tissue function, such as liver function, muscle function, or adipocyte function; systemic responses in an organism, such as hormonal responses (e.g., insulin response). Examples of metabolic disorders include obesity, insulin resistance, type II diabetes, hypertension, hyperuricemia, fatty liver, non-alcoholic fatty liver disease, polycystic ovarian syndrome, acanthosis nigricans, hyperphagia, endocrine abnormalities, triglyceride storage disease, Bardet-Biedl syndrome, Lawrence-Moon syndrome, Prader-Labhart-Willi syndrome, anorexia, and cachexia.

(20) As used herein, the term Metrnl refers to meteorin-like polypeptides and nucleic acid molecules encoding such polypeptides and is further intended to include fragments, variants (e.g., allelic variants) and derivatives thereof. The nucleotide and amino acid sequences of mouse Metrnl, which correspond to Genbank Accession number NM_144797.3 and NP_659046.1, respectively, are set forth in SEQ ID NOs: 1 and 2. Residues 1-45 of SEQ ID NO: 2 define a signal peptide, such that the mature murine Metrnl polypeptide contains residues 46-311 of SEQ ID NO: 2. Similarly, the nucleotide and amino acid sequences of human Metrnl, which correspond to Genbank Accession number NM_001004431.1 and NP_001004431.1, respectively, are set forth in SEQ ID NOs: 3 and 4. Residues 1-45 of SEQ ID NO: 4 define a signal peptide, such that the mature human Metrnl polypeptide contains residues 46-311 of SEQ ID NO: 4. Nucleic acid and polypeptide sequences of Metrnl orthologs in organisms other than mice and humans are well known and include, for example, chicken Metrnl (XM_415598.3; XP_415598.1), zebrafish Metrnl (BC046006.1; AAH46006.1), rat Metrnl (NM_001014104.1; NP_001014126.1), cow Metrnl (NM_001206050.1; NP_001192979.1), and frog Metrnl (NM_001097653.1; NP_001091122.1). Other useful Metrnl sequences that can be used according to the compositions and methods described herein are described in U.S. Pat. No. 8,334,264, which is hereby incorporated herein in its entirety.

(21) In some embodiments, fragments of Metrnl having one or more biological activities of the full-length Metrnl protein are described and employed. Such fragments can comprise or consist of at least one domain of an Metrnl protein other than the signal peptide without containing the full-length Metrnl protein sequence. In some embodiments, Metrnl fragments can comprise or consist of a substantially full-length Metrnl protein (e.g., the full-length Metrnl protein minus 1, 2, 3, 4, 5, 10, 15, 20, 25, or 30 or any range in between) or larger fragments with or without the signal peptide. As demonstrated by the sequences presented in Table 1, Metrnl orthologs are highly homologous and retain common structural domains well known in the art.

(22) As used herein, the term Metrn refers to meteorin polypeptides and nucleic acid molecules encoding such polypeptides and is further intended to include fragments, variants (e.g., allelic variants) and derivatives thereof. The nucleotide and amino acid sequences of mouse Metrn, which correspond to Genbank Accession number NM_133719.2 and NP_598480.1, respectively, are set forth in SEQ ID NOs: 17 and 18. Residues 1-21 of SEQ ID NO: 18 define a signal peptide, such that the mature murine Metrn polypeptide contains residues 22-291 of SEQ ID NO: 18. Similarly, the nucleotide and amino acid sequences of human Metrn, which correspond to Genbank Accession number NM_024042.2 and NP_076947.1, respectively, are set forth in SEQ ID NOs: 19 and 20. Residues 1-23 of SEQ ID NO: 20 define a signal peptide, such that the mature human Metrn polypeptide contains residues 24-293 of SEQ ID NO: 20. Nucleic acid and polypeptide sequences of Metrnl orthologs in organisms other than mice and humans are well known and include, for example, chimpanzee Metrn (XM_001156928.3; XP_001156928.1), cow Metrn (NM_001102026.2; NP_001095496.1), rat Metrn (NM_001009962.1; NP_00100962.1), chicken Metrn (XM_425223.4; XP_425223.3), and zebrafish Metrn (NM_001009983.2; NP_001009983.2).

(23) In some embodiments, fragments of Metrn having one or more biological activities of the full-length Metrn protein are described and employed. Such fragments can comprise or consist of at least one domain of an Metrn protein other than the signal peptide without containing the full-length Metrn protein sequence. In some embodiments, Metrn fragments can comprise or consist of a substantially full-length Metrn protein (e.g., the full-length Metrn protein minus 1, 2, 3, 4, 5, 10, 15, 20, 25, or 30 or any range in between) or larger fragments with or without the signal peptide. As demonstrated by the sequences presented in Table 1, Metrn orthologs are highly homologous and retain common structural domains well known in the art.

(24) TABLE-US-00001 TABLE1 SEQIDNO:1MouseMetrnlcDNASequence 1 atgcggggtgcggtgtgggcggcccggaggcgcgcggggcagcagtggcctcggtccccg 61 ggccctgggccgggtccgcccccgccgccaccgctgctgttgctgctactactgctgctg 121 ggcggcgcgagcgctcagtactccagcgacctgtgcagctggaaggggagtgggctcacc 181 cgagaggcacgcagcaaggaggtggagcaggtgtacctgcgctgctccgcaggctctgtg 241 gagtggatgtacccaactggggcgctcattgttaacctacggcccaacaccttctcacct 301 gcccagaacttgactgtgtgcatcaagcctttcagggactcctctggagccaatatttat 361 ttggaaaaaactggagaactaagactgttggtgcgggacatcagaggtgagcctggccaa 421 gtgcagtgcttcagcctggagcagggaggcttatttgtggaggcgacaccccaacaggac 481 atcagcagaaggaccacaggcttccagtatgagctgatgagtgggcagaggggactggac 541 ctgcacgtgctgtctgccccctgtcggccttgcagtgacactgaggtcctccttgccatc 601 tgtaccagtgactttgttgtccgaggcttcattgaggacgtcacacatgtaccagaacag 661 caagtgtcagtcatctacctgcgggtgaacaggcttcacaggcagaagagcagggtcttc 721 cagccagctcctgaggacagtggccactggctgggccatgtcacaacactgctgcagtgt 781 ggagtacgaccagggcatggggaattcctcttcactggacatgtgcactttggggaggca 841 caacttggatgtgccccacgctttagtgactttcaaaggatgtacaggaaagcagaagaa 901 atgggcataaacccctgtgaaatcaatatggagtga SEQIDNO:2MouseMetrnlAminoAcidSequence(SignalPeptide:Residues1-45) 1 mrgavwaarrragqqwprspgpgpgpppppplllllllllggasaqyssdlcswkgsglt 61 rearskeveqvylrcsagsvewmyptgalivnlrpntfspaqnltvcikpfrdssganiy 121 lektgelrllvrdirgepgqvqcfsleqgglfveatpqqdisrrttgfqyelmsgqrgld 181 lhvlsapcrpcsdtevllaictsdfvvrgfiedvthvpeqqvsviylrvnrlhrqksrvf 241 qpapedsghwlghvttllqcgvrpghgeflftghvhfgeaqlgcaprfsdfqrmyrkaee 301 mginpceinme SEQIDNO:3HumanMetrnlcDNASequence 1 atgcggggcgcggcgcgggcggcctgggggcgcgcggggcagccgtggccgcgacccccc 61 gccccgggcccgcccccgccgccgctcccgctgctgctcctgctcctggccgggctgctg 121 ggcggcgcgggcgcgcagtactccagcgaccggtgcagctggaaggggagcgggctgacg 181 cacgaggcacacaggaaggaggtggagcaggtgtatctgcgctgtgcggcgggtgccgtg 241 gagtggatgtacccaacaggtgctctcatcgttaacctgcggcccaacaccttctcgcct 301 gcccggcacctgaccgtgtgcatcaggtccttcacggactcctcgggggccaatatttat 361 ttggaaaaaactggagaactgagactgctggtaccggacggggacggcaggcccggccgg 421 gtgcagtgttttggcctggagcagggcggcctgttcgtggaggccacgccgcagcaggat 481 atcggccggaggaccacaggcttccagtacgagctggttaggaggcacagggcgtcggac 541 ctgcacgagctgtctgcgccgtgccgtccctgcagtgacaccgaggtgctcctagccgtc 601 tgcaccagcgacttcgccgttcgaggctccatccagcaagttacccacgagcctgagcgg 661 caggactcagccatccacctgcgcgtgagcagactctatcggcagaaaagcagggtcttc 721 gagccggtgcccgagggtgacggccactggcaggggcgcgtcaggacgctgctggagtgt 781 ggcgtgcggccggggcatggcgacttcctcttcactggccacatgcacttcggggaggcg 841 cggctcggctgtgccccacgcttcaaggacttccagaggatgtacagggatgcccaggag 901 agggggctgaacccttgtgaggttggcacggactga SEQIDNO:4HumanMetrnlAminoAcidSequence(SignalPeptide:Residues1-45) 1 mrgaaraawgragqpwprppapgppppplpllllllagllggagaqyssdrcswkgsglt 61 heahrkeveqvylrcaagavewmyptgalivnlrpntfsparhltvcirsftdssganiy 121 lektgelrllvpdgdgrpgrvqcfgleqgglfveatpqqdigrrttgfqyelvrrhrasd 181 lhelsapcrpcsdtevllavctsdfavrgsiqqvtheperqdsaihlrvsrlyrqksrvf 241 epvpegdghwqgrvrtllecgvrpghgdflftghmhfgearlgcaprfkdfqrmyrdaqe 301 rglnpcevgtd SEQIDNO:5ChickenMetrnlcDNASequence 1 atgccgctatttacttcttttctgaactcctttggactgctgacaattgatgcgtcctta 61 atccccgcgaatccacttcaaggcgagtccgttcgtggcttaactcacgagtctcacaag 121 aaggatgttgaacaggtctacctccgctgttccgaaggctccatagagtggatgtatccc 181 acgggagcgctcatagtcaacctgcgacccaacacttcacctgcctcctacaaacatttg 241 actgtttgcataaagcccttcaaggactctgcaggagcaaatatttatttggaaaaaact 301 ggagaactcaaactcttggtccgagatggagagcgcagccccagcaaggtgtactgcttt 361 ggctacgaccagggggggctgtttgtcgaggccaccccccagcaggacattagcaggaag 421 atcacaggcttccagtacgaactgatgagcagggggattgcatctgatttgcacacagtt 481 tctgctccatgccgaccatgcagtgacacagaggtcctcttggccgtctgcactagtgat 541 ttcgtgatcagaggctccattcaagatgtaacaaatgaggcagaagagcaagaatccata 601 attcacgttggcgtcaacaaactgtacaggcagaagagcaaagtctttcagctcacgggg 661 gagagtgggaactggcgaggacaaataaagaccctgctggagtgtggggtgagaccagga 721 gatggagacttcctcttcacgggacgcatgcactttggggaagccaggttaggctgtgcc 781 cctcgatttaaagacttccaaaggatgtacaaagaagcaaaagacaaagggctaaatcca 841 tgtgaaattggcccagattga SEQIDNO:6ChickenMetrnlAminoAcidSequence(SignalPeptide:Residues1-26) 1 mplftsflnsfglltidaslipanplqgesvrgltheshkkdveqvylrcsegsiewmyp 61 tgalivnlrpntspasykhltvcikpfkdsaganiylektgelkllvrdgerspskvycf 121 gydqgglfveatpqqdisrkitgfqyelmsrgiasdlhtvsapcrpcsdtevllavctsd 181 fvirgsiqdvtneaeeqesiihvgvnklyrqkskvfqltgesgnwrgqiktllecgvrpg 241 dgdflftgrmhfgearlgcaprfkdfqrmykeakdkglnpceigpd SEQIDNO:7ZebrafishMetrnlcDNASequence 1 atgctctcgccgttcttggcgtatttgctgtcggttgtgcttctgtgtcggattgcgcgc 61 tcccagtactcaagtgatcagtgcagctggaggggcagtggactgacccatgagggacac 121 actcggggtgtggagcaggtgtatctccgctgcgcccaggggttcctggagtggctgtac 181 cccactggcgcaatcatcgtcaacctgcggccaaacacgctgtcacccgcagcgtctctt 241 ctctccgtctgcatcaaaccctccaaggagtccagcgggacccacatctaccttgacaga 301 ctgggaaaattgcgactgctcctcagcgaaggggatcaggccgagggtaaagtgcactgc 361 ttcaacatccaggatggggcgctcttcatcgaagctgtgcctcaaagggacatcagccga 421 aaaatcacagccttccagtatgagctggtcaaccacagaccaggagcagatccacagtca 481 ttatctgctccctgccaaccgtgtacagatgcagaggtcctgctggccgtctgcaccagt 541 gactttgtggcgcgggggagaattcttggtgtatccgaggaggatgaacagacctcagtc 601 acagtgtccttaagtcacctatatagacagaagactcaagtgtttgtgtcagggggcggc 661 cgggctaaacgctggacaggctttgtgaagatgtccaggcagtgcggggttaaaccaggg 721 gacggcgagtttcttttcaccgggactgtgcgattcggagaggcctggctcagctgcgct 781 ccacgctacaaggacttccttagggtgtaccaggacgcgcggcagcaagggaccaacccc 841 tgtcatttggaaacagactga SEQIDNO:8ZebrafishMetrnlAminoAcidSequence(SignalPeptide:Residues1-21) 1 mlspflayllsvvllcriarsqyssdqcswrgsgltheghtrgveqvylrcaqgflewly 61 ptgaiivnlrpntlspaasllsvcikpskessgthiyldrlgklrlllsegdqaegkvhc 121 fniqdgalfieavpqrdisrkitafqyelvnhrpgadpqslsapcqpctdaevllavcts 181 dfvargrilgvseedeqtsvtvslshlyrqktqvfvsgggrakrwtgfvkmsrqcgvkpg 241 dgeflftgtvrfgeawlscaprykdflrvyqdarqqgtnpchletd SEQIDNO:9RatMetrnlcDNASequence 1 atgcggggtgtggtgtgggcggcccggaggcgcgcggggcagcagtggcctcggtccccg 61 ggccctgggccgggtccgcccccgccgccaccgctgctgttgctgctactgctgctgctg 121 ggcggcgcgagcgcgcagtactccagcgacctgtgcagctggaaggggagtgggctcacc 181 cgggaggcacacagcaaggaggtggagcaggtgtacctgcgctgctcagcaggctctgtg 241 gaatggatgtacccaaccggggcgctcattgttaacctacggcccaacaccttctcacct 301 gcccagaacttgactgtgtgcatcaagcctttcagggactcctctggggccaatatttat 361 ttggaaaaaactggagaactaagactgttggtgcgggatgtcagaggcgaacctggccaa 421 gtgcagtgcttcagcctagagcagggaggcttatttgtggaggccacaccccagcaggac 481 atcagcagaaggaccacaggcttccagtatgagctgatgagtgggcagaggggactggac 541 ctgcacgtgctctctgccccctgtcgaccttgcagcgacactgaggtcctccttgccatc 601 tgcaccagtgactttgttgtccgaggcttcatcgaggatgtcacccatgtaccagaacag 661 caagtgtcagtcattcacctacgggtgagcaggctccacaggcagaagagcagggtcttc 721 cagccagctcctgaggacagtggccactggctgggccatgtcacaacactgttgcagtgt 781 ggagtacgaccagggcatggagaattcctcttcactggacatgtgcactttggggaggca 841 caacttggatgtgccccacgctttagtgactttcaaaagatgtacaggaaagcagaagaa 901 aggggcataaacccttgtgaaataaatatggagtga SEQIDNO:10RatMetrnlAminoAcidSequence(SignalPeptide:Residues1-45) 1 mrgvvwaarrragqqwprspgpgpgpppppplllllllllggasaqyssdlcswkgsglt 61 reahskeveqvylrcsagsvewmyptgalivnlrpntfspaqnltvcikpfrdssganiy 121 lektgelrllvrdvrgepgqvqcfsleqgglfveatpqqdisrrttgfqyelmsgqrgld 181 lhvlsapcrpcsdtevllaictsdfvvrgfiedvthvpeqqvsvihlrvsrlhrqksrvf 241 qpapedsghwlghvttllqcgvrpghgeflftghvhfgeaqlgcaprfsdfqkmyrkaee 301 rginpceinme SEQIDNO:11CowMetrnlcDNASequence 1 atgcggggcgcgacgcgggcggctggggggcgcgcggggcagctgtggccgaggcccccc 61 gccccgggccctggaccgccgccgctgctgctgctgctggccgtgctactgggcggcgcg 121 ggcgcgcagtactcgagcgacctgtgcagctggaaggggagcgggctgacacacgaggcc 181 cacaggaaggaggtggagcaagtttacctgcgctgctcggcgggcaccgtcgagtggatg 241 tacccgaccggggcgctcatcgtgaacctacggcccaacaccttctcgccctcccggaac 301 ctgactctgtgcatcaagccccttaggggctcctcgggggccaatatttatttggaaaag 361 actggagaactgaaactgctggtgagggatggggacctcgggcccggccaggcgccgtgc 421 tttggcttcgagcaggggggcctgtttgtggaggcgacgccacagcaagacatcagcagg 481 aggaccacgggcttccagtacgagctgaccagcaggcgcacggggccggacctgcacgcc 541 ctgttggccccgtgccgcccttgcagccacacagaggttctcttggccgtctgcaccagc 601 gactttgtcgtccgaggctccatccagaaagtcacccacgagccggagcggcaggagtcg 661 gccatccacctgaacgtgagccggctctaccggcagaagagcagggtgttccggccggcc 721 cctgagggcgagggcggcggctggcgggggcgcgtctccacgctactggagtgcggcgtc 781 cggcctgggcacggcgagtttctcttcaccggccacatgcactttggggaggcctggctt 841 ggctgcgccccacgcttcaaggatttccaaaggatgtacagggacgctgaggagaggggg 901 ctgaacccctgcgagatgggcacggagtga SEQIDNO:12CowMetrnlAminoAcidSequence(SignalPeptide:Residues1-42) 1 mrgatraaggragqlwprppapgpgppplllllavllggagaqyssdlcswkgsglthea 61 hrkeveqvylrcsagtvewmyptgalivnlrpntfspsrnltlcikplrgssganiylek 121 tgelkllvrdgdlgpgqapcfgfeqgglfveatpqqdisrrttgfqyeltsrrtgpdlha 181 llapcrpcshtevllavctsdfvvrgsiqkvtheperqesaihlnvsrlyrqksrvfrpa 241 pegegggwrgrvstllecgvrpghgeflftghmhfgeawlgcaprfkdfqrmyrdaeerg 301 lnpcemgte SEQIDNO:13FrogMetrnlcDNASequence 1 atgttaaggaggggtctgctgagcttctttatggtgattcttatagacagagggacctca 61 cagctgtactccagcgacatgtgcaattggaaaggaagcggcttgacccatgagggccac 121 acgaaagatgttgagcaagtttacctccgctgctccgaaggttctgttgagtggctctac 181 ccaactggcgccatggttattaacctgaggcctaacaccttaacgtccgcctacaaacac 241 ctaacagtttgcatcaaaccttttaaagactccaagggagctaatatttattccgaaaaa 301 actggagaactcaaacttgtggtgccagatggagagaacaatccacacaaagtctattgc 361 tttggcctggatcgagggggtctgtatattgaggccaccccccagcaagacattagtcgc 421 aaaatcactggtttccagtatgaactgatcagccagaggactctctcggatttgcacaca 481 gtttctgatccctgccgcccctgcagtgatacagaagtcctgctagctgtctgtattagt 541 gatttcgttgtgaaagggacaatcagcgctgtgaccaatgatgaggagttgcaggaatct 601 ctgatcaacgtcacggtggataaactgtacaggcagaagagtaaaatcttccttcccaaa 661 gacaatgggggatgggagggaatgatacggactcctctggaatgtggggttaagacggga 721 atgggcagcttcttgttcacgggacgcatgcactttggggagcccagattgggctgcacg 781 ccccggtataaggactttaaaaggatatacctagaagcgaaaaagcaagggttaaaccca 841 tgtgaaatcagcacggactga SEQIDNO:14FrogMetrnlAminoAcidSequence(SignalPeptide:Residues1-21) 1 mlrrgllsffmvilidrgtsqlyssdmcnwkgsgltheghtkdveqvylrcsegsvewly 61 ptgamvinlrpntltsaykhltvcikpfkdskganiysektgelklvvpdgennphkvyc 121 fgldrgglyieatpqqdisrkitgfqyellsqrtlsdlhtvsdpcrpcsdtevllavcis 181 dfvvkgtisavtndeelqeslinvtvdklyrqkskiflpkdnggwegmirtplecgvktg 241 mgsflftgrmhfgeprlgctprykdfkriyleakkqglnpceistd SEQIDNO:15MouseMetrnlcDNASequenceWithC-TerminalV5EpitopeTag ATGCGGGGTGCGGTGTGGGCGGCCCGGAGGCGCGCGGGGCAGCAGTGGCCTCGGTCCCCGGGCCCTGGGC CGGGTCCGCCCCCGCCGCCACCGCTGCTGTTGCTGCTACTACTGCTGCTGGGCGGCGCGAGCGCTCAGTA CTCCAGCGACCTGTGCAGCTGGAAGGGGAGTGGGCTCACCCGAGAGGCACGCAGCAAGGAGGTGGAGCAG GTGTACCTGCGCTGCTCCGCAGGCTCTGTGGAGTGGATGTACCCAACTGGGGCGCTCATTGTTAACCTAC GGCCCAACACCTTCTCACCTGCCCAGAACTTGACTGTGTGCATCAAGCCTTTCAGGGACTCCTCTGGAGC CAATATTTATTTGGAAAAAACTGGAGAACTAAGACTGTTGGTGCGGGACATCAGAGGTGAGCCTGGCCAA GTGCAGTGCTTCAGCCTGGAGCAGGGAGGCTTATTTGTGGAGGCGACACCCCAACAGGACATCAGCAGAA GGACCACAGGCTTCCAGTATGAGCTGATGAGTGGGCAGAGGGGACTGGACCTGCACGTGCTGTCTGCCCC CTGTCGGCCTTGCAGTGACACTGAGGTCCTCCTTGCCATCTGTACCAGTGACTTTGTTGTCCGAGGCTTC ATTGAGGACGTCACACATGTACCAGAACAGCAAGTGTCAGTCATCTACCTGCGGGTGAACAGGCTTCACA GGCAGAAGAGCAGGGTCTTCCAGCCAGCTCCTGAGGACAGTGGCCACTGGCTGGGCCATGTCACAACACT GCTGCAGTGTGGAGTACGACCAGGGCATGGGGAATTCCTCTTCACTGGACATGTGCACTTTGGGGAGGCA CAACTTGGATGTGCCCCACGCTTTAGTGACTTTCAAAGGATGTACAGGAAAGCAGAAGAAATGGGCATAA ACCCCTGTGAAATCAATATGGAGGACCCAGCTTTCTTGTACPAAGTGGTTGATCTAGAGGGCCCGCGGTT CGAAGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGCGTACCGGTTAGTAATGA SEQIDNO:16MouseMetrnlAminoAcidSequenceWithC-TerminalV5EpitopeTag MRGAVWAARRRAGQQWPRSPGPGPGPPPPPPLLLLLLLLLGGASAQYSSDLCSWKGSGLT REARSKEVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIY LEKTGELRLLVRDIRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLD LHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIYLRVNRLHRQKSRVF QPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQRMYRKAEE MGINPCEINMEDPAFLYKVVDLEGPRFEGKPIPNPLLGLDSTRTG SEQIDNO:17MouseMetrncDNASequence 1 atgctggtagccacgcttctttgcgcgctctgttgcggcctcctggccgcgtccgctcac 61 gctggctactcggaagaccgctgcagctggaggggcagcggtttgacccaggagcctggc 121 agcgtggggcagctgaccctggactgtactgagggcgctatcgagtggctgtacccagct 181 ggggcgctgcgcctgaccctgggcggccccgatccgggcacacggcccagcatcgtctgt 241 ctgcgcccagagcggcccttcgctggtgcccaggtcttcgctgaacgtatgaccggcaat 301 ctagagttgctactggccgagggcccggacctggctgggggccgctgcatgcgctggggt 361 ccccgcgagcgccgagcccttttcctgcaggccacaccacaccgcgacatcagccgcaga 421 gttgctgccttccgttttgaactgcacgaggaccaacgtgcagaaatgtctccccaggct 481 caaggtcttggtgtggatggtgcctgcaggccctgcagtgatgccgagctcctcctggct 541 gcatgcaccagtgattttgtgatccacgggaccatccatggggtcgcccatgacacagag 601 ctgcaagaatcagtcatcactgtggtggttgctcgtgtcatccgccagacactgccactg 661 ttcaaggaagggagctcggagggccaaggccgggcctccattcgtaccttgctgcgctgt 721 ggtgtgcgtcctggcccaggctccttcctcttcatgggctggagccgatttggcgaagct 781 tggctgggctgtgctccccgcttccaagagttcagccgtgtctattcagctgctctcacg 841 acccatctcaacccatgtgagatggcactggactga SEQIDNO:18MouseMetrnAminoAcidSequence(SignalPeptide:Residues1-21) 1 mlvatllcalccgllaasahagysedrcswrgsgltqepgsvgqltldctegaiewlypa 61 galrltlggpdpgtrpsivclrperpfagaqvfaermtgnlelllaegpdlaggrcmrwg 121 prerralflqatphrdisrrvaafrfelhedqraemspqaqglgvdgacrpcsdaellla 181 actsdfvihgtihgvandtelqesvitvvvarvirqtlplfkegssegqgrasirtllrc 241 gvrpgpgsflfmgwsrfgeawlgcaprfqefsrvysaaltthlnpcemald SEQIDNO:19HumanMetrncDNASequence 1 atggggttcccggccgcggcgctgctctgcgcgctgtgctgcggcctcctggccccggct 61 gcccgcgccggctactccgaggagcgctgcagctggaggggcagcggcctcacccaggag 121 cccggcagcgtggggcagctggccctggcctgtgcggagggcgcggttgagtggctgtac 181 ccggctggggcgctgcgcctgaccctgggcggccccgatcccagagcgcggcccggcatc 241 gcctgtctgcggccggtgcggcccttcgcgggcgcccaggtcttcgcggagcgcgcaggg 301 ggcgccctggagctgctgctggccgagggcccgggcccggcagggggccgctgcgtgcgc 361 tggggtccccgcgagcgccgggccctcttcctgcaggccacgccgcaccaggacatcagc 421 cgccgcgtggccgccttccgctttgagctgcgcgaggacgggcgccccgagctgcccccg 481 caggcccacggtctcggcgtagacggtgcctgcaggccctgcagcgacgctgagctgctc 541 ctggccgcatgcaccagcgacttcgtaattcacgggatcatccatggggtcacccatgac 601 gtggagctgcaggagtctgtcatcactgtggtggccgcccgtgtcctccgccagacaccg 661 ccgctgttccaggcggggcgatccggggaccaggggctgacctccattcgtaccccactg 721 cgctgtggcgtccacccgggcccaggcaccttcctcttcatgggctggagccgctttggg 781 gaggcccggctgggctgtgccccacgattccaggagttccgccgtgcctacgaggctgcc 841 cgtgctgcccacctccacccctgcgaggtggcgctgcactga SEQIDNO:20HumanMetrnAminoAcidSequence(SignalPeptide:Residues1-23) 1 mgfpaaallcalccgllapaaragyseercswrgsgltqepgsvgqlalacaegavewly 61 pagalrltlggpdprarpgiaclrpvrpfagaqvfaeraggalelllaegpgpaggrcvr 121 wgprerralflqatphqdisrrvaafrfelredgrpelppqahglgvdgacrpcsdaell 181 laactsdfvihgiihgvthdvelqesvitvvaarvlrqtpplfqagrsgdqgltsirtpl 241 rcgvhpgpgtflfmgwsrfgearlgcaprfqefrrayeaaraahlhpcevalh SEQIDNO:21ChimpanzeeMetrncDNASequence 1 atggggttcccggccgcggcgctgctctgcgcgctgtgctgcggcctcctggccccggcc 61 gcccgcgccggctactccgaggagcgctgcagctggaggggcagcggcctcacccaggag 121 cctggcagcgtggggcagctggccctggcctgtgcggagggcgcggttgagtggctgtac 181 cccgctggggcgctgcgcctgaccctgggcggccccgatcccagagcgcggcccggcatc 241 gcctgtctgcggccggtgcggcccttcgcgggcgcccaggtcttcgcggagcgcgcaggg 301 ggcgccctggagctgctgctggccgagggcccgggcccggcagggggccgctgcgtgcgc 361 tggggtccccgcgagcgccgggccctcttcctgcaggccacgccgcaccgggacatcagc 421 cgccgcgtggccgccttccgctttgagctgcgcgaggacgggcgccccgagctgcccccg 481 caggcccacggtctcggcgtagacggtgcctgcaggccctgcagcgatgctgagctgctc 541 ctggccgcatgcaccagcgacttcgtaattcacgggatcatccatggggtcgcccatgac 601 gtggagctgcaggaatctgtcatcaccgtggtggccgcccgtgtcctccgccagacaccg 661 ccgctgttccaggcggggcgatccggggaccaggggctgacctccattcgtactccactg 721 cgctgtggcgtccgcccgggcccaggcaccttcctcttcatgggctggagccgcttcggg 781 gaggcctggctgggctgtgccccacgattccaggagttccgccgtgcctacgaggctgcc 841 cgtgctgcccacctccacccctgcgaggtggcgctgcactga SEQIDNO:22ChimpanzeeMetrnAminoAcidSequence(SignalPeptide:Residues1-23) 1 mgfpaaallcalccgllapaaragyseercswrgsgltqepgsvgqlalacaegavewly 61 pagalrltlggpdprarpgiaclrpvrpfagaqvfaeraggalelllaegpgpaggrcvr 121 wgprerralflqatphrdisrrvaafrfelredgrpelppqahglgvdgacrpcsdaell 181 laactsdfvihglihgvahdvelqesvitvvaarvlrqtpplfqagrsgdqgltsirtpl 241 rcgvrpgpgtflfmgwsrfgeawlgcaprfqefrrayeaaraahlhpcevalh SEQIDNO:23CowMetrncDNASequence 1 atgccgacctctgcgctgctctgcacactttgcttctgcctcttggccgcggccgctcgc 61 gccggctactcggaggaccgctgcagctggaggggcagcggcctgacccaggagcccggc 121 agcgtgggacagctcgccctggcctgtgcggacggcaagatcgagtggctgtacccggcc 181 ggggcgctgcgcctcaccctgggcggctctgagcccagcgcgcagcccggcatcgtctgc 241 ctgcggccgacgcggcccttcgcaggcgcccaagtcttcgtggagcggacgggcggcggg 301 ctagagttgctgctggccgagggccagggcccggccggggcccggtgcgcgcgctggggt 361 cctcgcgagcgccgggccctcttcctgcaggccaccccgcatcccgacctcagccgccgc 421 ttggcctccttccgcttccagctgcgggaggacgggcgtccggagctgcccccgcaggcc 481 cgcagccttggagcggatgctgcctgcagaccctgcagtgatgccgagctcctcctggcc 541 gtgtgcaccagtgactttgtgatctacggaaccatcctcggagttgcccacaacgcagag 601 ctacaggagtctgtcatcaccgtggcagctgcacgtgtcctccgccagacgctgccggtt 661 ttctgggtggggggccctgggggccaggggcaggcctccattcgcaccccactgcactgt 721 ggcgtgcgccctggccctggcaccttcctcttcatgggctggaaccgctttggtgaggcc 781 tggctgggctgtgctccccgcctccaggaattcagccgtgcctacgcggctgcccacgct 841 gaccacctgcacccctgcgaggtggtgctggactga SEQIDNO:24CowMetrnAminoAcidSequence(SignalPeptide:Residues1-21) 1 mptsallctlcfcllaaaaragysedrcswrgsgltqepgsvgq1alacadgkiewlypa 61 galrltlggsepsaqpgivclrptrpfagaqvfvertggglelllaegqgpagarcarwg 121 prerralflqatphpdlsrrlasfrfqlredgrpelppqarslgadaacrpcsdaellla 181 vctsdfviygtilgvahnaelqesvitvaaarvlrqtlpvfwvggpggqgqasirtplhc 241 gvrpgpgtflfmgwnrfgeawlgcaprlqefsrayaaahadhlhpcevvld SEQIDNO:25RatMetrncDNASequence 1 atgctggtagcggcgcttctctgcgcgctgtgctgcggcctcttggctgcgtccgctcga 61 gctggctactccgaggaccgctgcagctggaggggcagcggtttgacccaggaacctggc 121 agcgtggggcagctgaccctggattgtactgagggtgctatcgagtggctgtatccagct 181 ggggcgctgcgcctgactctaggcggctctgatccgggcacgcggcccagcatcgtctgt 241 ctgcgcccaacacggcccttcgctggtgcccaggtcttcgctgaacggatggccggcaac 301 ctagagttgctactggccgaaggccaaggcctggctgggggccgctgcatgcgctggggt 361 cctcgcgagcgccgagcccttttcctgcaggccacgccacaccgggacatcagccgcaga 421 gttgctgccttccaatttgaactgcacgaggaccaacgtgcagaaatgtctccccaggcc 481 caaggttttggtgtggatggtgcctgcaggccctgcagtgatgccgagctccttctgact 541 gcatgcaccagtgactttgtgatccatgggaccatccatggggtcgtccatgacatggag 601 ctgcaagaatcagtcatcactgtggtggccactcgtgtcatccgccagacactgccactg 661 ttccaggaagggagctcggagggccggggccaggcctccgttcgtaccttgttgcgctgt 721 ggtgtgcgtcctggcccaggctccttcctcttcatgggctggagccgatttggcgaagct 781 tggctgggctgcgctccccgcttccaagagttcagccgtgtctattcagctgctctcgcg 841 gcccacctcaacccatgtgaggtggcactggactga SEQIDNO:26RatMetrnAminoAcidSequence(SignalPeptide:Residues1-21) 1 mlvaallcalccgllaasaragysedrcswrgsgltqepgsvgqltldctegaiewlypa 61 galrltlggsdpgtrpsivclrptrpfagaqvfaermagnlelllaegqglaggrcmrwg 121 prerralflqatphrdisrrvaafqfelhedqraemspqaqgfgvdgacrpcsdaelllt 181 actsdfvihgtihgvvhdmelqesvitvvatrvirqtlplfqegssegrgqasvrtllrc 241 gvrpgpgsflfmgwsrfgeawlgcaprfqefsrvysaalaahlnpcevald SEQIDNO:27ChickenMetrncDNASequence 1 atgcgggctctgtgggcgctgtgcctcgccgggctggccgctgccctcggcagcttctcg 61 gcggatcagtgcagctggagggggagcggcttgtcgcaggaggcgggcagcgtggagcag 121 ctcaccctgcgctgcgccgagggctccctggagtggctgtaccccacgggagccctccgc 181 ctccgcttggccccccgcctgccccccgccaccaccgccgatggccgcgacccccgacac 241 gtcaccgcctgccttcagcccgccggcaccttccggggggctcagctctacctggagcgg 301 gatggggagctggagctgctgctgcccgaggcggaggcggccccgcggccccgtgtgagg 361 tgtttcagctggccaccccatgagcaggtggccctgttcctgcaggccaccccgcagcgc 421 gacatcagccgccgcatcgctgccttccgctatgagctgcggggggactggctcgcccgc 481 cctgcactgcctgccgaaggggtgtgccggccgtgcaacgacaccgagctcctgatggcc 541 atttgcactagtgactttgtggtccgcggtaccatccacagcgtctccaacgacgcagag 601 ctgcaggaatccgtcatcggggtgagtgccgtccgcatccaccgccagaaattccccctc 661 ttccaaaccggggggcggccggggagggcggtgggcagcatccgcacccctctgcgctgc 721 ggtgtgcggccgggccccggcaccttcctcttcacggggtggctgcactttggcgaggca 781 tggctcagctgcgctccccgctacaaggacttccagcgcatctacgagggcgcccggcgc 841 aggaggcagaacccctgcgagttccccgtggactga SEQIDNO:28ChickenMetrnAminoAcidSequence(SignalPeptide:Residues1-21) 1 mralwalclaglaaalgsfsadqcswrgsglsqeagsveqltlrcaegslewlyptgalr 61 lrlaprlppattadgrdprhvtaclqpagtfrgaqlylerdgelelllpeaeaaprprvr 121 cfswppheqvalflqatpqrdisrriaafryelrgdwlarpalpaegvcrpcndtellma 181 ictsdfvvrgtihsvsndaelqesvigvsavrihrqkfplfqtggrpgravgsirtplrc 241 gvrpgpgtflftgwlhfgeawlscaprykdfqriyegarrrrqnpcefpvd SEQIDNO:29ZebrafishMetrncDNASequence 1 atggagatttggggatttaggagtgttgcgctatggatttcattcctgacgggttggtcg 61 atggccagttactcagaagatcagtgcagctggagaggaagtggactttctcaggcggtg 121 aagaatgtggagcaggtttggttgaggtgtgcggagggctcggtggagtggttgtatcct 181 gctggagctttgcgtctcaccctgtcgccccgtctgccatggagtgccatggggccgggc 241 gagtccagcaggagcccggtgtcagtctgcgtcaagcctgatccacactggggtggggct 301 cagctgtatctggagcgcgatggagtcctggagcttctggtgggagatgagacctccacc 361 acacccggcccagcccatgtacgctgctttagtgccctgcccggagaacgacctgcactg 421 ttcctgcaggccacaccgcaccgggatatcagcagacgcatcgctgccttccgctacgag 481 ctgagaggggattggacggcgcagccagcagtcaacacagatccagtcagcagcgaagga 541 gcctgcagaccctgcaataacactgagatcctgatggccgtctgcactagtgactttgtg 601 gttcgaggaaacatccgctcagtgggaacagactcgaatctaaaagcagccgtgatcaaa 661 gtgagtgcgacgcgggtttaccggcagaagtttgcgttgttccctgaatctgggcgtctg 721 acgcgtttaggcgagatccgtacccctctacaatgtggcgttcgtcctggtgcaggcagt 781 ttcctcttcaccggacgcgtgcatttcggggaggcctggcttggctgcgctccaagatat 841 aaagactttctgaaggcgtacgaacaggccaaacaatccttgatgatcccctgcactctt 901 gtcaatgactga SEQIDNO:30ZebrafishMetrnAminoAcidSequence(SignalPeptide:Residues1-22) 1 meiwgfrsvalwisfltgwsmasysedqcswrgsglsqavknveqvwlrcaegsvewlyp 61 agalrltlsprlpwsamgpgessrspvsvcvkpdphwggaqlylerdgvlellvgdetst 121 tpgpahvrcfsalpgerpalflqatphrdisrriaafryelrgdwtaqpavntdpvsseg 181 acrpcnnteilmavctsdfvvrgnirsvgtdsnlkaavikvsatrvyrqkfalfpesgrl 241 trlgeirtplqcgvrpgagsflftgrvhfgeawlgcaprykdflkayeqakqslmipctl 301 vnd

(25) As used herein, obesity refers to a body mass index (BMI) of 30 kg/m.sup.2 or more (National Institute of Health, Clinical Guidelines on the Identification, Evaluation, and Treatment of Overweight and Obesity in Adults (1998)). However, the present invention is also intended to include a disease, disorder, or condition that is characterized by a body mass index (BMI) of 25 kg/m.sup.2 or more, 26 kg/m.sup.2 or more, 27 kg/m.sup.2 or more, 28 kg/m.sup.2 or more, 29 kg/m.sup.2 or more, 29.5 kg/m.sup.2 g, m.sup.2 Of more, or 29.9 kg/m.sup.2 or more, all of which are typically referred to as overweight (National Institute of Health, Clinical Guidelines on the Identification, Evaluation, and Treatment of Overweight and Obesity in Adults (1998)). The obesity described herein may be due to any cause, whether genetic or environmental. Examples of disorders that may result in obesity or be the cause of obesity include overeating and bulimia, polycystic ovarian disease, craniopharyngioma, the Prader-Willi Syndrome, Frohlich's syndrome, Type II diabetics, GH-deficient subjects, normal variant short stature, Turner's syndrome, and other pathological conditions showing reduced metabolic activity or a decrease in resting energy expenditure as a percentage of total fat-free mass, e.g., children with acute lymphoblastic leukemia.

(26) An overexpression or significantly higher level of expression, activity, copy number, and the like, of a marker (e.g., Metrnl, Metrn, or downstream signaling marker thereof) refers to an expression level or copy number in a test sample that is greater than the standard error of the assay employed to assess expression or copy number, but is preferably at least 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5 and more preferably three, four, five or ten or more times greater than the expression, activity, copy number, and the like, of the marker in a control sample (e.g., sample from a healthy subject not afflicted with a metabolic disorder and/or muscle inflammation) and preferably, the average expression level or copy number of the marker in several control samples.

(27) The term sample used for detecting or determining the presence or level of at least one biomarker is typically whole blood, plasma, serum, saliva, urine, stool (e.g., feces), tears, and any other bodily fluid (e.g., as described above under the definition of body fluids), or a tissue sample (e.g., biopsy) such as muscle or adipose tissue sample. In certain instances, the method of the present invention further comprises obtaining the sample from the individual prior to detecting or determining the presence or level of at least one marker in the sample.

(28) The term small molecule is a term of the art and includes molecules that are less than about 1000 molecular weight or less than about 500 molecular weight. In one embodiment, small molecules do not exclusively comprise peptide bonds. In another embodiment, small molecules are not oligomeric. Exemplary small molecule compounds which can be screened for activity include, but are not limited to, peptides, peptidomimetics, nucleic acids, carbohydrates, small organic molecules (e.g., polyketides) (Cane et al. 1998. Science 282:63), and natural product extract libraries. In another embodiment, the compounds are small, organic non-peptidic compounds. In a further embodiment, a small molecule is not biosynthetic.

(29) The term subject refers to any healthy animal, mammal or human, or any animal, mammal or human afflicted with a condition of interest (e.g., metabolic disorder and/or muscle inflammation). The term subject is interchangeable with patient.

(30) An underexpression or significantly lower level of expression, activity, copy number, and the like, of a marker (e.g., Metrnl, Metrn, or downstream signaling marker thereof) refers to an expression level or copy number in a test sample that is greater than the standard error of the assay employed to assess expression or copy number, but is preferably at least 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5 and more preferably three, four, five or ten or more times less than the expression, activity, copy number, and the like, of the marker in a control sample (e.g., sample from a healthy subject not afflicted with a metabolic disorder and/or muscle inflammation) and preferably, the average expression level or copy number of the marker in several control samples.

(31) It will be appreciated that specific sequence identifiers (SEQ ID NOs) have been referenced throughout the specification for purposes of illustration and should therefore not be construed to be limiting. Any marker of the invention, including, but not limited to, the markers described in the specification and markers described herein (e.g., TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3), are well known in the art and can be used in the embodiments of the invention as listed, for example, in Table 2.

(32) TABLE-US-00002 TABLE 2 Gene GenBank Gene GenBank Protein Symbol Gene Name Accession Number Accession Number Gene ID TNF- Tumor necrosis factor e.g., NM_013693.2 e.g., NP_038721.1 and e.g., 21926 and and NP_000585.2 7124 NM_000594.3 IL-6 Interleukin 6 e.g., NM_031168.1 e.g., NP_112445.1 and e.g., 16193 and and NM_000600.3 NP_000591.1 3569 IL- Interleukin 1 beta e.g., NM_008361.3 e.g., NP_032387.1 and e.g., 16176 and and NP_000567.1 3553 NM_000576.2 IL-10 Interleukin 10 e.g., NM_010548.2 e.g., NP_034678.1 and e.g., 16153 and and NM_000572.2 NP_000563.1 3586 TGF- Transforming growth e.g., NM_011577.1 e.g., NP_035707.1 and e.g., 21803 and factor, beta 1 and NP_000651.3 7040 NM_000660.4 pgc1 peroxisome e.g., NM_133249.2 e.g., NP_573512.1 and e.g., 170826 and proliferative activated and NP_001166169.1 and 133522 receptor, gamma, NM_001172698.1 and NP_001166170.1 and coactivator 1 beta NM_001172699.1 and NP_573570.3 and NM_133263.3 and err- estrogen related e.g., NM_007953.2 e.g., NP_031979.2 and e.g., 26379 and receptor, alpha and NM_004451.3 NP_004442.3 2101 bmp8b bone morphogenetic e.g., NM_007559.4 e.g., NP_031585.2 and e.g., 12164 and protein 8b and NM_001720.3 NP_001711.2 656 adipsin complement factor D e.g., NM_013459.2 e.g., NP_038487.1 and e.g., 11537 and and NM_001928.2 NP_001919.2 1675 fatty acid fatty acid e.g., NM_007643.3 e.g., NP_031669.2 and e.g., 12491 and transporter transporter/cd36 and NM_000072.3 and NP_000063.2 and 948 cd36 NM_001001547.2 and NP_001001547.1 and NM_001001548.2 and NP_001001548.1 and NM_001127443.1 and NP_001120915.1 and NM_001127444.1 NP_001120916.1 adiponectin adiponectin e.g., NM_009605.4 e.g., NP_0033735.3 e.g., 11450 and and NM_004797.2 and NP_004788.1 9370 UCP-1 uncoupling protein 1 e.g., NM_009463.3 e.g., NP_033489.1 and e.g., 22227 and and NM_021833.4 NP_068605.1 7350 cidea cell death-inducing e.g., NM_007702.2 e.g., NP_031728.1 and e.g., 12683 and DFFA-like effector a and NM_001279.3 and NP_001270.1 and 1149 NM_198289.2 NP_938031.1 PGC1a Peroxisome e.g., NM_008904.2 e.g., NP_032930.1 and e.g., 19017 and (i.e., proliferative activated and NM_013261.3 NP_037393.1 10891 PGC11) receptor, gamma, coactivator 1 alpha Elovl3 elongation of very e.g., NM_007703.2 e.g., NP_031729.1 and e.g., 12686 and long chain fatty acids and NM_152310.1 NP_689523.1 83401 (FEN1/Elo2, SUR4/Elo3, yeast)- like 3 C/EBPbeta CCAAT/enhancer e.g., NM_009883.3 e.g., NP_034013.1 and e.g., 12608 and binding protein beta and NM_005194.2 NP_005185.2 1051 Cox7a1 cytochrome c oxidase e.g., NM_009944.3 e.g., NP_034074.1 and e.g., 12865 and subunit VIIa and NM_001864.2 NP_001855.1 1346 polypeptide 1 Otopetrin Otopetrin 1 e.g., NM_172709.3 e.g., NP_766297.2 and e.g., 21906 and and NM_177998.1 NP_819056.1 133060 Type II Deiodinase, e.g., NM_010050.2 e.g., NP_034180.1 and e.g., 13371 and deiodinase iodothyronine, type H and NM_000793.4 and NP_000784.2 and 1734 NM_001007023.2 and NP_001007024.1 and NM_013989.3 NP_054644.1 cytochrome cytochrome c e.g., NM_009989.2 e.g., NP_034119.1 and e.g., 13067 and C and NM_018947.4 NP_061820.1 54205 cox4i1 cytochrome c oxidase e.g., NM_009941.2 e.g., NP_034071.1 and e.g., 12857 and subunit IV isoform 1 and NM_001861.2 NP_001852.1 1327 coxIII mitochondrially e.g., NC_005089.1 e.g., NP_904334.1 and e.g., 17705 and encoded cytochrome c and ENSP00000354982 4514 oxidase III ENST00000362079 cox5b cytochrome c oxidase e.g., NM_009942.2 e.g., NP_034072.2 and e.g., 12859and subunit Vb and NM_001862.2 NP_001853.2 1329 cox8b cytochrome c oxidase e.g., NM_007751.3 e.g., NP_031777.1 e.g., 12869 and subunit 8B, 404544 mitochondrial precursor glut4 solute carrier family 2 e.g., NM_009204.2 e.g., NP_033230.2 and e.g., 20528 and (facilitated glucose and NM_001042.2 NP_001033.1 6517 transporter), member 4 atpase b2 ATPase, H+ e.g., NM_057213.2 e.g., NP_476561.1 and e.g., 117596 and transportying, and NM_001693.3 NP_001684.2 526 lysosomal 56/58 kDa, V1 subunit B2 coxII mitochondrially e.g., NC_005089.1 e.g., NP_904331 and e.g., 17709 and encoded cytochrome c and ENSP00000354876 4513 oxidase II ENST00000361739 atp5o ATP synthase, H+ e.g., NM_138597.2 e.g., NP_613063.1 and e.g., 28080 and transporting, and NM_001697.2 NP_001688.1 539 mitochondrial F1 complex, O subunit ndufb5 NADH dehydrogenase e.g., NM_025316.2 e.g., NP_079592.2 and e.g., 66046 and (ubiquinone) 1 beta and NM_002492.2 NP_002483.1 4711 subcomplex, 5, 16 kDa Rarres2 retinoic acid receptor e.g., NM_027852.2 e.g., NP_082128.1 and e.g., 71660 and responder (tazarotene and NM_002889.3 NP_002880.1 5919 induced) 2 Car3 carbonic anhydrase 3 e.g., NM_007606.3 e.g., NP_031632.2 and e.g., 12350 and and NM_005181.3 NP_005172.1 761 Peg 10 paternally expressed e.g., e.g., NP_001035701.1 e.g., 170676 and 10 NM_001040611.1 and and NP_001035242.1 23089 NM_001040152.1 and and NP_001165908.1 NM_001172437.1 and and NP_001165909.1 NM_001172438.1 and and NP_055883.2 NM_015068.3 Cidec Cidec cell death- e.g., NM_178373.3 e.g., NP_848460.1 and e.g., 14311 and inducing DFFA-like and NM_022094.2 NP_071377.2 63924 effector c Cd24a CD24a antigen e.g., NM_009846.2 e.g., NP_033976.1 and e.g., 12484 and and NM_013230.2 NP_037362.1 100133941 Nr1d2 nuclear receptor e.g., NM_011584.4 e.g., NP_035714.3 and e.g., 353187 and subfamily 1, group D, and NM_001145425.1 NP_001138897.1 and 9975 member 2 and NM_005126.4 NP_005117.3 Ddx17 DEAD (Asp-Glu-Ala- e.g., e.g., NP_001035277.1 e.g., 67040 and Asp) box polypeptide NM_001040187.1 and and NP_001091974.1 10521 17 NM_001098504.1 and and NP_001091975.1 NM_001098505.1 and and NP_006377.2 and NM_006386.4 and NP_112020.1 NM_030881.3 Aplp2 amyloid beta (A4) e.g., e.g., NP_001095925.1 e.g., 11804 and precursor-like protein NM_001102455.1 and and NP_001135748.1 334 2 NM_001142276.1 and and NP_001135749.1 NM_001142277.1 and and NP_001135750.1 NM_001142278.1 and and NP_001633.1 NM_001642.2 Nr3c1 nuclear receptor e.g., NM_008173.3 e.g., NP_032199.3 and e.g., 14815 and subfamily 3, group C, and NM_000176.2 and NP_000167.1 and 2908 member 1 NM_001018074.1 and NP_001018084.1 and NM_001018075.1 and NP_001018085.1 and NM_001018076.1 and NP_001018086.1 and NM_001018077.1 and NP_001018087.1 and NM_001020825.1 and NP_001018661.1 and NM_001024094.1 NP_001019265.1 Rybp RING1 and YY1 e.g., NM_019743.3 e.g., NP_062717.2 and e.g., 56353 and binding protein and NM_012234.4 NP_036366.3 23429 Txnip thioredoxin interacting e.g., e.g., NP_001009935.1 e.g., 56338 and protein NM_001009935.2 and and NP_006463.3 10628 NM_006472.3 Cig30 Elongation of very e.g., e.g., NP_689523.1 and e.g., 83401 and long chain fatty acids- NM_152310.1 and N NP_031729.1.sup.1 12686 like 3 M 007703.1.sup.1 Ppar Peroxisome e.g., NM_015869.4 e.g., NP_056953 and e.g., 5468 and gamma 2 proliferator-activated and NM_011146.2.sup.1 NP_035276.1.sup.1 19016 receptor gamma 2 Prdm16 PR domain containing e.g., NM_022114.3 e.g., NP_071397.3 and e.g., 63976 and 16 protein and NM_199454.2 and NP_955533.2 and 70673 NM_027504.3 NP_081780.3 Apt Fatty acid binding e.g., NM_001442.2 e.g., NP_001433.1 and e.g., 2167 and protein 4 and NM_024406.1 NP_077717.1 11770 Ndufs2 NADH dehydrogenase e.g., e.g., NP_001159631.1 e.g., 4720 and (ubiquinone) Fe-S NM_001166159.1 and and NP_004541.1 and 226646 protein 2, 49 kDa NM_004550.4 and NP_694704.1 (NADH-coenzyme Q NM_153064.4 reductase Grp109A Hydroxycarboxylic e.g., NM_177551 and e.g., NP_808219 and e.g., 338442 and acid receptor 2 NM_030701.3 NP_109626.1 80885 AcylCoA- Acyl-coenzyme A e.g., NM_152331 and e.g., NP_689544 and e.g., 122970 and thioesterase thioesterase 4 NM_134247.3 NP_599008.3 171282 4 Claudin1 Claudin1 e.g., NM_021101.4 e.g., NP_066924.1 and e.g., 9076 and and NM_016674.4 NP_057883.1 12737 PEPCK Phosphoenolpyruvate e.g., e.g., NP_001018083.1 e.g., 5106 and carboxykinase NM_001018073.1 and and NP_004554.2 and 74551 (mitochondrial) NM_004563.2 and NP_083270.1 NM_028994.2 Fgf21 Fibroblast growth e.g., NM_019113 and e.g., NP_061986 and e.g., 26291 and factor 21 NM_020013.4 NP_064397.1 56636 AcyCoA- Acyl-coenzyme A e.g., e.g., NP_001032238.1 e.g., 641371 and thioesterase thioesterase 4 NM_001037161.1 and and NP_599007.1 171281 3 NM_134246.3 Dio2 Type II iodothyronine e.g., NM_00793.5 and e.g., NP_000784.2 and e.g., 1734 and deiodinase NM_010050.2 NP_034180.1 13371
I. Isolated Nucleic Acids

(33) One aspect of the invention pertains to methods utilizing isolated nucleic acid molecules that encode Metrnl, Metrn, or biologically active portions thereof. As used herein, the term nucleic acid molecule is intended to include DNA molecules (i.e., cDNA or genomic DNA) and RNA molecules (i.e., mRNA) and analogs of the DNA or RNA generated using nucleotide analogs. The nucleic acid molecule can be single-stranded or double-stranded, but preferably is double-stranded DNA. An isolated nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid. Preferably, an isolated nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5 and 3 ends of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated Metrnl and/or Metrn nucleic acid molecule can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell from which the nucleic acid is derived (e.g., a muscle cell). Moreover, an isolated nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized.

(34) A nucleic acid molecule of the present invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or a nucleotide sequence which is at least about 50%, preferably at least about 60%, more preferably at least about 70%, yet more preferably at least about 80%, still more preferably at least about 90%, and most preferably at least about 95% or more (e.g., about 98%) homologous to the nucleotide sequence shown in SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or a portion thereof (i.e., 100, 200, 300, 400, 450, 500, or more nucleotides), can be isolated using standard molecular biology techniques and the sequence information provided herein. For example, a human Metrnl or Metrn cDNA can be isolated from a human muscle cell line (from Stratagene, La Jolla, Calif., or Clontech, Palo Alto, Calif.) using all or portion of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, as a hybridization probe and standard hybridization techniques (i.e., as described in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989). Moreover, a nucleic acid molecule encompassing all or a portion of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or a nucleotide sequence which is at least about 50%, preferably at least about 60%, more preferably at least about 70%, yet more preferably at least about 80%, still more preferably at least about 90%, and most preferably at least about 95% or more homologous to the nucleotide sequence shown in SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, can be isolated by the polymerase chain reaction using oligonucleotide primers designed based upon the sequence of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, or the homologous nucleotide sequence. For example, mRNA can be isolated from muscle cells (i.e., by the guanidinium-thiocyanate extraction procedure of Chirgwin et al. (1979) Biochemistry 18: 5294-5299) and cDNA can be prepared using reverse transcriptase (i.e., Moloney MLV reverse transcriptase, available from Gibco/BRL, Bethesda, Md.; or AMV reverse transcriptase, available from Seikagaku America, Inc., St. Petersburg, Fla.). Synthetic oligonucleotide primers for PCR amplification can be designed based upon the nucleotide sequence shown in SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, or to the homologous nucleotide sequence. A nucleic acid of the invention can be amplified using cDNA or, alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to an Metrnl and/or Metrn nucleotide sequence can be prepared by standard synthetic techniques, i.e., using an automated DNA synthesizer.

(35) Probes based on the Metrnl and/or Metrn nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In preferred embodiments, the probe further comprises a label group attached thereto, i.e., the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissue which express an Metrnl and/or Metrn protein, such as by measuring a level of an Metrnl-encoding and/or Metrn-encoding nucleic acid in a sample of cells from a subject, i.e., detecting Metrnl and/or Metrn mRNA levels.

(36) Nucleic acid molecules encoding other Metrnl and/or Metrn members and thus which have a nucleotide sequence which differs from the Metrnl and/or Metrn sequences of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, are contemplated. Moreover, nucleic acid molecules encoding Metrnl and/or Metrn proteins from different species, and thus which have a nucleotide sequence which differs from the Metrnl sequences of SEQ ID NOs: 1, 3 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29 are also intended to be within the scope of the present invention. For example, chimpanzee or monkey Metrnl and/or Metrn cDNA can be identified based on the nucleotide sequence of a human and/or mouse Metrnl and/or Metrn, respectively.

(37) In one embodiment, the nucleic acid molecule(s) of the invention encodes a protein or portion thereof which includes an amino acid sequence which is sufficiently homologous to an amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, such that the protein or portion thereof modulates (e.g., enhance), one or more of the following biological activities: 1) it can modulate the expression of TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3; 2) it can increase cellular respiration (i.e., total and uncoupled respiration); 3) it can increase thermogenesis of adipose cells; 4) it can increase insulin sensitivity of adipose, muscle and/or hepatic cells; 5) it can decrease hepatosteatosis, obesity, type II diabetes, and/or appetite; 6) it can increase insulin secretion of pancreatic beta cells; 7) it can increase cardiac function to combat cardiac hypertrophy; 8) it can improve muscle hypoplasia; 9) it can reduce the growth and effects of obesity-associated cancer, cachexia, and anorexia; 10) it can treat diseases or disorders characterized by increased PGC-1 expression or activity, e.g., diabetes or obesity; and 11) it can inhibit inflammation of muscle tissue.

(38) Methods and assays for measuring each such biological activity are well-known in the art and representative, non-limiting embodiments are described in the Examples below. For example, evaluating the effect of various chemical agents on animal models of muscular dystrophy can be achieved by injecting mdx mice with an agent and evaluating therapeutic effects by comparing the morphological results between 3 regions of the triangularis sterni (TS); the caudal third of the muscle extending toward the xiphoid process, the middle third, and the cephalad third of the muscle since obvious differences between these regions exist in the extent of pathology and the muscle thickness in the TS of mdx mice. In another representative example, assays useful in measuring total mitochondrial oxygen consumption, uncoupled respiration, and total respiration are well known in the art, as described in St-Pierre et al. (2003) J. Biol. Chem. 278: 26597-26603.

(39) As used herein, the language sufficiently homologous refers to proteins or portions thereof which have amino acid sequences which include a minimum number of identical or equivalent (e.g., an amino acid residue which has a similar side chain as an amino acid residue in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof) amino acid residues to an amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, such that the protein or portion thereof modulates (e.g., enhance) one or more of the following biological activities: 1) it can modulate the expression of TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3; 2) it can increase cellular respiration (i.e., total and uncoupled respiration); 3) it can increase thermogenesis of adipose cells; 4) it can increase insulin sensitivity of adipose, muscle and/or hepatic cells; 5) it can decrease hepatosteatosis, obesity, type II diabetes, and/or appetite; 6) it can increase insulin secretion of pancreatic beta cells; 7) it can increase cardiac function to combat cardiac hypertrophy; 8) it can improve muscle hypoplasia; 9) it can reduce the growth and effects of obesity-associated cancer, cachexia, and anorexia; 10) it can treat diseases or disorders characterized by increased PGC-1 expression or activity, e.g., diabetes or obesity; and 11) it can inhibit inflammation of muscle tissue.

(40) In another embodiment, the protein is at least about 50%, preferably at least about 60%, more preferably at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to the entire amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, or a fragment thereof.

(41) Portions of proteins encoded by the Metrnl and/or Metrn nucleic acid molecule of the invention are preferably biologically active portions of the Metrnl and/or Metrn protein. As used herein, the term biologically active portion of Metrnl and/or Metrn is intended to include a portion, e.g., a domain/motif, of Metrnl and/or Metrn that has one or more of the biological activities of the full-length Metrnl and/or Metrn protein, respectively.

(42) Standard binding assays, e.g., immunoprecipitations and yeast two-hybrid assays, as described herein, or functional assays, e.g., RNAi or overexpression experiments, can be performed to determine the ability of an Metrnl and/or Metrn protein or a biologically active fragment thereof to maintain a biological activity of the full-length Metrnl and/or Metrn protein.

(43) The invention further encompasses nucleic acid molecules that differ from the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof due to degeneracy of the genetic code and thus encode the same Metrnl and/or Metrn protein as that encoded by the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, for fragment thereof. In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, or fragment thereof, or a protein having an amino acid sequence which is at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, or a fragment thereof, or differs by at least 1, 2, 3, 5 or 10 amino acids but not more than 30, 20, 15 amino acids from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30. In another embodiment, a nucleic acid encoding an Metrnl and/or Metrn polypeptide consists of nucleic acid sequence encoding a portion of a full-length Metrnl and/or Metrn fragment of interest that is less than 195, 190, 185, 180, 175, 170, 165, 160, 155, 150, 145, 140, 135, 130, 125, 120, 115, 110, 105, 100, 95, 90, 85, 80, 75, or 70 amino acids in length.

(44) It will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences of Metrnl and/or Metrn may exist within a population (e.g., a mammalian population, e.g., a human population). Such genetic polymorphism in the Metrnl and/or Metrn gene may exist among individuals within a population due to natural allelic variation. As used herein, the terms gene and recombinant gene refer to nucleic acid molecules comprising an open reading frame encoding an Metrnl and/or Metrn protein, preferably a mammalian, e.g., human, Metrnl and/or Metrn protein. Such natural allelic variations can typically result in 1-5% variance in the nucleotide sequence of the Metrnl and/or Metrn gene. Any and all such nucleotide variations and resulting amino acid polymorphisms in Metrnl and/or Metrn that are the result of natural allelic variation and that do not alter the functional activity of Metrnl and/or Metrn are intended to be within the scope of the invention. Moreover, nucleic acid molecules encoding Metrnl and/or Metrn proteins from other species, and thus which have a nucleotide sequence which differs from the human or mouse sequences of SEQ ID NO: 1, 3, 5, 7, 15, 17, or 19, are intended to be within the scope of the invention. Nucleic acid molecules corresponding to natural allelic variants and homologues of the human or mouse Metrnl and/or Metrn cDNAs of the invention can be isolated based on their homology to the human or mouse Metrnl and/or Metrn nucleic acid sequences disclosed herein using the human or mouse cDNA, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions (as described herein).

(45) In addition to naturally-occurring allelic variants of the Metrnl and/or Metrn sequence that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, thereby leading to changes in the amino acid sequence of the encoded Metrnl and/or Metrn protein, without altering the functional ability of the Metrnl and/or Metrn protein. For example, nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues can be made in the sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof. A non-essential amino acid residue is a residue that can be altered from the wild-type sequence of Metrnl and/or Metrn (e.g., the sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof) without significantly altering the activity of Metrnl and/or Metrn, whereas an essential amino acid residue is required for Metrnl and/or Metrn activity. Other amino acid residues, however, (e.g., those that are not conserved or only semi-conserved between mouse and human) may not be essential for activity and thus are likely to be amenable to alteration without altering Metrnl and/or Metrn activity. Furthermore, amino acid residues that are essential for Metrnl and/or Metrn functions related to thermogenesis and/or adipogenesis, but not essential for Metrnl and/or Metrn functions related to gluconeogenesis, are likely to be amenable to alteration.

(46) Accordingly, another aspect of the invention pertains to nucleic acid molecules encoding Metrnl and/or Metrn proteins that contain changes in amino acid residues that are not essential for Metrnl and/or Metrn activity. Such Metrnl and/or Metrn proteins differ in amino acid sequence from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, yet retain at least one of the Metrnl and/or Metrn activities described herein. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein lacks one or more Metrnl and/or Metrn domains (e.g., a signal peptide).

(47) Sequence identity or homology, as used herein, refers to the sequence similarity between two polypeptide molecules or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous or sequence identical at that position. The percent of homology or sequence identity between two sequences is a function of the number of matching or homologous identical positions shared by the two sequences divided by the number of positions compared100. For example, if 6 of 10, of the positions in two sequences are the same then the two sequences are 60% homologous or have 60% sequence identity. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology or sequence identity. Generally, a comparison is made when two sequences are aligned to give maximum homology. Unless otherwise specified loop out regions, e.g., those arising from, from deletions or insertions in one of the sequences are counted as mismatches.

(48) The comparison of sequences and determination of percent homology between two sequences can be accomplished using a mathematical algorithm.

(49) Preferably, the alignment can be performed using the Clustal Method. Multiple alignment parameters include GAP Penalty=10, Gap Length Penalty=10. For DNA alignments, the pairwise alignment parameters can be Htuple=2, Gap penalty=5, Window=4, and Diagonal saved=4. For protein alignments, the pairwise alignment parameters can be Ktuple=1, Gap penalty=3, Window=5, and Diagonals Saved=5.

(50) In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available online), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available online), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. In another embodiment, the percent identity between two amino acid or nucleotide sequences is determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0) (available online), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.

(51) An isolated nucleic acid molecule encoding a Metrnl and/or Metrn protein homologous to the protein of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, or a homologous nucleotide sequence such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations can be introduced into SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, or the homologous nucleotide sequence by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), bet217-420ranched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid residue in Metrnl and/or Metrn is preferably replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of a Metrnl and/or Metrn coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for a Metrnl and/or Metrn activity described herein to identify mutants that retain Metrnl and/or Metrn activity. Following mutagenesis of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, the encoded protein can be expressed recombinantly (as described herein) and the activity of the protein can be determined using, for example, assays described herein.

(52) Metrnl and/or Metrn levels may be assessed by any of a wide variety of well-known methods for detecting expression of a transcribed molecule or protein. Non-limiting examples of such methods include immunological methods for detection of proteins, protein purification methods, protein function or activity assays, nucleic acid hybridization methods, nucleic acid reverse transcription methods, and nucleic acid amplification methods.

(53) In preferred embodiments, Metrnl and/or Metrn levels are ascertained by measuring gene transcript (e.g., mRNA), by a measure of the quantity of translated protein, or by a measure of gene product activity. Expression levels can be monitored in a variety of ways, including by detecting mRNA levels, protein levels, or protein activity, any of which can be measured using standard techniques. Detection can involve quantification of the level of gene expression (e.g., genomic DNA, cDNA, mRNA, protein, or enzyme activity), or, alternatively, can be a qualitative assessment of the level of gene expression, in particular in comparison with a control level. The type of level being detected will be clear from the context.

(54) In a particular embodiment, the Metrnl and/or Metrn mRNA expression level can be determined both by in situ and by in vitro formats in a biological sample using methods known in the art. The term biological sample is intended to include tissues, cells, biological fluids and isolates thereof, isolated from a subject, as well as tissues, cells and fluids present within a subject. Many expression detection methods use isolated RNA. For in vitro methods, any RNA isolation technique that does not select against the isolation of mRNA can be utilized for the purification of RNA from cells (see, e.g., Ausubel et al., ed., Current Protocols in Molecular Biology, John Wiley & Sons, New York 1987-1999). Additionally, large numbers of tissue samples can readily be processed using techniques well known to those of skill in the art, such as, for example, the single-step RNA isolation process of Chomczynski (1989, U.S. Pat. No. 4,843,155).

(55) The isolated mRNA can be used in hybridization or amplification assays that include, but are not limited to, Southern or Northern analyses, polymerase chain reaction analyses and probe arrays. One preferred diagnostic method for the detection of mRNA levels involves contacting the isolated mRNA with a nucleic acid molecule (probe) that can hybridize to the mRNA encoded by the gene being detected. The nucleic acid probe can be, for example, a full-length cDNA, or a portion thereof, such as an oligonucleotide of at least 7, 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to a mRNA or genomic DNA encoding Metrnl and/or Metrn. Other suitable probes for use in the diagnostic assays of the invention are described herein. Hybridization of an mRNA with the probe indicates that Metrnl and/or Metrn is being expressed.

(56) In one format, the mRNA is immobilized on a solid surface and contacted with a probe, for example by running the isolated mRNA on an agarose gel and transferring the mRNA from the gel to a membrane, such as nitrocellulose. In an alternative format, the probe(s) are immobilized on a solid surface and the mRNA is contacted with the probe(s), for example, in a gene chip array, e.g., an Affymetrix gene chip array. A skilled artisan can readily adapt known mRNA detection methods for use in detecting the level of the Metrnl and/or Metrn mRNA expression levels.

(57) An alternative method for determining the Metrnl and/or Metrn mRNA expression level in a sample involves the process of nucleic acid amplification, e.g., by rtPCR (the experimental embodiment set forth in Mullis, 1987, U.S. Pat. No. 4,683,202), ligase chain reaction (Barany, 1991, Proc. Natl. Acad. Sci. USA, 88:189-193), self-sustained sequence replication (Guatelli et al., 1990, Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh et al., 1989, Proc. Natl. Acad. Sci. USA 86:1173-1177), Q-Beta Replicase (Lizardi et al., 1988, Bio/Technology 6:1197), rolling circle replication (Lizardi et al., U.S. Pat. No. 5,854,033) or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well-known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers. As used herein, amplification primers are defined as being a pair of nucleic acid molecules that can anneal to 5 or 3 regions of a gene (plus and minus strands, respectively, or vice-versa) and contain a short region in between. In general, amplification primers are from about 10 to 30 nucleotides in length and flank a region from about 50 to 200 nucleotides in length. Under appropriate conditions and with appropriate reagents, such primers permit the amplification of a nucleic acid molecule comprising the nucleotide sequence flanked by the primers.

(58) For in situ methods, mRNA does not need to be isolated from the cells prior to detection. In such methods, a cell or tissue sample is prepared/processed using known histological methods. The sample is then immobilized on a support, typically a glass slide, and then contacted with a probe that can hybridize to the Metrnl and/or Metrn mRNA.

(59) As an alternative to making determinations based on the absolute Metrnl and/or Metrn expression level, determinations may be based on the normalized Metrnl and/or Metrn expression level. Expression levels are normalized by correcting the absolute Metrnl and/or Metrn expression level by comparing its expression to the expression of a non-Metrnl and/or non-Metrn gene, e.g., a housekeeping gene that is constitutively expressed. Suitable genes for normalization include housekeeping genes such as the actin gene, or epithelial cell-specific genes. This normalization allows the comparison of the expression level in one sample, e.g., a subject sample, to another sample, e.g., a normal sample, or between samples from different sources.

(60) The level or activity of a Metrnl and/or Metrn protein can also be detected and/or quantified by detecting or quantifying the expressed polypeptide. The Metrnl and/or Metrn polypeptide can be detected and quantified by any of a number of means well known to those of skill in the art. These may include analytic biochemical methods such as electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, and the like, or various immunological methods such as fluid or gel precipitin reactions, immunodiffusion (single or double), immunoelectrophoresis, radioimmunoassay (RIA), enzyme-linked immunosorbent assays (ELISAs), immunofluorescent assays, Western blotting, and the like. A skilled artisan can readily adapt known protein/antibody detection methods for use in determining whether cells express Metrnl and/or Metrn.

(61) In addition to the nucleic acid molecules encoding Metrnl and/or Metrn proteins described above, another aspect of the invention pertains to isolated nucleic acid molecules which are antisense thereto. An antisense nucleic acid comprises a nucleotide sequence which is complementary to a sense nucleic acid encoding a protein, i.e., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence. Accordingly, an antisense nucleic acid can hydrogen bond to a sense nucleic acid. The antisense nucleic acid can be complementary to an entire Metrnl and/or Metrn coding strand, or to only a portion thereof. In one embodiment, an antisense nucleic acid molecule is antisense to a coding region of the coding strand of a nucleotide sequence encoding Metrnl and/or Metrn. The term coding region refers to the region of the nucleotide sequence comprising codons which are translated into amino acid residues. In another embodiment, the antisense nucleic acid molecule is antisense to a noncoding region of the coding strand of a nucleotide sequence encoding Metrnl and/or Metrn. The term noncoding region refers to 5 and 3 sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5 and 3 untranslated regions).

(62) In some embodiments, Metrnl and/or Metrn expression can be reduced using nucleic acid compositions described herein. For example, an RNA interfering agent, as used herein, is defined as any agent which interferes with or inhibits expression of a target gene, e.g., Metrnl and/or Metrn, by RNA interference (RNAi). Such RNA interfering agents include, but are not limited to, nucleic acid molecules including RNA molecules which are homologous to the target gene or a fragment thereof, short interfering RNA (siRNA), and small molecules which interfere with or inhibit expression of a target gene by RNA interference (RNAi).

(63) RNA interference (RNAi) is an evolutionally conserved process whereby the expression or introduction of RNA of a sequence that is identical or highly similar to a target gene results in the sequence specific degradation or specific post-transcriptional gene silencing (PTGS) of messenger RNA (mRNA) transcribed from that targeted gene (see Coburn, G. and Cullen, B. (2002) J. of Virology 76(18):9225), thereby inhibiting expression of the target gene. In one embodiment, the RNA is double stranded RNA (dsRNA). This process has been described in plants, invertebrates, and mammalian cells. In nature, RNAi is initiated by the dsRNA-specific endonuclease Dicer, which promotes processive cleavage of long dsRNA into double-stranded fragments termed siRNAs. siRNAs are incorporated into a protein complex that recognizes and cleaves target mRNAs. RNAi can also be initiated by introducing nucleic acid molecules, e.g., synthetic siRNAs or RNA interfering agents, to inhibit or silence the expression of target genes. As used herein, inhibition of target gene expression or inhibition of marker gene expression includes any decrease in expression or protein activity or level of the target gene or protein encoded by the target gene. The decrease may be of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more as compared to the expression of a target gene or the activity or level of the protein encoded by a target gene which has not been targeted by an RNA interfering agent.

(64) Short interfering RNA (siRNA), also referred to herein as small interfering RNA is defined as an agent which functions to inhibit expression of a target gene, e.g., by RNAi. An siRNA may be chemically synthesized, may be produced by in vitro transcription, or may be produced within a host cell. In one embodiment, siRNA is a double stranded RNA (dsRNA) molecule of about 15 to about 40 nucleotides in length, preferably about 15 to about 28 nucleotides, more preferably about 19 to about 25 nucleotides in length, and more preferably about 19, 20, 21, or 22 nucleotides in length, and may contain a 3 and/or 5 overhang on each strand having a length of about 0, 1, 2, 3, 4, or 5 nucleotides. The length of the overhang is independent between the two strands, i.e., the length of the overhang on one strand is not dependent on the length of the overhang on the second strand. Preferably the siRNA is capable of promoting RNA interference through degradation or specific post-transcriptional gene silencing (PTGS) of the target messenger RNA (mRNA).

(65) In another embodiment, an siRNA is a small hairpin (also called stem loop) RNA (shRNA). In one embodiment, these shRNAs are composed of a short (e.g., 19-25 nucleotide) antisense strand, followed by a 5-9 nucleotide loop, and the analogous sense strand. Alternatively, the sense strand may precede the nucleotide loop structure and the antisense strand may follow. These shRNAs may be contained in plasmids, retroviruses, and lentiviruses and expressed from, for example, the pol III U6 promoter, or another promoter (see, e.g., Stewart, et al. (2003) RNA April; 9(4):493-501 incorporated by reference herein).

(66) RNA interfering agents, e.g., siRNA molecules, may be administered to a subject having or at risk for a condition described herein mediated by Metrnl and/or Metrn, to inhibit expression of Metrnl and/or Metrn to thereby treat, prevent, or inhibit the condition in the subject.

(67) II. Recombinant Expression Vectors and Host Cells

(68) Another aspect of the invention pertains to the use of vectors, preferably expression vectors, containing a nucleic acid encoding Metrnl and/or Metrn (or a portion thereof). As used herein, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as expression vectors. In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, plasmid and vector can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions. In one embodiment, adenoviral vectors comprising a Metrnl and/or Metrn nucleic acid molecule are used.

(69) The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operatively linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, operably linked is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner which allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). The term regulatory sequence is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those which direct constitutive expression of a nucleotide sequence in many types of host cell and those which direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.

(70) The recombinant expression vectors of the invention can be designed for expression of Metrnl and/or Metrn in prokaryotic or eukaryotic cells. For example, Metrnl and/or Metrn can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.

(71) Expression of proteins in prokaryotes is most often carried out in E. coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fusion vectors typically serve three purposes: 1) to increase expression of recombinant protein; 2) to increase the solubility of the recombinant protein; and 3) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith, D. B. and Johnson, K. S. (1988) Gene 67:31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein. In one embodiment, the coding sequence of the Metrnl and/or Metrn is cloned into a pGEX expression vector to create a vector encoding a fusion protein comprising, from the N-terminus to the C-terminus, and/or GST-thrombin cleavage site-Metrnl and/or -Metrn. The fusion protein can be purified by affinity chromatography using glutathione-agarose resin. Recombinant Metrnl and/or Metrn unfused to GST can be recovered by cleavage of the fusion protein with thrombin.

(72) Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89). Target gene expression from the pTrc vector relies on host RNA polymerase transcription from a hybrid trp-lac fusion promoter. Target gene expression from the pET 11d vector relies on transcription from a T7 gn10-lac fusion promoter mediated by a coexpressed viral RNA polymerase (T7 gn1). This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident prophage harboring a T7 gn1 gene under the transcriptional control of the lacUV 5 promoter.

(73) One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein (Gottesman, S., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 119-128). Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (Wada et al. (1992) Nucleic Acids Res. 20:2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.

(74) In another embodiment, the Metrnl and/or Metrn expression vector is a yeast expression vector. Examples of vectors for expression in yeast S. cerivisae include pYepSecl (Baldari, et al., (1987) EMBO J. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell 30:933-943), pJRY88 (Schultz et al., (1987) Gene 54:113-123), and pYES2 (Invitrogen Corporation, San Diego, Calif.).

(75) Alternatively, Metrnl and/or Metrn can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., Sf 9 cells) include the pAc series (Smith et al. (1983) Mol. Cell Biol. 3:2156-2165) and the pVL series (Lucklow and Summers (1989) Virology 170:31-39).

(76) In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, B. (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987) EMBO J. 6:187-195). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see chapters 16 and 17 of Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.

(77) In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert et al. (1987) Genes Dev. 1:268-277), lymphoid-specific promoters (Calame and Eaton (1988) Adv. Immunol. 43:235-275), in particular promoters of T cell receptors (Winoto and Baltimore (1989) EMBO J. 8:729-733) and immunoglobulins (Banerji et al. (1983) Cell 33:729-740; Queen and Baltimore (1983) Cell 33:741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle (1989) Proc. Natl. Acad. Sci. USA 86:5473-5477), pancreas-specific promoters (Edlund et al. (1985) Science 230:912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, for example the murine hox promoters (Kessel and Gruss (1990) Science 249:374-379) and the -fetoprotein promoter (Campes and Tilghman (1989) Genes Dev. 3:537-546).

(78) The invention further provides a recombinant expression vector comprising a nucleic acid molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively linked to a regulatory sequence in a manner which allows for expression (by transcription of the DNA molecule) of an RNA molecule which is antisense to Metrnl and/or Metrn mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen which direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen which direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.

(79) Another aspect of the invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms host cell and recombinant host cell are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.

(80) A host cell can be any prokaryotic or eukaryotic cell. For example, Metrnl and/or Metrn protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Fao hepatoma cells, primary hepatocytes, Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.

(81) Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms transformation and transfection are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.

(82) A cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art. A Metrnl and/or Metrn polypeptide or fragment thereof, may be secreted and isolated from a mixture of cells and medium containing the polypeptide. Alternatively, a Metrnl and/or Metrn polypeptide or fragment thereof, may be retained cytoplasmically and the cells harvested, lysed and the protein or protein complex isolated. A Metrnl and/or Metrn polypeptide or fragment thereof, may be isolated from cell culture medium, host cells, or both using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and inmmunoaffinity purification with antibodies specific for particular epitopes of Metrnl, Metrn. or a fragment thereof. In other embodiments, heterologous tags can be used for purification purposes (e.g., epitope tags and FC fusion tags), according to standards methods known in the art.

(83) Thus, a nucleotide sequence encoding all or a selected portion of a Metrnl and/or Metrn polypeptide may be used to produce a recombinant form of the protein via microbial or eukaryotic cellular processes. Ligating the sequence into a polynucleotide construct, such as an expression vector, and transforming or transfecting into hosts, either eukaryotic (yeast, avian, insect or mammalian) or prokaryotic (bacterial cells), are standard procedures. Similar procedures, or modifications thereof, may be employed to prepare recombinant Metrnl and/or Metrn polypeptides, or fragments thereof, by microbial means or tissue-culture technology in accord with the subject invention.

(84) In another variation, protein production may be achieved using in vitro translation systems. In vitro translation systems are, generally, a translation system which is a cell-free extract containing at least the minimum elements necessary for translation of an RNA molecule into a protein. An in vitro translation system typically comprises at least ribosomes, tRNAs, initiator methionyl-tRNAMet, proteins or complexes involved in translation, e.g., eIF2, eIF3, the cap-binding (CB) complex, comprising the cap-binding protein (CBP) and eukaryotic initiation factor 4F (eIF4F). A variety of in vitro translation systems are well known in the art and include commercially available kits. Examples of in vitro translation systems include eukaryotic lysates, such as rabbit reticulocyte lysates, rabbit oocyte lysates, human cell lysates, insect cell lysates and wheat germ extracts. Lysates are commercially available from manufacturers such as Promega Corp., Madison, Wis.; Stratagene, La Jolla, Calif.; Amersham, Arlington Heights, Ill.; and GIBCO/BRL, Grand Island, N.Y. In vitro translation systems typically comprise macromolecules, such as enzymes, translation, initiation and elongation factors, chemical reagents, and ribosomes. In addition, an in vitro transcription system may be used. Such systems typically comprise at least an RNA polymerase holoenzyme, ribonucleotides and any necessary transcription initiation, elongation and termination factors. In vitro transcription and translation may be coupled in a one-pot reaction to produce proteins from one or more isolated DNAs.

(85) In certain embodiments, the Metrnl and/or Metrn polypeptide, or fragment thereof, may be synthesized chemically, ribosomally in a cell free system, or ribosomally within a cell. Chemical synthesis may be carried out using a variety of art recognized methods, including stepwise solid phase synthesis, semi-synthesis through the conformationally-assisted re-ligation of peptide fragments, enzymatic ligation of cloned or synthetic peptide segments, and chemical ligation. Native chemical ligation employs a chemoselective reaction of two unprotected peptide segments to produce a transient thioester-linked intermediate. The transient thioester-linked intermediate then spontaneously undergoes a rearrangement to provide the full length ligation product having a native peptide bond at the ligation site. Full length ligation products are chemically identical to proteins produced by cell free synthesis. Full length ligation products may be refolded and/or oxidized, as allowed, to form native disulfide-containing protein molecules. (see e.g., U.S. Pat. Nos. 6,184,344 and 6,174,530; and T. W. Muir et al., Curr. Opin. Biotech. (1993): vol. 4, p 420; M. Miller, et al., Science (1989): vol. 246, p 1149; A. Wlodawer, et al., Science (1989): vol. 245, p 616; L. H. Huang, et al., Biochemistry (1991): vol. 30, p 7402; M. Sclmolzer, et al., Int. J. Pept. Prot. Res. (1992): vol. 40, p 180-193; K. Rajarathnam, et al., Science (1994): vol. 264, p 90; R. E. Offord, Chemical Approaches to Protein Engineering, in Protein Design and the Development of New therapeutics and Vaccines, J. B. Hook, G. Poste, Eds., (Plenum Press, New York, 1990) pp. 253-282; C. J. A. Wallace, et al., J. Biol. Chem. (1992): vol. 267, p 3852; L. Abrahmsen, et al., Biochemistry (1991): vol. 30, p 4151; T. K. Chang, et al., Proc. Natl. Acad. Sci. USA (1994) 91: 12544-12548; M. Schnlzer, et al., Science (1992): vol., 3256, p 221; and K. Akaji, et al., Chem. Pharm. Bull. (Tokyo) (1985) 33: 184).

(86) For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Preferred selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding Metrnl and/or Metrn or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).

(87) A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) Metrnl and/or Metrn protein. Accordingly, the invention further provides methods for producing Metrnl and/or Metrn protein using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding Metrnl has been introduced) in a suitable medium until Metrnl and/or Metrn is produced. In another embodiment, the method further comprises isolating Metrnl and/or Metrn from the medium or the host cell.

(88) The host cells of the invention can also be used to produce nonhuman transgenic animals that, for example, overexpress Metrnl and/or Metrn, oversecrete Metrnl and/or Metrn, underexpress Metrnl and/or Metrn, or undersecrete Metrnl and/or Metrn. The nonhuman transgenic animals can be used in screening assays designed to identify agents or compounds, e.g., drugs, pharmaceuticals, etc., which are capable of ameliorating detrimental symptoms of selected disorders such as glucose homeostasis disorders, weight disorders, disorders associated with insufficient insulin activity, or inflammation-related muscle disorders. For example, in one embodiment, a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which Metrnl- and/or Metrn-encoding sequences, or fragments thereof, have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous Metrnl and/or Metrn sequences have been introduced into their genome or homologous recombinant animals in which endogenous Metrnl and/or Metrn sequences have been altered. Such animals are useful for studying the function and/or activity of Metrnl and/or Metrn, or fragments thereof, and for identifying and/or evaluating modulators of Metrnl and/or Metrn activity. As used herein, a transgenic animal is a nonhuman animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene. Other examples of transgenic animals include nonhuman primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA which is integrated into the genome of a cell from which a transgenic animal develops and which remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. As used herein, a homologous recombinant animal is a nonhuman animal, preferably a mammal, more preferably a mouse, in which an endogenous Metrnl and/or Metrn gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal.

(89) A transgenic animal of the invention can be created by introducing nucleic acids encoding Metrnl and/or Metrn, or a fragment thereof, into the male pronuclei of a fertilized oocyte, e.g., by microinjection, retroviral infection, and allowing the oocyte to develop in a pseudopregnant female foster animal. The human Metrnl and/or Metrn cDNA sequence can be introduced as a transgene into the genome of a nonhuman animal. Alternatively, a nonhuman homologue of the human Metrnl and/or Metrn gene can be used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably linked to the Metrnl and/or Metrn transgene to direct expression of Metrnl and/or Metrn protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Pat. Nos. 4,736,866 and 4,870,009, both by Leder et al., U.S. Pat. No. 4,873,191 by Wagner et al. and in Hogan, B., Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986). Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of the Metrnl and/or Metrn transgene in its genome and/or expression of Metrnl and/or Metrn mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene encoding Metrnl and/or Metrn can further be bred to other transgenic animals carrying other transgenes.

(90) In some embodiments, transgenic animals can be created in which Metrnl and/or Metrn expression and/or secretion is inhibited by introducing and expressing anti-Metrnl and/or anti-Metrn antisense nucleic acids into the genome of the animal.

(91) To create a homologous recombinant animal, a vector is prepared which contains at least a portion of a Metrnl and/or Metrn gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the Metrnl and/or Metrn gene. The Metrnl and/or Metrn gene can be a human gene, but more preferably, is a nonhuman homologue of a human Metrnl and/or Metrn gene. For example, a mouse Metrnl and/or Metrn gene can be used to construct a homologous recombination vector suitable for altering an endogenous Metrnl and/or Metrn gene, respectively, in the mouse genome. In a preferred embodiment, the vector is designed such that, upon homologous recombination, the endogenous Metrnl and/or Metrn gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a knock out vector). Alternatively, the vector can be designed such that, upon homologous recombination, the endogenous Metrnl and/or Metrn gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression of the endogenous Metrnl and/or Metrn protein). In the homologous recombination vector, the altered portion of the Metrnl and/or Metrn gene is flanked at its 5 and 3 ends by additional nucleic acid of the Metrnl and/or Metrn gene to allow for homologous recombination to occur between the exogenous Metrnl and/or Metrn gene carried by the vector and an endogenous Metrnl and/or Metrn gene in an embryonic stem cell. The additional flanking Metrnl and/or Metrn nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5 and 3 ends) are included in the vector (see e.g., Thomas, K. R. and Capecchi, M. R. (1987) Cell 51:503 for a description of homologous recombination vectors). The vector is introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced Metrnl and/or Metrn gene has homologously recombined with the endogenous Metrnl and/or Metrn gene are selected (see e.g., Li, E. et al. (1992) Cell 69:915). The selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras (see e.g., Bradley, A. in Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, E. J. Robertson, ed. (IRL, Oxford, 1987) pp. 113-152). A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously recombined DNA in their germ cells can be used to breed animals in which all cells of the animal contain the homologously recombined DNA by germline transmission of the transgene. Methods for constructing homologous recombination vectors and homologous recombinant animals are described further in Bradley, A. (1991) Current Opinion in Biotechnology 2:823-829 and in PCT International Publication Nos.: WO 90/11354 by Le Mouellec et al.; WO 91/01140 by Smithies et al.; WO 92/0968 by Zijlstra et al.; and WO 93/04169 by Berns et al.

(92) In another embodiment, transgenic nonhuman animals can be produced which contain selected systems which allow for regulated expression of the transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage P1. For a description of the cre/loxP recombinase system, see, e.g., Lakso et al. (1992) Proc. Natl. Acad. Sci. USA 89:6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae (O'Gorman et al. (1991) Science 251:1351-1355. If a cre/loxP recombinase system is used to regulate expression of the transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of double transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.

(93) Clones of the nonhuman transgenic animals described herein can also be produced according to the methods described in Wilmut, I. et al. (1997) Nature 385:810-813 and PCT International Publication Nos. WO 97/07668 and WO 97/07669. In brief, a cell, e.g., a somatic cell, from the transgenic animal can be isolated and induced to exit the growth cycle and enter G.sub.O phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyst and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone of the animal from which the cell, e.g., the somatic cell, is isolated.

(94) III. Isolated Metrnl and/or Metrn Polypeptides, Anti-Metrnl Antibodies, and Anti-Metrn Antibodies

(95) The present invention provides soluble, purified and/or isolated forms of Metrnl and/or Metrn, or fragments thereof.

(96) In one aspect, a Metrnl and/or Metrn polypeptide may comprise a full-length Metrnl and/or Metrn amino acid sequence or a full-length Metrnl and/or Metrn amino acid sequence with 1 to about 20 conservative amino acid substitutions Amino acid sequence of any Metrnl and/or Metrn polypeptide described herein can also be at least 50, 55, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 99.5% identical to a Metrnl and/or Metrn polypeptide sequence of interest, described herein, well known in the art, or a fragment thereof. In addition, any Metrnl and/or Metrn polypeptide, or fragment thereof, described herein has modulates (e.g., enhance) one or more of the following biological activities: 1) it can modulate the expression of TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3; 2) it can increase cellular respiration (i.e., total and uncoupled respiration); 3) it can increase thermogenesis of adipose cells; 4) it can increase insulin sensitivity of adipose, muscle and/or hepatic cells; 5) it can decrease hepatosteatosis, obesity, type II diabetes, and/or appetite; 6) it can increase insulin secretion of pancreatic beta cells; 7) it can increase cardiac function to combat cardiac hypertrophy; 8) it can improve muscle hypoplasia; 9) it can reduce the growth and effects of obesity-associated cancer, cachexia, and anorexia; 10) it can treat diseases or disorders characterized by increased PGC-1 expression or activity, .g., diabetes or obesity; and 11) it can inhibit inflammation of muscle tissue. In another aspect, the present invention contemplates a composition comprising an isolated Metrnl and/or Metrn polypeptide and less than about 25%, or alternatively 15%, or alternatively 5%, contaminating biological macromolecules or polypeptides.

(97) The present invention further provides compositions related to producing, detecting, or characterizing a Metrnl and/or Metrn polypeptide, or fragment thereof, such as nucleic acids, vectors, host cells, and the like. Such compositions may serve as compounds that modulate a Metrnl and/or Metrn polypeptide's expression and/or activity, such as antisense nucleic acids.

(98) In certain embodiments, a Metrnl and/or Metrn polypeptide of the invention may be a fusion protein containing a domain which increases its solubility and bioavailability and/or facilitates its purification, identification, detection, and/or structural characterization. In some embodiments, it may be useful to express Metrnl and/or Metrn fusion polypeptides in which the fusion partner enhances fusion protein stability in blood plasma and/or enhances systemic bioavailability. Exemplary domains, include, for example, glutathione S-transferase (GST), protein A, protein G, calmodulin-binding peptide, thioredoxin, maltose binding protein, HA, myc, poly arginine, poly His, poly His-Asp or FLAG fusion proteins and tags. Additional exemplary domains include domains that alter protein localization in vivo, such as signal peptides, type III secretion system-targeting peptides, transcytosis domains, nuclear localization signals, etc. In various embodiments, n Metrnl and/or Metrn polypeptide of the invention may comprise one or more heterologous fusions. Polypeptides may contain multiple copies of the same fusion domain or may contain fusions to two or more different domains. The fusions may occur at the N-terminus of the polypeptide, at the C-terminus of the polypeptide, or at both the N- and C-terminus of the polypeptide. It is also within the scope of the invention to include linker sequences between a polypeptide of the invention and the fusion domain in order to facilitate construction of the fusion protein or to optimize protein expression or structural constraints of the fusion protein. In one embodiment, the linker is a linker described herein, e.g., a linker of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more amino acids. The linker can be, e.g., an unstructured recombinant polymer (URP), e.g., a URP that is 9, 10, 11, 12, 13, 14, 15, 20 amino acids in length, i.e., the linker has limited or lacks secondary structure, e.g., Chou-Fasman algorithm. An exemplary linker comprises (e.g., consists of) the amino acid sequence GGGGAGGGG (SEQ ID NO:15). In another embodiment, the polypeptide may be constructed so as to contain protease cleavage sites between the fusion polypeptide and polypeptide of the invention in order to remove the tag after protein expression or thereafter. Examples of suitable endoproteases, include, for example, Factor Xa and TEV proteases.

(99) In some embodiments, Metrnl and/or Metrn polypeptides, or fragments thereof, are fused to an antibody (e.g., IgG 1, IgG2, IgG3, IgG4) fragment (e.g., Fc polypeptides). Techniques for preparing these fusion proteins are known, and are described, for example, in WO 99/31241 and in Cosman et al. (2001) Immunity 14:123-133. Fusion to an Fc polypeptide offers the additional advantage of facilitating purification by affinity chromatography over Protein A or Protein G columns.

(100) In still another embodiment, a Metrnl and/or Metrn polypeptide may be labeled with a fluorescent label to facilitate their detection, purification, or structural characterization. In an exemplary embodiment, a Metrnl and/or Metrn polypeptide of the invention may be fused to a heterologous polypeptide sequence which produces a detectable fluorescent signal, including, for example, green fluorescent protein (GFP), enhanced green fluorescent protein (EGFP), Renilla Reniformis green fluorescent protein, GFPmut2, GFPuv4, enhanced yellow fluorescent protein (EYFP), enhanced cyan fluorescent protein (ECFP), enhanced blue fluorescent protein (EBFP), citrine and red fluorescent protein from discosoma (dsRED).

(101) Another aspect of the invention pertains to the use of isolated Metrnl and/or Metrn proteins, and biologically active portions thereof, as well as peptide fragments suitable for use as immunogens to raise anti-Metrnl and/or anti-Metrn antibodies. An isolated or purified protein or biologically active portion thereof is substantially free of cellular material when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. The language substantially free of cellular material includes preparations of Metrnl and/or Metrn protein in which the protein is separated from cellular components of the cells in which it is naturally or recombinantly produced. In one embodiment, the language substantially free of cellular material includes preparations of Metrnl and/or Metrn protein having less than about 30% (by dry weight) of non-Metrnl and/or non-Metrn protein (also referred to herein as a contaminating protein), more preferably less than about 20% of non-Metrnl and/or non-Metrn protein, still more preferably less than about 10% of non-Metrnl and/or non-Metrn protein, and most preferably less than about 5% non-Metrnl and/or non-Metrn protein. When the Metrnl and/or Metrn protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the protein preparation. The language substantially free of chemical precursors or other chemicals includes preparations of Metrnl and/or Metrn protein in which the protein is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein. In one embodiment, the language substantially free of chemical precursors or other chemicals includes preparations of Metrnl and/or Metrn protein having less than about 30% (by dry weight) of chemical precursors of non-Metrnl and/or non-Metrn chemicals, more preferably less than about 20% chemical precursors of non-Metrnl and/or non-Metrn chemicals, still more preferably less than about 10% chemical precursors of non-Metrnl and/or non-Metrn chemicals, and most preferably less than about 5% chemical precursors of non-Metrnl and/or non-Metrn chemicals. In preferred embodiments, isolated proteins or biologically active portions thereof lack contaminating proteins from the same animal from which the Metrnl and/or Metrn protein is derived. Typically, such proteins are produced by recombinant expression of, for example, a human Metrnl and/or Metrn protein in a nonhuman cell.

(102) In preferred embodiments, the protein or portion thereof comprises an amino acid sequence which is sufficiently homologous to an amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, such that the protein or portion thereof maintains one or more of the following biological activities or, in complex, modulates (e.g., enhance) one or more of the following biological activities: 1) it can modulate the expression of TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3; 2) it can increase cellular respiration (i.e., total and uncoupled respiration); 3) it can increase thermogenesis of adipose cells; 4) it can increase insulin sensitivity of adipose, muscle and/or hepatic cells; 5) it can decrease hepatosteatosis, obesity, type II diabetes, and/or appetite; 6) it can increase insulin secretion of pancreatic beta cells; 7) it can increase cardiac function to combat cardiac hypertrophy; 8) it can improve muscle hypoplasia; 9) it can reduce the growth and effects of obesity-associated cancer, cachexia, and anorexia; 10) it can treat diseases or disorders characterized by increased PGC-1 expression or activity, e.g., diabetes or obesity; and 11) it can inhibit inflammation of muscle tissue. The portion of the protein is preferably a biologically active portion as described herein. In another preferred embodiment, the Metrnl and/or Metrn protein has an amino acid sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, respectively, or an amino acid sequence which is at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to the amino acid sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof. In yet another preferred embodiment, the Metrnl and/or Metrn protein has an amino acid sequence which is encoded by a nucleotide sequence which hybridizes, e.g., hybridizes under stringent conditions, to the nucleotide sequence of SEQ ID NO:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof, or a nucleotide sequence which is at least about 50%, preferably at least about 60%, more preferably at least about 70%, yet more preferably at least about 80%, still more preferably at least about 90%, and most preferably at least about 95% or more homologous to the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof. The preferred Metrnl and/or Metrn proteins of the present invention also preferably possess at least one of the Metrnl and/or Metrn biological activities, or activities associated with the complex, described herein. For example, a preferred Metrnl and/or Metrn protein of the present invention includes an amino acid sequence encoded by a nucleotide sequence which hybridizes, e.g., hybridizes under stringent conditions, to the nucleotide sequence of SEQ ID NO:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, or 29, or fragment thereof and which can maintain one or more of the following biological activities or, in complex, modulates (e.g., enhance) one or more of the following biological activities: 1) it can modulate the expression of TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3; 2) it can increase cellular respiration (i.e., total and uncoupled respiration); 3) it can increase thermogenesis of adipose cells; 4) it can increase insulin sensitivity of adipose, muscle and/or hepatic cells; 5) it can decrease hepatosteatosis, obesity, type II diabetes, and/or appetite; 6) it can increase insulin secretion of pancreatic beta cells; 7) it can increase cardiac function to combat cardiac hypertrophy; 8) it can improve muscle hypoplasia; 9) it can reduce the growth and effects of obesity-associated cancer, cachexia, and anorexia; 10) it can treat diseases or disorders characterized by increased PGC-1 expression or activity, e.g., diabetes or obesity; and 11) it can inhibit inflammation of muscle tissue.

(103) Biologically active portions of the Metrnl and/or Metrn protein include peptides comprising amino acid sequences derived from the amino acid sequence of the Metrnl and/or Metrn protein, e.g., the amino acid sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30, or fragment thereof, or the amino acid sequence of a protein homologous to the Metrnl and/or Metrn protein, which include fewer amino acids than the full length Metrnl and/or Metrn protein or the full length protein which is homologous to the Metrnl and/or Metrn protein, and exhibit at least one activity of the Metrnl and/or Metrn protein, or complex thereof. Typically, biologically active portions (peptides, e.g., peptides which are, for example, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more amino acids in length) comprise a domain or motif, e.g., the full-length protein minus the signal peptide). In a preferred embodiment, the biologically active portion of the protein which includes one or more the domains/motifs described herein can modulate brown fat gene expression programs and/or thermogenesis in adipose tissue (e.g., white fat cells) and/or inhibit inflammation in muscle tissue (e.g., skeletal muscle cells). Moreover, other biologically active portions, in which other regions of the protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the activities described herein. Preferably, the biologically active portions of the Metrnl and/or Metrn protein include one or more selected domains/motifs or portions thereof having biological activity. In one embodiment, a Metrnl and/or Metrn fragment consists of a portion of a full-length Metrnl and/or Metrn fragment of interest that is less than 300, 290, 280, 270, 260, 250, 240, 230, 220, 210, 200, 195, 190, 185, 180, 175, 170, 165, 160, 155, 150, 145, 140, 135, 130, 125, 120, 115, 110, 105, 100, 95, 90, 85, 80, 75, or 70 amino acids in length. Metrnl and/or Metrn proteins can be produced by recombinant DNA techniques.

(104) For example, a nucleic acid molecule encoding the protein is cloned into an expression vector (as described above), the expression vector is introduced into a host cell (as described above) and the Metrnl and/or Metrn protein is expressed in the host cell. The Metrnl and/or Metrn protein can then be isolated from the cells by an appropriate purification scheme using standard protein purification techniques. Alternative to recombinant expression, a Metrnl and/or Metrn protein, polypeptide, or peptide can be synthesized chemically using standard peptide synthesis techniques. Moreover, native Metrnl and/or Metrn protein can be isolated from cells (e.g., skeletal muscle cells), for example using an anti-Metrnl antibody and/or an anti-Metrn antibody (described further below).

(105) The invention also provides Metrnl and/or Metrn chimeric or fusion proteins. As used herein, a Metrnl and/or Metrn chimeric protein or fusion protein comprises a Metrnl and/or Metrn polypeptide operatively linked to a non-Metrnl and/or non-Metrn polypeptide. A Metrnl or Metrn polypeptide refers to a polypeptide having an amino acid sequence corresponding to Metrnl and/or Metrn, respectively, whereas a non-Metrnl or non-Metrn polypeptide refers to a polypeptide having an amino acid sequence corresponding to a protein which is not substantially homologous to the Metrnl and/or Metrn protein, respectively, e.g., a protein which is different from the Metrnl and/or Metrn protein and which is derived from the same or a different organism. Within the fusion protein, the term operatively linked is intended to indicate that the Metrnl and/or Metrn polypeptide and the non-Metrnl polypeptide and/or non-Metrn polypeptide are fused in-frame to each other. The non-Metrnl polypeptide and/or non-Metrn polypeptide can be fused to the N-terminus or C-terminus of the Metrnl polypeptide or Metrn polypeptide, respectively. For example, in one embodiment the fusion protein is a Metrnl-GST and/or Metrnl-Fc fusion protein in which the Metrnl sequences, respectively, are fused to the N-terminus of the GST or Fc sequences. Such fusion proteins can be made using Metrn polypeptides. Such fusion proteins can also facilitate the purification, expression, and/or bioavailability of recombinant Metrnl and/or Metrn. In another embodiment, the fusion protein is a Metrnl and/or Metrn protein containing a heterologous signal sequence at its C-terminus. In certain host cells (e.g., mammalian host cells), expression and/or secretion of Metrnl and/or Metrn can be increased through use of a heterologous signal sequence.

(106) Preferably, a Metrnl and/or Metrn chimeric or fusion protein of the invention is produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, for example by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al. John Wiley & Sons: 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide). A Metrnl-encoding and/or Metrn-encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the Metrnl and/or Metrn protein.

(107) The present invention also pertains to homologues of the Metrnl and/or Metrn proteins which function as either a Metrnl and/or Metrn agonist (mimetic) or a Metrnl and/or Metrn antagonist. In a preferred embodiment, the Metrnl and/or Metrn agonists and antagonists stimulate or inhibit, respectively, a subset of the biological activities of the naturally occurring form of the Metrnl and/or Metrn protein, respectively. Thus, specific biological effects can be elicited by treatment with a homologue of limited function. In one embodiment, treatment of a subject with a homologue having a subset of the biological activities of the naturally occurring form of the protein has fewer side effects in a subject relative to treatment with the naturally occurring form of the Metrnl protein.

(108) Homologues of the Metrnl and/or Metrn protein can be generated by mutagenesis, e.g., discrete point mutation or truncation of the Metrnl and/or Metrn protein, respectively. As used herein, the term homologue refers to a variant form of the Metrnl and/or Metrn protein which acts as an agonist or antagonist of the activity of the Metrnl and/or Metrn protein, respectively. An agonist of the Metrnl and/or Metrn protein can retain substantially the same, or a subset, of the biological activities of the Metrnl and/or Metrn protein, respectively. An antagonist of the Metrnl and/or Metrn protein can inhibit one or more of the activities of the naturally occurring form of the Metrnl and/or Metrn protein, by, for example, competitively binding to a downstream or upstream member of the Metrnl and/or Metrn cascade which includes the Metrnl and/or Metrn protein. Thus, the mammalian Metrnl and/or Metrn protein and homologues thereof of the present invention can be, for example, either positive or negative regulators of adipocyte differentiation and/or thermogenesis in brown adipocytes.

(109) In an alternative embodiment, homologues of the Metrnl and/or Metrn protein can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of the Metrnl and/or Metrn protein for Metrnl and/or Metrn protein agonist or antagonist activity. In one embodiment, a variegated library of Metrnl and/or Metrn variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of Metrnl and/or Metrn variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential Metrnl and/or Metrn sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of Metrnl and/or Metrn sequences therein. There are a variety of methods which can be used to produce libraries of potential Metrnl homologues from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the desired set of potential Metrnl and/or Metrn sequences. Methods for synthesizing degenerate oligonucleotides are known in the art (see, e.g., Narang, S. A. (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al. (1984) Science 198:1056; Ike et al. (1983) Nucleic Acid Res. 11:477.

(110) In addition, libraries of fragments of the Metrnl and/or Metrn protein coding can be used to generate a variegated population of Metrnl and/or Metrn fragments for screening and subsequent selection of homologues of a Metrnl and/or Metrn protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of a Metrnl and/or Metrn coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with S1 nuclease, and ligating the resulting fragment library into an expression vector. By this method, an expression library can be derived which encodes N-terminal, C-terminal and internal fragments of various sizes of the Metrnl and/or Metrn protein.

(111) Several techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of Metrnl and/or Metrn homologues. The most widely used techniques, which are amenable to high through-put analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding the gene whose product was detected. Recursive ensemble mutagenesis (REM), a new technique which enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify Metrnl and/or Metrn homologues (Arkin and Youvan (1992) Proc. Natl. Acad. Sci. USA 89:7811-7815; Delagrave et al. (1993) Protein Engineering 6(3):327-331).

(112) In another aspect, an isolated Metrnl and/or Metrn protein, or a fragment thereof, can be used as an immunogen to generate antibodies that bind Metrnl and/or Metrn, respectively, or the complex thereof, using standard techniques for polyclonal and monoclonal antibody preparation. The full-length Metrnl and/or Metrn protein can be used or, alternatively, antigenic peptide fragments of Metrnl and/or Metrn, or peptides in complex, can be used as immunogens. A Metrnl and/or Metrn immunogen typically is used to prepare antibodies by immunizing a suitable subject, (e.g., rabbit, goat, mouse or other mammal) with the immunogen. An appropriate immunogenic preparation can contain, for example, recombinantly expressed Metrnl and/or Metrn protein or a chemically synthesized Metrnl and/or Metrn peptide. The preparation can further include an adjuvant, such as Freund's complete or incomplete adjuvant, or similar immunostimulatory agent. Immunization of a suitable subject with an immunogenic Metrnl and/or Metrn preparation induces a polyclonal anti-Metrnl and/or anti-Metrn antibody response.

(113) Accordingly, another aspect of the invention pertains to the use of anti-Metrnl antibodies and/or anti-Metrn antibodies. The term antibody as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which specifically binds (immunoreacts with) an antigen, such as Metrnl and/or Metrn. Examples of immunologically active portions of immunoglobulin molecules include F(ab) and F(ab).sub.2 fragments which can be generated by treating the antibody with an enzyme such as pepsin. The invention provides polyclonal and monoclonal antibodies that bind Metrnl and/or Metrn. The term monoclonal antibody or monoclonal antibody composition, as used herein, refers to a population of antibody molecules that contain only one species of an antigen binding site capable of immunoreacting with a particular epitope of Metrnl and/or Metrn. A monoclonal antibody composition thus typically displays a single binding affinity for a particular Metrnl and/or Metrn protein with which it immunoreacts.

(114) Polyclonal anti-Metrnl antibodies and/or anti-Metrn antibodies can be prepared as described above by immunizing a suitable subject with a Metrnl and/or Metrn immunogen, or fragment thereof. The anti-Metrnl antibody and/or anti-Metrn antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized Metrnl and/or Metrn. If desired, the antibody molecules directed against Metrnl and/or Metrn can be isolated from the mammal (e.g., from the blood) and further purified by well-known techniques, such as protein A chromatography to obtain the IgG fraction. At an appropriate time after immunization, i.e., when the anti-Metrnl antibody and/or anti-Metrn antibody titers are highest, antibody-producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256:495-497) (see also, Brown et al. (1981) J. Immunol. 127:539-46; Brown et al. (1980)J. Biol. Chem. 255:4980-83; Yeh et al. (1976) Proc. Natl. Acad. Sci. USA 76:2927-31; and Yeh et al. (1982) Int. J. Cancer 29:269-75), the more recent human B cell hybridoma technique (Kozbor et al. (1983) Immunol. Today 4:72), the EBV-hybridoma technique (Cole et al. (1985), Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96) or trioma techniques. The technology for producing monoclonal antibody hybridomas is well known (see generally R. H. Kenneth, in Monoclonal Antibodies: A New Dimension In Biological Analyses, Plenum Publishing Corp., New York, N.Y. (1980); E. A. Lerner (1981) Yale J. Biol. Med., 54:387-402; M. L. Gefter et al. (1977) Somatic Cell Genet. 3:231-36). Briefly, an immortal cell line (typically a myeloma) is fused to lymphocytes (typically splenocytes) from a mammal immunized with a Metrnl and/or Metrn immunogen as described above, and the culture supernatants of the resulting hybridoma cells are screened to identify a hybridoma producing a monoclonal antibody that binds Metrnl and/or Metrn.

(115) Any of the many well-known protocols used for fusing lymphocytes and immortalized cell lines can be applied for the purpose of generating an anti-Metrnl monoclonal antibody and/or anti-Metrn monoclonal antibody (see, i.e., G. Galfre et al. (1977) Nature 266:550-52; Gefter et al. Somatic Cell Genet., cited supra; Lerner, Yale J. Biol. Med., cited supra; Kenneth, Monoclonal Antibodies, cited supra). Moreover, the ordinarily skilled worker will appreciate that there are many variations of such methods which also would be useful. Typically, the immortal cell line (e.g., a myeloma cell line) is derived from the same mammalian species as the lymphocytes. For example, murine hybridomas can be made by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the present invention with an immortalized mouse cell line. Preferred immortal cell lines are mouse myeloma cell lines that are sensitive to culture medium containing hypoxanthine, aminopterin and thymidine (HAT medium). Any of a number of myeloma cell lines can be used as a fusion partner according to standard techniques, i.e., the P3-NS1/1-Ag4-1, P3-x63-Ag8.653 or Sp2/OAg14 myeloma lines. These myeloma lines are available from ATCC. Typically, HAT-sensitive mouse myeloma cells are fused to mouse splenocytes using polyethylene glycol (PEG). Hybridoma cells resulting from the fusion are then selected using HAT medium, which kills unfused and unproductively fused myeloma cells (unfused splenocytes die after several days because they are not transformed). Hybridoma cells producing a monoclonal antibody of the invention are detected by screening the hybridoma culture supernatants for antibodies that bind Metrnl and/or Metrn, i.e., using a standard ELISA assay.

(116) As an alternative to preparing monoclonal antibody-secreting hybridomas, a monoclonal anti-Metrnl antibody and/or monoclonal anti-Metrn antibody can be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with Metrnl and/or Metrn, respectively, to thereby isolate immunoglobulin library members that bind Metrnl and/or Metrn. Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, Catalog No. 27-9400-01; and the Stratagene SurfZAP Phage Display Kit, Catalog No. 240612). Additionally, examples of methods and reagents particularly amenable for use in generating and screening antibody display library can be found in, for example, Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. PCT International Publication No. WO 92/18619; Dower et al. PCT International Publication No. WO 91/17271; Winter et al. PCT International Publication WO 92/20791; Markland et al. PCT International Publication No. WO 92/15679; Breitling et al. PCT International Publication WO 93/01288; McCafferty et al. PCT International Publication No. WO 92/01047; Garrard et al. PCT International Publication No. WO 92/09690; Ladner et al. PCT International Publication No. WO 90/02809; Fuchs et al. (1991) Bio/Technology 9:1369-1372; Hay et al. (1992) Hum. Antibod. Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275-1281; Griffiths et al. (1993) EMBO J. 12:725-734; Hawkins et al. (1992) J. Mol. Biol. 226:889-896; Clackson et al. (1991) Nature 352:624-628; Gram et al. (1992) Proc. Natl. Acad. Sci. USA 89:3576-3580; Garrard et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nucleic Acids Res. 19:4133-4137; Barbas et al. (1991) Proc. Natl. Acad. Sci. USA 88:7978-7982; and McCafferty et al. Nature (1990) 348:552-554.

(117) Additionally, recombinant anti-Metrnl antibodies and/or anti-Metrn antibodies, such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope of the invention. Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art, for example using methods described in Robinson et al. International Application No. PCT/US86/02269; Akira, et al. European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al. European Patent Application 173,494; Neuberger et al. PCT International Publication No. WO 86/01533; Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al. European Patent Application 125,023; Better et al. (1988) Science 240:1041-1043; Liu et al. (1987) Proc. Natl. Acad. Sci. USA 84:3439-3443; Liu et al. (1987) J. Immunol. 139:3521-3526; Sun et al. (1987) Proc. Natl. Acad. Sci. USA 84:214-218; Nishimura et al. (1987) Canc. Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al. (1988) J. Natl. Cancer Inst. 80:1553-1559); Morrison, S. L. (1985) Science 229:1202-1207; Oi et al. (1986) BioTechniques 4:214; Winter U.S. Pat. No. 5,225,539; Jones et al. (1986) Nature 321:552-525; Verhoeyan et al. (1988) Science 239:1534; and Beidler et al. (1988) J. Immunol. 141:4053-4060.

(118) An anti-Metrnl antibody and/or anti-Metrn antibody (e.g., monoclonal antibody) can be used to isolate Metrnl and/or Metrn by standard techniques, such as affinity chromatography or immunoprecipitation. An anti-Metrnl antibody and/or anti-Metrn antibody can facilitate the purification of natural Metrnl and/or Metrn from cells and of recombinantly produced Metrnl and/or Metrn expressed in host cells. Moreover, an anti-Metrnl antibody and/or anti-Metrn antibody can be used to detect Metrnl and/or Metrn protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the Metrnl and/or Metrn protein. Anti-Metrnl antibodies and/or anti-Metrn antibodies can be used to monitor protein levels in a cell or tissue, e.g., adipose cells or tissue, as part of a clinical testing procedure, e.g., in order to monitor a safe dosage of an uncoupling agent. Detection can be facilitated by coupling (e.g., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, -galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include .sup.125I, .sup.131I, .sup.35S or .sup.3H.

(119) In vivo techniques for detection of Metrnl and/or Metrn protein include introducing into a subject a labeled antibody directed against the protein. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.

(120) IV. Identification of Compounds that Modulate Metrnl and/or Metrn

(121) The Metrnl and/or Metrn nucleic acid and polypeptide molecules described herein may be used to design modulators of one or more of biological activities of the complex or complex polypeptides. In particular, information useful for the design of therapeutic and diagnostic molecules, including, for example, the protein domain, structural information, and the like for polypeptides of the invention is now available or attainable as a result of the ability to prepare, purify and characterize the complexes and complex polypeptides, and domains, fragments, variants and derivatives thereof.

(122) In one aspect, modulators, inhibitors, or antagonists against the polypeptides of the invention, biological complexes containing them, or orthologs thereof, may be used to treat any disease or other treatable condition of a patient (including humans and animals), including, for example, metabolic disorders.

(123) Modulators of Metrnl and/or Metrn nucleic acid and polypeptide molecules, may be identified and developed as set forth below using techniques and methods known to those of skill in the art. The modulators of the invention may be employed, for instance, to inhibit and treat Metrnl-mediated and/or Metrn-mediated diseases or disorders. The modulators of the invention may elicit a change in one or more of the following activities: (a) a change in the level and/or rate of formation of an Metrnl-receptor and/or Metrn-receptor complex, (b) a change in the activity of a Metrnl and/or Metrn nucleic acid and/or polypeptide, (c) a change in the stability of a Metrnl and/or Metrn nucleic acid and/or polypeptide, (d) a change in the conformation of a Metrnl and/or Metrn nucleic acid and/or polypeptide, or (e) a change in the activity of at least one polypeptide contained in a Metrnl and/or Metrn complex (e.g., a receptor for secreted Metrnl and/or Metrn). A number of methods for identifying a molecule which modulates a Metrnl and/or Metrn nucleic acid and/or polypeptide are known in the art. For example, in one such method, a Metrnl and/or Metrn nucleic acid and/or polypeptide, is contacted with a test compound, and the activity of the Metrnl and/or Metrn nucleic acid and/or polypeptide is determined in the presence of the test compound, wherein a change in the activity of the Metrnl and/or Metrn nucleic acid and/or polypeptide in the presence of the compound as compared to the activity in the absence of the compound (or in the presence of a control compound) indicates that the test compound modulates the activity of the Metrnl and/or Metrn nucleic acid and/or polypeptide.

(124) Compounds to be tested for their ability to act as modulators of Metrnl and/or Metrn nucleic acids and/or polypeptides, can be produced, for example, by bacteria, yeast or other organisms (e.g. natural products), produced chemically (e.g. small molecules, including peptidomimetics), or produced recombinantly. Compounds for use with the above-described methods may be selected from the group of compounds consisting of lipids, carbohydrates, polypeptides, peptidomimetics, peptide-nucleic acids (PNAs), small molecules, natural products, aptamers and polynucleotides. In certain embodiments, the compound is a polynucleotide. In some embodiments, said polynucleotide is an antisense nucleic acid. In other embodiments, said polynucleotide is an siRNA. In certain embodiments, the compound comprises a biologically active fragment of a Metrnl and/or Metrn polypeptide (e.g., a dominant negative form that binds to, but does not activate, a Metrnl receptor and/or Metrn receptor).

(125) A variety of assay formats will suffice and, in light of the present disclosure, those not expressly described herein may nevertheless be comprehended by one of ordinary skill in the art based on the teachings herein. Assay formats for analyzing Metrnl-receptor and/or Metrn-receptor complex formation and/or activity of a Metrnl and/or Metrn nucleic acid and/or polypeptide, may be generated in many different forms, and include assays based on cell-free systems, e.g. purified proteins or cell lysates, as well as cell-based assays which utilize intact cells. Simple binding assays can also be used to detect agents which modulate a Metrnl and/or Metrn, for example, by enhancing the formation of a Metrnl complex and/or Metrn complex, by enhancing the binding of Metrnl and/or Metrn to a substrate, and/or by enhancing the binding of a Metrnl and/or Metrn polypeptide to a substrate. Another example of an assay useful for identifying a modulator of Metrnl and/or Metrn is a competitive assay that combines one or more Metrnl and/or Metrn polypeptides with a potential modulator, such as, for example, polypeptides, nucleic acids, natural substrates or ligands, or substrate or ligand mimetics, under appropriate conditions for a competitive inhibition assay. Metrnl and/or Metrn polypeptides can be labeled, such as by radioactivity or a colorimetric compound, such that Metrnl-receptor complex and/or Metrn-receptor formation and/or activity can be determined accurately to assess the effectiveness of the potential modulator.

(126) Assays may employ kinetic or thermodynamic methodology using a wide variety of techniques including, but not limited to, microcalorimetry, circular dichroism, capillary zone electrophoresis, nuclear magnetic resonance spectroscopy, fluorescence spectroscopy, and combinations thereof. Assays may also employ any of the methods for isolating, preparing and detecting Metrnl and/or Metrn, or complex polypeptides, as described above.

(127) Complex formation between a Metrnl polypeptide and/or Metrn, or fragment thereof, and a binding partner (e.g., Metrnl receptor and/or Metrn receptor) may be detected by a variety of methods. Modulation of the complex's formation may be quantified using, for example, detectably labeled proteins such as radiolabeled, fluorescently labeled, or enzymatically labeled polypeptides or binding partners, by immunoassay, or by chromatographic detection. Methods of isolating and identifying Metrnl-receptor complexes and/or Metrn-receptor complexes described above may be incorporated into the detection methods.

(128) In certain embodiments, it may be desirable to immobilize a Metrnl polypeptide and/or Metrn polypeptide to facilitate separation of Metrnl complexes and/or Metrn complexes from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a Metrnl polypeptide and/or Metrn polypeptide to a binding partner may be accomplished in any vessel suitable for containing the reactants. Examples include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein may be provided which adds a domain that allows the protein to be bound to a matrix. For example, glutathione-S-transferase/polypeptide (GST/polypeptide) fusion proteins may be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the binding partner, e.g. an .sup.35S-labeled binding partner, and the test compound, and the mixture incubated under conditions conducive to complex formation, e.g. at physiological conditions for salt and pH, though slightly more stringent conditions may be desired. Following incubation, the beads are washed to remove any unbound label, and the matrix immobilized and radiolabel determined directly (e.g. beads placed in scintillant), or in the supernatant after the complexes are subsequently dissociated. Alternatively, the complexes may be dissociated from the matrix, separated by SDS-PAGE, and the level of Metrnl polypeptides and/or Metrn polypeptides found in the bead fraction quantified from the gel using standard electrophoretic techniques such as described in the appended examples.

(129) Other techniques for immobilizing proteins on matrices are also available for use in the subject assay. For instance, a Metrnl polypeptide and/or Metrn polypeptide may be immobilized utilizing conjugation of biotin and streptavidin. For instance, biotinylated polypeptide molecules may be prepared from biotin-NHS(N-hydroxy-succinimide) using techniques well known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, Ill.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with the polypeptide may be derivatized to the wells of the plate, and polypeptide trapped in the wells by antibody conjugation. As above, preparations of a binding partner and a test compound are incubated in the polypeptide presenting wells of the plate, and the amount of complex trapped in the well may be quantified. Exemplary methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the binding partner, or which are reactive with the Metrnl polypeptide and/or Metrn polypeptide and compete with the binding partner; as well as enzyme-linked assays which rely on detecting an enzymatic activity associated with the binding partner, either intrinsic or extrinsic activity. In the instance of the latter, the enzyme may be chemically conjugated or provided as a fusion protein with the binding partner. To illustrate, the binding partner may be chemically cross-linked or genetically fused with horseradish peroxidase, and the amount of Metrnl polypeptide and/or Metrn polyeptpdie trapped in the Metrnl complex and/or Metrn complex, respectively, may be assessed with a chromogenic substrate of the enzyme, e.g. 3,3-diamino-benzadine terahydrochloride or 4-chloro-1-napthol. Likewise, a fusion protein comprising the Metrnl polypeptide and/or Metrn polypeptide and glutathione-S-transferase may be provided, and Metrnl and/or Metrn complex formation quantified by detecting the GST activity using 1-chloro-2,4-dinitrobenzene (Habig et al (1974) J Biol Chem 249:7130).

(130) Antibodies against the Metrnl and/or Metrn polypeptide can be used for immunodetection purposes. Alternatively, the Metrnl and/or Metrn polypeptide to be detected may be epitope-tagged in the form of a fusion protein that includes, in addition to the polypeptide sequence, a second polypeptide for which antibodies are readily available (e.g. from commercial sources). For instance, the GST fusion proteins described above may also be used for quantification of binding using antibodies against the GST moiety. Other useful epitope tags include myc-epitopes (e.g., see Ellison et al. (1991) J Biol Chem 266:21150-21157) which includes a 10-residue sequence from c-myc, as well as the pFLAG system (International Biotechnologies, Inc.) or the pEZZ-protein A system (Pharmacia, N.J.).

(131) In certain in vitro embodiments of the present assay, the protein or the set of proteins engaged in a protein-protein, protein-substrate, or protein-nucleic acid interaction comprises a reconstituted protein mixture of at least semi-purified proteins. By semi-purified, it is meant that the proteins utilized in the reconstituted mixture have been previously separated from other cellular or viral proteins. For instance, in contrast to cell lysates, the proteins involved in a protein-substrate, protein-protein or nucleic acid-protein interaction are present in the mixture to at least 50% purity relative to all other proteins in the mixture, and more preferably are present at 90-95% purity. In certain embodiments of the subject method, the reconstituted protein mixture is derived by mixing highly purified proteins such that the reconstituted mixture substantially lacks other proteins (such as of cellular or viral origin) which might interfere with or otherwise alter the ability to measure activity resulting from the given protein-substrate, protein-protein interaction, or nucleic acid-protein interaction.

(132) In one embodiment, the use of reconstituted protein mixtures allows more careful control of the protein-substrate, protein-protein, or nucleic acid-protein interaction conditions. Moreover, the system may be derived to favor discovery of modulators of particular intermediate states of the protein-protein interaction. For instance, a reconstituted protein assay may be carried out both in the presence and absence of a candidate agent, thereby allowing detection of a modulator of a given protein-substrate, protein-protein, or nucleic acid-protein interaction.

(133) Assaying biological activity resulting from a given protein-substrate, protein-protein or nucleic acid-protein interaction, in the presence and absence of a candidate modulator, may be accomplished in any vessel suitable for containing the reactants. Examples include microtiter plates, test tubes, and micro-centrifuge tubes.

(134) In yet another embodiment, a Metrnl and/or Metrn polypeptide may be used to generate a two-hybrid or interaction trap assay (see also, U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J. Biol Chem 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; and Iwabuchi et al. (1993) Oncogene 8:1693-1696), for subsequently detecting agents which disrupt binding of the interaction components to one another.

(135) In particular, the method makes use of chimeric genes which express hybrid proteins. To illustrate, a first hybrid gene comprises the coding sequence for a DN217-420inding domain of a transcriptional activator may be fused in frame to the coding sequence for a bait protein, e.g., a Metrnl and/or Metrn polypeptide of sufficient length to bind to a potential interacting protein. The second hybrid protein encodes a transcriptional activation domain fused in frame to a gene encoding a fish protein, e.g., a potential interacting protein of sufficient length to interact with the protein-protein interaction component polypeptide portion of the bait fusion protein. If the bait and fish proteins are able to interact, e.g., form a protein-protein interaction component complex, they bring into close proximity the two domains of the transcriptional activator. This proximity causes transcription of a reporter gene which is operably linked to a transcriptional regulatory site responsive to the transcriptional activator, and expression of the reporter gene may be detected and used to score for the interaction of the bait and fish proteins. The host cell also contains a first chimeric gene which is capable of being expressed in the host cell. The gene encodes a chimeric protein, which comprises (a) a DNA binding domain that recognizes the responsive element on the reporter gene in the host cell, and (b) a bait protein (e.g., a Metrnl and/or Metrn polypeptide). A second chimeric gene is also provided which is capable of being expressed in the host cell, and encodes the fish fusion protein. In one embodiment, both the first and the second chimeric genes are introduced into the host cell in the form of plasmids. Preferably, however, the first chimeric gene is present in a chromosome of the host cell and the second chimeric gene is introduced into the host cell as part of a plasmid.

(136) The DNA binding domain of the first hybrid protein and the transcriptional activation domain of the second hybrid protein may be derived from transcriptional activators having separable DNA binding and transcriptional activation domains. For instance, these separate DNA binding and transcriptional activation domains are known to be found in the yeast GAL4 protein, and are known to be found in the yeast GCN4 and ADR1 proteins. Many other proteins involved in transcription also have separable binding and transcriptional activation domains which make them useful for the present invention, and include, for example, the LexA and VP16 proteins. It will be understood that other (substantially) transcriptionally-inert DNA binding domains may be used in the subject constructs; such as domains of ACE1, cI, lac repressor, jun or fos. In another embodiment, the DNA binding domain and the transcriptional activation domain may be from different proteins. The use of a LexA DNA binding domain provides certain advantages. For example, in yeast, the LexA moiety contains no activation function and has no known effect on transcription of yeast genes. In addition, use of LexA allows control over the sensitivity of the assay to the level of interaction (see, for example, PCT publication WO 94/10300).

(137) In certain embodiments, any enzymatic activity associated with the bait or fish proteins is inactivated, e.g., dominant negative or other mutants of a protein-protein interaction component can be used.

(138) Continuing with the illustrative example, formation of a complex between the bait and fish fusion proteins in the host cell, causes the activation domain to activate transcription of the reporter gene. The method is carried out by introducing the first chimeric gene and the second chimeric gene into the host cell, and subjecting that cell to conditions under which the bait and fish fusion proteins and are expressed in sufficient quantity for the reporter gene to be activated. The formation of a complex results in a detectable signal produced by the expression of the reporter gene.

(139) In still further embodiments, the Metrnl and/or Metrn polypeptide, or complexes thereof, of interest may be generated in whole cells, taking advantage of cell culture techniques to support the subject assay. For example, the Metrnl and/or Metrn polypeptide, or complexes thereof, may be constituted in a prokaryotic or eukaryotic cell culture system. Advantages to generating the Metrnl and/or Metrn polypeptide, or complexes thereof, in an intact cell includes the ability to screen for modulators of the level and/or activity of the Metrnl and/or Metrn polypeptides, or complexes thereof, which are functional in an environment more closely approximating that which therapeutic use of the modulator would require, including the ability of the agent to gain entry into the cell. Furthermore, certain of the in vivo embodiments of the assay are amenable to high through-put analysis of candidate agents.

(140) The Metrnl and/or Metrn nucleic acids and/or polypeptide can be endogenous to the cell selected to support the assay. Alternatively, some or all of the components can be derived from exogenous sources. For instance, fusion proteins can be introduced into the cell by recombinant techniques (such as through the use of an expression vector), as well as by microinjecting the fusion protein itself or mRNA encoding the fusion protein. Moreover, in the whole cell embodiments of the subject assay, the reporter gene construct can provide, upon expression, a selectable marker. Such embodiments of the subject assay are particularly amenable to high through-put analysis in that proliferation of the cell can provide a simple measure of the protein-protein interaction.

(141) The amount of transcription from the reporter gene may be measured using any method known to those of skill in the art to be suitable. For example, specific mRNA expression may be detected using Northern blots or specific protein product may be identified by a characteristic stain, western blots or an intrinsic activity. In certain embodiments, the product of the reporter gene is detected by an intrinsic activity associated with that product. For instance, the reporter gene may encode a gene product that, by enzymatic activity, gives rise to a detection signal based on color, fluorescence, or luminescence.

(142) In many drug screening programs which test libraries of compounds and natural extracts, high throughput assays are desirable in order to maximize the number of compounds surveyed in a given period of time. Assays of the present invention which are performed in cell-free systems, such as may be derived with purified or semi-purified proteins or with lysates, are often preferred as primary screens in that they can be generated to permit rapid development and relatively easy detection of an alteration in a molecular target which is mediated by a test compound. Moreover, the effects of cellular toxicity and/or bioavailability of the test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity with other proteins or changes in enzymatic properties of the molecular target. Accordingly, potential modulators of Metrnl and/or Metrn may be detected in a cell-free assay generated by constitution of a functional Metrnl and/or Metrn in a cell lysate. In an alternate format, the assay can be derived as a reconstituted protein mixture which, as described below, offers a number of benefits over lysate-based assays.

(143) The activity of a Metrnl and/or Metrn polypeptide may be identified and/or assayed using a variety of methods well known to the skilled artisan. For example, the activity of a Metrnl and/or Metrn nucleic acid and/or polypeptide may be determined by assaying for the level of expression of RNA and/or protein molecules. Transcription levels may be determined, for example, using Northern blots, hybridization to an oligonucleotide array or by assaying for the level of a resulting protein product. Translation levels may be determined, for example, using Western blotting or by identifying a detectable signal produced by a protein product (e.g., fluorescence, luminescence, enzymatic activity, etc.). Depending on the particular situation, it may be desirable to detect the level of transcription and/or translation of a single gene or of multiple genes.

(144) In other embodiments, the biological activity of a Metrnl and/or Metrn nucleic acid and/or polypeptide may be assessed by monitoring changes in the phenotype of a targeted cell. For example, the detection means can include a reporter gene construct which includes a transcriptional regulatory element that is dependent in some form on the level and/or activity of a Metrnl and/or Metrn nucleic acid and/or polypeptide. The Metrnl and/or Metrn nucleic acid and/or polypeptide may be provided as a fusion protein with a domain that binds to a DNA element of a reporter gene construct. The added domain of the fusion protein can be one which, through its DNA binding ability, increases or decreases transcription of the reporter gene. Whichever the case may be, its presence in the fusion protein renders it responsive to a Metrnl and/or Metrn nucleic acid and/or polypeptide. Accordingly, the level of expression of the reporter gene will vary with the level of expression of a Metrnl and/or Metrn nucleic acid and/or polypeptide.

(145) Moreover, in the whole cell embodiments of the subject assay, the reporter gene construct can provide, upon expression, a selectable marker. A reporter gene includes any gene that expresses a detectable gene product, which may be RNA or protein. Preferred reporter genes are those that are readily detectable. The reporter gene may also be included in the construct in the form of a fusion gene with a gene that includes desired transcriptional regulatory sequences or exhibits other desirable properties. For instance, the product of the reporter gene can be an enzyme which confers resistance to an antibiotic or other drug, or an enzyme which complements a deficiency in the host cell (i.e. thymidine kinase or dihydrofolate reductase). To illustrate, the aminoglycoside phosphotransferase encoded by the bacterial transposon gene Tn5 neo can be placed under transcriptional control of a promoter element responsive to the level of a Metrnl and/or Metrn nucleic acid and/or polypeptide present in the cell. Such embodiments of the subject assay are particularly amenable to high through-put analysis in that proliferation of the cell can provide a simple measure of inhibition of the Metrnl and/or Metrn nucleic acid and/or polypeptide.

(146) V. Methods of the Invention

(147) The methods of the invention relate to the expression and/or activity of Metrnl and/or Metrn sufficient to modulate (e.g., induce or repress) brown fat gene expression programs (e.g., one or more genes indicative of brown fat relative to white fat) and/or thermogenesis in adipose tissue and inflammation in muscle tissue, wherein increases in Metrnl and/or Metrn expression and/or activity promote brown fat gene expression and/or thermogenesis in adipose tissue so as to increase energy expenditure and can therefore be used to treat metabolic disorders such as obesity, cardiac hypertrophy, type II diabetes, and in patients in need of more exercise; and, wherein decreases in Metrnl and/or Metrn expression and/or activity promote brown fat gene expression and/or thermogenesis in adipose tissue so as to decrease energy expenditure and can therefore be used to treat the effects of such conditions as cachexia, anorexia, and obesity-associated cancer. Similarly, increases in Metrnl and/or Metrn expression and/or activity inhibit inflammation in muscle tissue (e.g., skeletal muscle cells) and thus are useful in treating inflammation-related muscle disorders.

(148) The invention also relates to methods for increasing energy expenditure in a mammal comprising inducing expression and/or activity of Metrnl and/or Metrn sufficient to activate a brown fat gene expression program in the mammal, wherein the differentiated brown fat cells promote energy expenditure thereby increasing energy expenditure in the mammal.

(149) The term sufficient to activate is intended to encompass any increase in expression and/or activity of Metrnl and/or Metrn that promotes, activates, stimulates, enhances, or results in brown fat gene expression program induction.

(150) In another aspect, the invention relates to methods for treating metabolic disorders or muscle inflammation disorders in a subject comprising administering to the subject an agent that induces expression and/or activity of Metrnl and/or Metrn, wherein expression and/or activity of Metrnl and/or Metrn increases respiration and energy expenditure and/or decreases muscle cell inflammation to thereby treat the metabolic disorder or muscle inflammation disorder. In one embodiment, total respiration is increased following the expression and/or activity of Metrnl and/or Metrn. In another embodiment, uncoupled respiration is increased following the expression and/or activity of Metrnl and/or Metrn. Uncoupled respiration dissipates heat and thereby increases energy expenditure in the subject.

(151) As used herein, the term agent and therapeutic agent is defined broadly as anything that cells from a subject having a metabolic disorder may be exposed to in a therapeutic protocol. In one embodiment, the agent is a recombinant Metrnl and/or Metrn protein, or fragment thereof, or nucleic acid molecule encoding such a polypeptide. In some embodiments, Metrnl and/or Metrn proteins or nucleic acid molecules encoding same can serve to enhance Metrnl and/or Metrn protein function (e.g., overexpressed Metrnl and/or Metrn, oversecreted Metrnl and/or Metrn, plasma stabilized Metrnl and/or Metrn, etc.), whereas in other embodiments, Metrnl and/or Metrn proteins or nucleic acid molecules encoding same can serve to inhibit Metrnl and/or Metrn protein function (e.g., non-activating Metrnl and/or Metrn polypeptides that bind Metrnl and/or Metrn receptors but do not activate receptor signaling, dominant-negative Metrnl and/or Metrn polypeptides that cannot bind Metrnl and/or Metrn receptors or binding partners). In another embodiment, the agent is an anti-sense nucleic acid molecule having a sequence complementary to Metrnl and/or Metrn (e.g., an RNAi, siRNA, or other RNA inhibiting nucleic acid molecule). In still another embodiment, antibody reagents can be used to sequester Metrnl and/or Metrn from functionally activating Metrnl and/or Metrn receptors or binding partners.

(152) The term administering is intended to include routes of administration which allow the agent to perform its intended function of modulating (e.g., increasing or decreasing) expression and/or activity of Metrnl and/or Metrn. Examples of routes of administration which can be used include injection (subcutaneous, intravenous, parenterally, intraperitoneally, intrathecal, etc., such as in a subcutaneous injection into white fate depots), oral, inhalation, and transdermal. The injection can be bolus injections or can be continuous infusion. Depending on the route of administration, the agent can be coated with or disposed in a selected material to protect it from natural conditions which may detrimentally affect its ability to perform its intended function. The agent may be administered alone, or in conjunction with a pharmaceutically acceptable carrier. Further the agent may be coadministered with a pharmaceutically acceptable carrier. The agent also may be administered as a prodrug, which is converted to its active form in vivo. The agent may also be administered in combination with one or more additional therapeutic agent(s) (e.g., before, after or simultaneously therewith).

(153) The term effective amount of an agent that induces expression and/or activity of Metrnl and/or Metrn is that amount necessary or sufficient to modulate (e.g., increase or decrease) expression and/or activity of Metrnl and/or Metrn in the subject or population of subjects. The effective amount can vary depending on such factors as the type of therapeutic agent(s) employed, the size of the subject, or the severity of the disorder.

(154) It will be appreciated that individual dosages may be varied depending upon the requirements of the subject in the judgment of the attending clinician, the severity of the condition being treated and the particular compound being employed. In determining the therapeutically effective amount or dose, a number of additional factors may be considered by the attending clinician, including, but not limited to, the pharmacodynamic characteristics of the particular respiration uncoupling agent and its mode and route of administration; the desired time course of treatment; the species of mammal; its size, age, and general health; the specific disease involved; the degree of or involvement or the severity of the disease; the response of the individual subject; the particular compound administered; the mode of administration; the bioavailability characteristics of the preparation administered; the dose regimen selected; the kind of concurrent treatment; and other relevant circumstances.

(155) Treatment can be initiated with smaller dosages which are less than the effective dose of the compound. Thereafter, in one embodiment, the dosage should be increased by small increments until the optimum effect under the circumstances is reached. For convenience, the total daily dosage may be divided and administered in portions during the day if desired.

(156) The effectiveness of any particular respiration agent to treat a metabolic disorder or muscle inflammation disorder can be monitored by comparing two or more samples obtained from a subject undergoing anti-obesity, obesity-related, or muscle inflammation disorder treatment. In general, it is preferable to obtain a first sample from the subject prior to beginning therapy and one or more samples during treatment. In such a use, a baseline of expression of cells from subjects with the disorder prior to therapy is determined and then changes in the baseline state of expression of cells from subjects with the disorder is monitored during the course of therapy. Alternatively, two or more successive samples obtained during treatment can be used without the need of a pre-treatment baseline sample. In such a use, the first sample obtained from the subject is used as a baseline for determining whether the expression of cells from subjects with the disorder is increasing or decreasing.

(157) Another aspect of the invention relates to a method for inducing a brown fat gene expression program in adipose tissue (e.g., white fat cells and preadipocytes), fibroblasts, and the like of a mammal comprising expressing Metrnl and/or Metrn nucleic acid and/or polypeptide molecules in a mammal and monitoring brown fat gene expression or downstream effects of brown fat cells in the mammal Increased brown adipose tissue in the mammal will warm up the body and blood of the mammal resulting in an increased energy expenditure from the cells. The increased energy expenditure will increase the metabolic rate of the subject and may be used for the treatment and/or prevention of obesity and obesity related disorders. The induction of brown fat cells may be monitored by analyzing 1) the expression of TNF-, IL-6, IL-, IL-10, TGF-, ucp-1, cidea, dio2, pgc1, err-, pgc1 and its isoforms (e.g., pgc11), bmp8b, adiponectin (adipoq), adipsin, otopetrin, type II deiodinase, cig30, ppar gamma 2, elovl3, cAMP, Prdm16, cytochrome C, cox4i1, coxIII, cox5b, cox7a1, cox8b, glut4, atpase b2, cox II, atp5o, ndufb5, ap2, ndufs1, GRP109A, acylCoA-thioesterase 4, EARA1, claudin1, PEPCK, fgf21, and acylCoA-thioesterase 3; 2) increases in cellular respiration (i.e., total and uncoupled respiration); 3) increases in thermogenesis of adipose cells; 4) increases in insulin sensitivity of adipose, muscle and/or hepatic cells; 5) decreases in hepatosteatosis, obesity, type II diabetes, and/or appetite; 6) increases in insulin secretion of pancreatic beta cells; 7) increases in cardiac function to combat cardiac hypertrophy; 8) improved muscle hypoplasia; 9) reduction in growth and effects of obesity-associated cancer, cachexia, and anorexia; and/or 10) treatment of diseases or disorders characterized by increased PGC-1 expression or activity, e.g., diabetes or obesity. Alternatively, anti-Metrnl agents and/or anti-Metrn agents, such as antisense or antibody agents, can be used to inhibit a brown fat gene expression program in a mammal to thereby cause the opposite result.

(158) Still another aspect of the invention relates to a method for inhibiting muscle inflammation in a mammal comprising expressing Metrnl and/or Metrn nucleic acid and/or polypeptide molecules in a mammal and monitoring muscle inflammation in the mammal Alternatively, anti-Metrnl agents and/or anti-Metrn agents, such as antisense or antibody agents, can be used to promote muscle inflammation.

(159) Any means for the introduction of a polynucleotide into mammals, human or non-human, or cells thereof may be adapted to the practice of this invention for the delivery of the various constructs of the invention into the intended recipient. In one embodiment of the invention, the DNA constructs are delivered to cells by transfection, i.e., by delivery of naked DNA or in a complex with a colloidal dispersion system. A colloidal system includes macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. The preferred colloidal system of this invention is a lipid-complexed or liposome-formulated DNA. In the former approach, prior to formulation of DNA, e.g., with lipid, a plasmid containing a transgene bearing the desired DNA constructs may first be experimentally optimized for expression (e.g., inclusion of an intron in the 5 untranslated region and elimination of unnecessary sequences (Feigner, et al., Ann NY Acad Sci 126-139, 1995). Formulation of DNA, e.g. with various lipid or liposome materials, may then be effected using known methods and materials and delivered to the recipient mammal See, e.g., Canonico et al, Am J Respir Cell Mol Biol 10:24-29, 1994; Tsan et al, Am J Physiol 268; Alton et al., Nat Genet. 5:135-142, 1993 and U.S. Pat. No. 5,679,647 by Carson et al.

(160) The targeting of liposomes can be classified based on anatomical and mechanistic factors. Anatomical classification is based on the level of selectivity, for example, organ-specific, cell-specific, and organelle-specific. Mechanistic targeting can be distinguished based upon whether it is passive or active. Passive targeting utilizes the natural tendency of liposomes to distribute to cells of the reticulo-endothelial system (RES) in organs, which contain sinusoidal capillaries. Active targeting, on the other hand, involves alteration of the liposome by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein, or by changing the composition or size of the liposome in order to achieve targeting to organs and cell types other than the naturally occurring sites of localization.

(161) The surface of the targeted delivery system may be modified in a variety of ways. In the case of a liposomal targeted delivery system, lipid groups can be incorporated into the lipid bilayer of the liposome in order to maintain the targeting ligand in stable association with the liposomal bilayer. Various linking groups can be used for joining the lipid chains to the targeting ligand. Naked DNA or DNA associated with a delivery vehicle, e.g., liposomes, can be administered to several sites in a subject (see below).

(162) Nucleic acids can be delivered in any desired vector. These include viral or non-viral vectors, including adenovirus vectors, adeno-associated virus vectors, retrovirus vectors, lentivirus vectors, and plasmid vectors. Exemplary types of viruses include HSV (herpes simplex virus), AAV (adeno associated virus), HIV (human immunodeficiency virus), BIV (bovine immunodeficiency virus), and MLV (murine leukemia virus). Nucleic acids can be administered in any desired format that provides sufficiently efficient delivery levels, including in virus particles, in liposomes, in nanoparticles, and complexed to polymers.

(163) The nucleic acids encoding a protein or nucleic acid of interest may be in a plasmid or viral vector, or other vector as is known in the art. Such vectors are well known and any can be selected for a particular application. In one embodiment of the invention, the gene delivery vehicle comprises a promoter and a demethylase coding sequence. Preferred promoters are tissue-specific promoters and promoters which are activated by cellular proliferation, such as the thymidine kinase and thymidylate synthase promoters. Other preferred promoters include promoters which are activatable by infection with a virus, such as the - and -interferon promoters, and promoters which are activatable by a hormone, such as estrogen. Other promoters which can be used include the Moloney virus LTR, the CMV promoter, and the mouse albumin promoter. A promoter may be constitutive or inducible.

(164) In another embodiment, naked polynucleotide molecules are used as gene delivery vehicles, as described in WO 90/11092 and U.S. Pat. No. 5,580,859. Such gene delivery vehicles can be either growth factor DNA or RNA and, in certain embodiments, are linked to killed adenovirus. Curiel et al., Hum. Gene. Ther. 3:147-154, 1992. Other vehicles which can optionally be used include DNA-ligand (Wu et al., J. Biol. Chem. 264:16985-16987, 1989), lipid-DNA combinations (Feigner et al., Proc. Natl. Acad. Sci. USA 84:7413 7417, 1989), liposomes (Wang et al., Proc. Natl. Acad. Sci. 84:7851-7855, 1987) and microprojectiles (Williams et al., Proc. Natl. Acad. Sci. 88:2726-2730, 1991).

(165) A gene delivery vehicle can optionally comprise viral sequences such as a viral origin of replication or packaging signal. These viral sequences can be selected from viruses such as astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, retrovirus, togavirus or adenovirus. In a preferred embodiment, the growth factor gene delivery vehicle is a recombinant retroviral vector. Recombinant retroviruses and various uses thereof have been described in numerous references including, for example, Mann et al., Cell 33:153, 1983, Cane and Mulligan, Proc. Nat'l. Acad. Sci. USA 81:6349, 1984, Miller et al., Human Gene Therapy 1:5-14, 1990, U.S. Pat. Nos. 4,405,712, 4,861,719, and 4,980,289, and PCT Application Nos. WO 89/02,468, WO 89/05,349, and WO 90/02,806. Numerous retroviral gene delivery vehicles can be utilized in the present invention, including for example those described in EP 0,415,731; WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; U.S. Pat. No. 5,219,740; WO 9311230; WO 9310218; Vile and Hart, Cancer Res. 53:3860-3864, 1993; Vile and Hart, Cancer Res. 53:962-967, 1993; Ram et al., Cancer Res. 53:83-88, 1993; Takamiya et al., J. Neurosci. Res. 33:493-503, 1992; Baba et al., J. Neurosurg. 79:729-735, 1993 (U.S. Pat. No. 4,777,127, GB 2,200,651, EP 0,345,242 and WO91/02805).

(166) Other viral vector systems that can be used to deliver a polynucleotide of the invention have been derived from herpes virus, e.g., Herpes Simplex Virus (U.S. Pat. No. 5,631,236 by Woo et al., issued May 20, 1997 and WO 00/08191 by Neurovex), vaccinia virus (Ridgeway (1988) Ridgeway, Mammalian expression vectors, In: Rodriguez R L, Denhardt D T, ed. Vectors: A survey of molecular cloning vectors and their uses. Stoneham: Butterworth; Baichwal and Sugden (1986) Vectors for gene transfer derived from animal DNA viruses: Transient and stable expression of transferred genes, In: Kucherlapati R, ed. Gene transfer. New York: Plenum Press; Coupar et al. (1988) Gene, 68:1-10), and several RNA viruses. Preferred viruses include an alphavirus, a poxivirus, an arena virus, a vaccinia virus, a polio virus, and the like. They offer several attractive features for various mammalian cells (Friedmann (1989) Science, 244:1275-1281; Ridgeway, 1988, supra; Baichwal and Sugden, 1986, supra; Coupar et al., 1988; Horwich et al. (1990) J. Virol., 64:642-650).

(167) In other embodiments, target DNA in the genome can be manipulated using well-known methods in the art. For example, the target DNA in the genome can be manipulated by deletion, insertion, and/or mutation are retroviral insertion, artificial chromosome techniques, gene insertion, random insertion with tissue specific promoters, gene targeting, transposable elements and/or any other method for introducing foreign DNA or producing modified DNA/modified nuclear DNA. Other modification techniques include deleting DNA sequences from a genome and/or altering nuclear DNA sequences. Nuclear DNA sequences, for example, may be altered by site-directed mutagenesis.

(168) In other embodiments, recombinant Metrnl and/or Metrn polypeptides, and fragments thereof, can be administered to subjects. In some embodiments, fusion proteins can be constructed and administered which have enhanced biological properties (e.g., Fc fusion proteins discussed above). In addition, the Metrnl and/or Metrn polypeptides, and fragment thereof, can be modified according to well-known pharmacological methods in the art (e.g., pegylation, glycosylation, oligomerization, etc.) in order to further enhance desirable biological activities, such as increased bioavailability and decreased proteolytic degradation.

(169) VI. Pharmaceutical Compositions

(170) In another aspect, the present invention provides pharmaceutically acceptable compositions which comprise a therapeutically-effective amount of an agent that modulates (e.g., increases or decreases) Metrnl and/or Metrn expression and/or activity, formulated together with one or more pharmaceutically acceptable carriers (additives) and/or diluents. As described in detail below, the pharmaceutical compositions of the present invention may be specially formulated for administration in solid or liquid form, including those adapted for the following: (1) oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, boluses, powders, granules, pastes; (2) parenteral administration, for example, by subcutaneous, intramuscular or intravenous injection as, for example, a sterile solution or suspension; (3) topical application, for example, as a cream, ointment or spray applied to the skin; (4) intravaginally or intrarectally, for example, as a pessary, cream or foam; or (5) aerosol, for example, as an aqueous aerosol, liposomal preparation or solid particles containing the compound.

(171) The phrase therapeutically-effective amount as used herein means that amount of an agent that modulates (e.g., enhances) Metrnl and/or Metrn expression and/or activity, or expression and/or activity of the complex, or composition comprising an agent that modulates (e.g., enhances) Metrnl and/or Metrn expression and/or activity, or expression and/or activity of the complex, which is effective for producing some desired therapeutic effect, e.g., weight loss, at a reasonable benefit/risk ratio.

(172) The phrase pharmaceutically acceptable is employed herein to refer to those agents, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.

(173) The phrase pharmaceutically-acceptable carrier as used herein means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject chemical from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation and not injurious to the subject. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.

(174) The term pharmaceutically-acceptable salts refers to the relatively non-toxic, inorganic and organic acid addition salts of the agents that modulates (e.g., enhances) Metrnl and/or Metrn expression and/or activity, or expression and/or activity of the complex encompassed by the invention. These salts can be prepared in situ during the final isolation and purification of the respiration uncoupling agents, or by separately reacting a purified respiration uncoupling agent in its free base form with a suitable organic or inorganic acid, and isolating the salt thus formed. Representative salts include the hydrobromide, hydrochloride, sulfate, bisulfate, phosphate, nitrate, acetate, valerate, oleate, palmitate, stearate, laurate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napthylate, mesylate, glucoheptonate, lactobionate, and laurylsulphonate salts and the like (See, for example, Berge et al. (1977) Pharmaceutical Salts, J. Pharm. Sci. 66:1-19).

(175) In other cases, the agents useful in the methods of the present invention may contain one or more acidic functional groups and, thus, are capable of forming pharmaceutically-acceptable salts with pharmaceutically-acceptable bases. The term pharmaceutically-acceptable salts in these instances refers to the relatively non-toxic, inorganic and organic base addition salts of agents that modulates (e.g., enhances) Metrnl and/or Metrn expression and/or activity, or expression and/or activity of the complex. These salts can likewise be prepared in situ during the final isolation and purification of the respiration uncoupling agents, or by separately reacting the purified respiration uncoupling agent in its free acid form with a suitable base, such as the hydroxide, carbonate or bicarbonate of a pharmaceutically-acceptable metal cation, with ammonia, or with a pharmaceutically-acceptable organic primary, secondary or tertiary amine. Representative alkali or alkaline earth salts include the lithium, sodium, potassium, calcium, magnesium, and aluminum salts and the like. Representative organic amines useful for the formation of base addition salts include ethylamine, diethylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine and the like (see, for example, Berge et al., supra).

(176) Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.

(177) Examples of pharmaceutically-acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.

(178) Formulations useful in the methods of the present invention include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal, aerosol and/or parenteral administration. The formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, the particular mode of administration. The amount of active ingredient, which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 1 percent to about ninety-nine percent of active ingredient, preferably from about 5 percent to about 70 percent, most preferably from about 10 percent to about 30 percent.

(179) Methods of preparing these formulations or compositions include the step of bringing into association an agent that modulates (e.g., increases or decreases) Metrnl and/or Metrn expression and/or activity, with the carrier and, optionally, one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association a respiration uncoupling agent with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.

(180) Formulations suitable for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of a respiration uncoupling agent as an active ingredient. A compound may also be administered as a bolus, electuary or paste.

(181) In solid dosage forms for oral administration (capsules, tablets, pills, dragees, powders, granules and the like), the active ingredient is mixed with one or more pharmaceutically-acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as, for example, acetyl alcohol and glycerol monostearate; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such a talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof; and (10) coloring agents. In the case of capsules, tablets and pills, the pharmaceutical compositions may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.

(182) A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared using binder (for example, gelatin or hydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine a mixture of the powdered peptide or peptidomimetic moistened with an inert liquid diluent.

(183) Tablets, and other solid dosage forms, such as dragees, capsules, pills and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art. They may also be formulated so as to provide slow or controlled release of the active ingredient therein using, for example, hydroxypropylmethyl cellulose in varying proportions to provide the desired release profile, other polymer matrices, liposomes and/or microspheres. They may be sterilized by, for example, filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions, which can be dissolved in sterile water, or some other sterile injectable medium immediately before use. These compositions may also optionally contain opacifying agents and may be of a composition that they release the active ingredient(s) only, or preferentially, in a certain portion of the gastrointestinal tract, optionally, in a delayed manner Examples of embedding compositions, which can be used include polymeric substances and waxes. The active ingredient can also be in micro-encapsulated form, if appropriate, with one or more of the above-described excipients.

(184) Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredient, the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.

(185) Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming and preservative agents.

(186) Suspensions, in addition to the active agent may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.

(187) Formulations for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing one or more respiration uncoupling agents with one or more suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active agent.

(188) Formulations which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.

(189) Dosage forms for the topical or transdermal administration of an agent that modulates (e.g., increases or decreases) Metrnl and/or Metrn expression and/or activity include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. The active component may be mixed under sterile conditions with a pharmaceutically-acceptable carrier, and with any preservatives, buffers, or propellants which may be required.

(190) The ointments, pastes, creams and gels may contain, in addition to a respiration uncoupling agent, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.

(191) Powders and sprays can contain, in addition to an agent that modulates (e.g., increases or decreases) Metrnl and/or Metrn expression and/or activity, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances. Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.

(192) The agent that modulates (e.g., increases or decreases) Metrnl and/or Metrn expression and/or activity, can be alternatively administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation or solid particles containing the compound. A nonaqueous (e.g., fluorocarbon propellant) suspension could be used. Sonic nebulizers are preferred because they minimize exposing the agent to shear, which can result in degradation of the compound.

(193) Ordinarily, an aqueous aerosol is made by formulating an aqueous solution or suspension of the agent together with conventional pharmaceutically acceptable carriers and stabilizers. The carriers and stabilizers vary with the requirements of the particular compound, but typically include nonionic surfactants (Tweens, Pluronics, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols. Aerosols generally are prepared from isotonic solutions.

(194) Transdermal patches have the added advantage of providing controlled delivery of a respiration uncoupling agent to the body. Such dosage forms can be made by dissolving or dispersing the agent in the proper medium. Absorption enhancers can also be used to increase the flux of the peptidomimetic across the skin. The rate of such flux can be controlled by either providing a rate controlling membrane or dispersing the peptidomimetic in a polymer matrix or gel.

(195) Ophthalmic formulations, eye ointments, powders, solutions and the like, are also contemplated as being within the scope of this invention.

(196) Pharmaceutical compositions of this invention suitable for parenteral administration comprise one or more respiration uncoupling agents in combination with one or more pharmaceutically-acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.

(197) Examples of suitable aqueous and nonaqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.

(198) These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.

(199) In some cases, in order to prolong the effect of a drug, it is desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material having poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution, which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally-administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle.

(200) Injectable depot forms are made by forming microencapsule matrices of an agent that modulates (e.g., increases or decreases) Metrnl and/or Metrn expression and/or activity, in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions, which are compatible with body tissue.

(201) When the respiration uncoupling agents of the present invention are administered as pharmaceuticals, to humans and animals, they can be given per se or as a pharmaceutical composition containing, for example, 0.1 to 99.5% (more preferably, 0.5 to 90%) of active ingredient in combination with a pharmaceutically acceptable carrier.

(202) Actual dosage levels of the active ingredients in the pharmaceutical compositions of this invention may be determined by the methods of the present invention so as to obtain an amount of the active ingredient, which is effective to achieve the desired therapeutic response for a particular subject, composition, and mode of administration, without being toxic to the subject.

(203) The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see U.S. Pat. No. 5,328,470) or by stereotactic injection (see e.g., Chen et al. (1994) Proc. Natl. Acad. Sci. USA 91:3054 3057). The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells which produce the gene delivery system.

EXEMPLIFICATION

(204) This invention is further illustrated by the following examples, which should not be construed as limiting.

Example 1: Materials and Methods for Examples 2-4

(205) A. Adenoviral Vectors

(206) The Metrnl expression vector was purchased from OriGene. PCR primers were designed to remove the stop codon and sub-clone it into the pENTR1a vector (Invitrogen). The pENTR vector containing Metrnl cDNA was recombined into the pAd-CMV-DEST-V5 adenoviral vector (Invitrogen) to obtain Metrnl with a C-terminal V5 epitope tag. The sequence of the murine Metrnl cDNA (light grey shading) from the pAD/CMV/V5-DEST adenoviral vector, in which the stop codon was removed and a C-terminal V5 epitope tag (dark grey shading) was added, has the following sequence:

(207) TABLE-US-00003 embedded image

(208) The adenovirus was produced using the ViraPower system (Invitrogen). Thereafter, virus was concentrated using the Vivapure AdenoPACK 100 (Sartorius Stedim Biotech) and buffer exchanged to 10 mM Tris-Cl at pH 8.0, 2 mM MgCl.sub.2, and 4% w/v sucrose reaching a concentration of 2-410.sup.8 infection units (ifu)/l concentration of 9-10 ifu/l. A LacZ adenovirus was prepared as a control in parallel.

(209) B. Adenovirus Injections

(210) C57/BL6J mice were fed a high fat (60% kcal) diet (D12492, Research Diets) for 20 weeks, starting at 4 weeks of age. Mice were then injected with 110.sup.10 ifu of adenovirus expressing LacZ or Metrnl. Mice were sacrificed five days post-injection and the subcutaneous inguinal fat pad was harvested to analyze for changes in thermogenic and mitochondrial gene expression programs. All gene expression data were normalized to TATA-Binding Protein (TBP) and quantitative measures were obtained using the del-delC.sub.T method.

Example 2: Muscle-Specific PGC-14 Transgenic Mice Exhibit a Lean Phenotype, Increased Thermogenesis, and Increased Browning of White Adipose Tissues

(211) Peroxisome proliferator-activated receptor gamma coactivator 1-alpha 4 (PGC-14), which is an isoform of PGC-1, is induced by resistance exercise and regulates skeletal muscle hypertrophy (Ruas et al. (2012) Cell 151:1319-1331). Mice transgenically engineered to express PGC-14 specifically within muscles under the control of the myogenin promoter have increased skeletal muscle hypertrophy and strength and are additionally resistant to cancer-induced cachexia (Ruas et al. (2012) Cell 151:1319-1331).

(212) It has now been determined herein that such muscle-specific PGC-14 transgenic mice exhibit a lean phenotype, increased thermogenesis, and increased browning of white adipose tissues. For example, subcutaneous inguinal fat pads from muscle-specific PGC-14 transgenic mice were analyzed for expression of genes related to a thermogenic gene program and genes characteristic of brown fat development. FIG. 1 shows significantly increased levels of well-known gene expression markers of thermogenesis and brown fat cells in the subcutaneous inguinal fat pads of the transgenic mice relative to those of wild type control animals. Thus, muscle-specific expression of PGC-14 drives increased thermogenesis and browning of white adipose tissues (e.g., subcutaneous inguinal fat pads), which contributes to an overall lean phenotype in transgenic mice.

Example 3: Metrnl Promotes Thermogenic Gene Programs in Adipose Tissue

(213) A combination of Affymetrix-based gene expression arrays and an algorithm that predicts protein secretion was then used to search for muscle proteins that could mediate the muscle-fat crosslink resulting in the promotion of browning in adipose tissues of the muscle-specific PGC-14 transgenic mice. The search identified Meteorin-like (Metrnl) as a candidate.

(214) Obese C57/BL6 mice intravenously injected with Metrnl-expressing adenoviral particles exhibited significantly more Metrnl protein expression in plasma relative to control mice injected with LacZ-expressing adenoviral particles (FIG. 2A). An anti-mouse Metrnl polyclonal antibody antigen affinity-purified from sheep was used (Antibody AF6679; R&D Systems). Quantitative polymerase chain reaction (qPCR) results of thermogenesis-related biomarkers in subcutaneous inguinal fat from mice injected with the LacZ- or Metrnl-expressing adenoviral particles demonstrate that Metrnl promotes thermogenic gene programs in adipose tissue (FIG. 2B). Thus, adenoviral-mediated overexpression of Metrnl in mice promotes thermogenic gene programs in adipose tissue.

Example 4: Metrnl Inhibits Inflammation in Skeletal Muscle

(215) C57/BL6 mice intravenously injected with Metrnl-expressing adenoviral particles also have decreased expression of inflammation-related genes in skeletal muscles (FIG. 3). Thus, adenoviral-mediated overexpression of Metrnl in mice inhibits inflammation in skeletal muscle.

INCORPORATION BY REFERENCE

(216) The contents of all references, patent applications, patents, and published patent applications, as well as the Figures and the Sequence Listing, cited throughout this application are hereby incorporated by reference.

EQUIVALENTS

(217) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.