Tumor necrosis factor 1B (TNF-1B) mutants and methods of use thereof to screen for candidate therapeutic compounds
10717776 ยท 2020-07-21
Assignee
Inventors
- Steven C. Almo (Pelham, NY, US)
- Sarah Garrett-Thomson (New York, NY, US)
- Ron Seidel (Larchmont, NY, US)
Cpc classification
G01N2500/04
PHYSICS
G01N33/5008
PHYSICS
G01N33/6863
PHYSICS
G01N2333/70575
PHYSICS
C07K14/70578
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
C07K14/7151
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
A61P19/04
HUMAN NECESSITIES
International classification
C07K14/705
CHEMISTRY; METALLURGY
C07K14/715
CHEMISTRY; METALLURGY
Abstract
Disclosed are tumor necrosis factor receptor 1B (TNFR-1B) signaling targets and TNFR-1B mutants and their uses for treatment of diseases and disorders.
Claims
1. A mutant of tumor necrosis factor receptor 1B (TNFR-1B) (SEQ ID NO:3) that modulates the binding of TNFR-1B to one or more of tumor necrosis factor receptor alpha (TNF), inducible costimulatory ligand (ICOS-L), and mucosal vascular addressing cell adhesion molecule 1 (MadCAM-1), wherein the mutant is selected from the group consisting of mutants K42D, T48A, N171D, S79D, R113D, L114A, R119D, K120D, D58A, R19D, S59D, L64D, R77A, S107D, R119A, K120A, R129A, V138D, K140A, 1156D, 1168D, N171A and M174D, wherein mutant numbering is based on the mature form of TNFR-1B in which the signal peptide at residues 1-22 has been removed.
2. The mutant of claim 1, selected from the group consisting of mutants K42D, T48A and N171D that, compared to TNFR-1B, have reduced binding to TNF, ICOS-L and MadCAM-1.
3. The mutant of claim 1, selected from the group consisting of mutants S79D, R113D, L114A, R119D and K120D that, compared to TNFR-1B, have reduce binding to ICOS-L and MadCAM-1, but not to TNF.
4. The mutant of claim 1, which is mutant D58A that, compared to TNFR-1B, has reduced binding to TNF and ICOS-L, but not to MadCAM-1.
5. The mutant of claim 1, selected from the group consisting of mutants R19D, S59D, L64D, R77A, S107D, R119A, K120A, R129A, V138D, K140A, 1156D, 1168D, N171A and M174D that, compared to TNFR-1B, predominately reduce binding to MadCAM-1.
6. A fusion protein comprising the mutant of claim 1 and an immunoglobulin Fc sequence.
7. The fusion protein of claim 6, wherein the immunoglobulin is an IgG.
8. The fusion protein of claim 6, wherein the immunoglobulin is IgG1.
9. A pharmaceutical composition comprising the fusion protein of claim 6 and a pharmaceutically acceptable carrier.
10. A method for screening for a candidate compound for treating a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease, the method comprising testing the compound to determine if the compound modulates the interaction between one or more of TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, and TNFR-1B and ISLR2, wherein a compound that is tested and determined to modulate the interaction between one or more of TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, or TNFR-1B and ISLR2 is a candidate compound for treating a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease.
11. The method of claim 10, wherein binding between TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, and/or TNFR-1B and ISLR2 is determined in the presence of the candidate compound and in the absence of the candidate compound, and wherein a change in the binding between TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, and/or TNFR-1B and ISLR2 in the presence of the candidate compound indicates that the candidate compound modulates the interaction between TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, and/or TNFR-1B and ISLR2.
12. The method of claim 10, wherein the compound is a non-naturally occurring small molecule of 2,000 daltons or less, or an antibody or an antibody fragment.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION OF THE INVENTION
(16) The present invention provides a method for screening for a candidate compound for treating a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease, the method comprising testing the compound to determine if the compound modulates the interaction between one or more of TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, TNFR-1B and ISLR2, and B7-1 and ISLR2, wherein a compound that is tested and determined to modulate the interaction between one or more of TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, TNFR-1B and ISLR2, and B7-1 and ISLR2 is a candidate compound for treating a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease.
(17) Binding between TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, TNFR-1B and ISLR2, and/or B7-1 and ISLR2 can be determined in the presence of the candidate compound and in the absence of the candidate compound, where a change in the binding between TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, TNFR-1B and ISLR2, and/or B7-1 and ISLR2 in the presence of the candidate compound indicates that the candidate compound modulates the interaction between TNFR-1B and ICOS-L, TNFR-1B and MadCAM-1, TNFR-1B and ISLR2, and/or B7-1 and ISLR2.
(18) The compound can be, for example, a non-naturally occurring small molecule of 2,000 daltons or less, or an antibody or an antibody fragment.
(19) Also provided is a method for screening for a candidate compound for treating a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease, the method comprising testing a modified TNFR-1B compound or mutant to determine if the modified TNFR-1B compound or mutant has modified binding affinity for one or more of ICOS-L, MadCAM-1 and ISLR2, wherein a modified TNFR-1B compound or mutant that is tested and determined to have modified binding affinity for one or more of ICOS-L, MadCAM-1 and ISLR2 is a candidate compound for treating a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease.
(20) In some embodiments, the modified TNFR-1B compound or mutant recognizes TNF-alpha, but not one or more of ICOS-L, MadCAM-1 and ISLR2. In some embodiments, the modified TNFR-1B compound or mutant recognizes ICOS-L, but not one or more of TNF-alpha, MadCAM-1 and ISLR2. In some embodiments, the modified TNFR-1B compound or mutant recognizes MadCAM-1, but not one or more of TNF-alpha, ICOS-L, and ISLR2. In some embodiments, the modified TNFR-1B compound or mutant recognizes ISLR2, but not one or more of TNF-alpha, ICOS-L, and MadCAM-1. In some embodiments, the modified TNFR-1B compound or mutant recognizes ICOS-L and MadCAM-1, but not TNF-alpha or ISLR2. In some embodiments, the compound or mutant has enhanced affinities for all ligands compared to TNFR-1B. In some embodiments, the compound or mutant has enhanced affinities for some ligands compared to TNFR-1B. In some embodiments, the compound or mutant has reduced affinities for some ligands compared to TNFR-1B. In some embodiments, the compound or mutant has enhanced affinities for some ligands compared to TNFR-1B and reduced affinities for some ligands compared to TNFR-1B. In some embodiments, the compound or mutant recognizes only one ligand.
(21) In one embodiment, the fusion protein that links the protein for tumor necrosis factor (TNF) receptor 1B (TNFR-1B) to the protein for Immunoglobulin (Ig)G1 Fc is encoded by the following nucleic acid sequence:
(22) TABLE-US-00001 (SEQIDNO:1) ATGGGCGTGCACGAGTGCCCCGCCTGGCTGTGGCTGCTGCTGAGCCTG CTGAGTCTACCTCTCGGCCTGCCTGTGCTAGGCTTGCCCGCCCAGGTG GCATTTACACCCTACGCCCCGGAGCCCGGGAGCACATGCCGGCTCAGA GAATACTATGACCAGACAGCTCAGATGTGCTGCAGCAAATGCTCGCCG GGCCAACATGCAAAAGTCTTCTGTACCAAGACCTCGGACACCGTGTGT GACTCCTGTGAGGACAGCACATACACCCAGCTCTGGAACTGGGTTCCC GAGTGCTTGAGCTGTGGCTCCCGCTGTAGCTCTGACCAGGTGGAAACT CAAGCCTGCACTCGGGAACAGAACCGCATCTGCACCTGCAGGCCCGGC TGGTACTGCGCGCTGAGCAAGCAGGAGGGGTGCCGGCTGTGCGCGCCG CTGCGCAAGTGCCGCCCGGGCTTCGGCGTGGCCAGACCAGGAACTGAA ACATCAGACGTGGTGTGCAAGCCCTGTGCCCCGGGGACGTTCTCCAAC ACGACTTCATCCACGGATATTTGCAGGCCCCACCAGATCTGTAACGTG GTGGCCATCCCTGGGAATGCAAGCATGGATGCAGTCTGCACGTCCACG TCCCCCACCCGGAGTATGGCCCCAGGGGCAGTACACTTACCCCAGCCA GTGTCCACACGATCCCAACACACGCAGCCAACTCCAGAACCCAGCACT GCTCCAAGCACCTCCTTCCTGCTCCCAATGGGCCCCAGCCCCCCAGCT GAAGGGAGCACTGGCGACGAGCCCAAATCTTGTGACAAAACTCACACA TGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTC CTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCT GAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTC AAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACA AAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTC CTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGC AAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCC AAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCA TCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTC AAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCCCCGGGTAAATAG.
(23) The amino acid sequence of the TNFR-1B Fc fusion encoded by the nucleotide sequence of SEQ ID NO:1 is:
(24) TABLE-US-00002 (SEQIDNO:2) MGVHECPAWLWLLLSLLSLPLGLPVLGLPAQVAFTPYAPEPGSTCRLR EYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVP ECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAP LRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNV VAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPST APSTSFLLPMGPSPPAEGSTGDEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK.
(25) The nucleic acid sequence of the TNFR-1B construct used as the template for mutagenesis is:
(26) TABLE-US-00003 (SEQIDNO:3) ACCATGGGCGTGCACGAGTGCCCCGCCTGGCTGTGGCTGCTGCTGAGC CTGCTGAGTCTACCTCTCGGCCTGCCTGTGCTAGGCTTGCCCGCCCAG GTGGCATTTACACCCTACGCCCCGGAGCCCGGGAGCACATGCCGGCTC AGAGAATACTATGACCAGACAGCTCAGATGTGCTGCAGCAAATGCTCG CCGGGCCAACATGCAAAAGTCTTCTGTACCAAGACCTCGGACACCGTG TGTGACTCCTGTGAGGACAGCACATACACCCAGCTCTGGAACTGGGTT CCCGAGTGCTTGAGCTGTGGCTCCCGCTGTAGCTCTGACCAGGTGGAA ACTCAAGCCTGCACTCGGGAACAGAACCGCATCTGCACCTGCAGGCCC GGCTGGTACTGCGCGCTGAGCAAGCAGGAGGGGTGCCGGCTGTGCGCG CCGCTGCGCAAGTGCCGCCCGGGCTTCGGCGTGGCCAGACCAGGAACT GAAACATCAGACGTGGTGTGCAAGCCCTGTGCCCCGGGGACGTTCTCC AACACGACTTCATCCACGGATATTTGCAGGCCCCACCAGATCTGTAAC GTGGTGGCCATCCCTGGGAATGCAAGCATGGATGCAGTCTGCACGTCC ACGTCCCCCACCCGGAGTATGGCCCCAGGGGCAGTACACTTACCCCAG CCAGTGTCCACACGATCCCAACACACGCAGCCAACTCCAGAACCCAGC ACTGCTCCAAGCACCTCCTTCCTGCTCCCAATGGGCCCCAGCCCCCCA GCTGAAGGGAGCACTGGCGACTTCGCTCTTCCAGTTGGACTGATTGTG GGTGTGACAGCCTTGGGTCTACTAATAATAGGAGTGGTGAACTGTGTC ATCATGACCCAGGTGAAAAAGAAGCCCTTGTGCCTGCAGAGAGAAGCC AAGGTGCCTCACTTGCCTGCCGATAAGGCCCGGGGTACACAGGGCCCC GAGCAGCAGCACCTGCTGATCACAGCGCCGAGCTCCAGCAGCAGCTCC CTGGAGAGCTCGGCCAGTGCGTTGGACAGAAGGGCGCCCACTCGGAAC CAGCCACAGGCACCAGGCGTGGAGGCCAGTGGGGCCGGGGAGGCCCGG GCCAGCACCGGGAGCTCAGATTCTTCCCCTGGTGGCCATGGGACCCAG GTCAATGTCACCTGCATCGTGAACGTCTGTAGCAGCTCTGACCACAGC TCACAGTGCTCCTCCCAAGCCAGCTCCACAATGGGAGACACAGATTCC AGCCCCTCGGAGTCCCCGAAGGACGAGCAGGTCCCCTTCTCCAAGGAG GAATGTGCCTTTCGGTCACAGCTGGAGACGCCAGAGACCCTGCTGGGG AGCACCGAAGAGAAGCCCCTGCCCCTTGGAGTGCCTGATGCTGGGATG AAGCCCAGTGGTGGCGGAAGCGAGAACCTGTACTCCAGT.
(27) The amino acid sequence of full-length TNFR-1B is:
(28) TABLE-US-00004 (SEQIDNO:4) PAQVAFTPYAPEPGSTCR LREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNW VPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLC AOLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQIC NVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEP STAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNC VIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSS SLESSASALDFRAPTRNQPQAPGVEASGAGEARASTGSSDSSPGGHGT QVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSK EECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS(human, NCBIRef.Seq.NP_001057.1)(22aminoacid signalpeptidein
.
Note that the numbering of the mutagenesis positions starts after removal of the signal peptide. Therefore, position 1=L, position 2=P, position 3=A, etc.
(29) The compound or mutant can also be a candidate for treating any disease or disorder mediated by TNF.
(30) Also provided are mutants of TNFR-1B that modulates the binding of TNFR-1B to one or more of TNF, ICOS-L and MadCAM-1. Such mutants include, for example, mutants K42D, T48A, N171D, S79D, R113D, L114A, R119D, K120D, D58A, R19D, S59D, L64D, R77A, S107D, R119A, K120A, R129A, V138D, K140A, I156D, I168D, N171A and M174D. Mutants K42D, T48A and N171D, for example, compared to TNFR-1B, have reduced binding to TNF, ICOS-L and MadCAM-1. Mutants S79D, R113D, L114A, R119D and K120D, for example, compared to TNFR-1B, have reduce binding to ICOS-L and MadCAM-1, but not to TNF. Mutant D58A, for example, compared to TNFR-1B, has reduced binding to TNF and ICOS-L, but not to MadCAM-1. Mutants R19D, S59D, L64D, R77A, S107D, R119A, K120A, R129A, V138D, K140A, I156D, I168D, N171A and M174D, for example, compared to TNFR-1B, predominately have reduced binding to MadCAM-1.
(31) Also provided are fusion proteins comprising mutants of TNFR-1B that modulate the binding of TNFR-1B to one or more of TNF, ICOS-L and MadCAM-1, and an immunoglobulin Fc sequence. In an embodiment, the immunoglobulin is an IgG. In an embodiment, the IgG is an IgG1 or IgG2 or IgG3 or IgG4 or IgM. Preferably, the immunoglobulin is IgG1. Preferably, the Fc domain has the same sequence or 95% or greater sequence identity with a human IgG1 Fc domain. Immunoglobulin Fc sequences are well known in the art. In an embodiment, the term Fc sequence herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc sequence of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. In an embodiment, the C-terminal lysine of the Fc may be removed, for example, during production or purification, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
(32) In a fusion protein, the presence of the Fc domain markedly increases the plasma half-life of the attached protein, which prolongs therapeutic activity. In addition, the Fc domain also enables the fusion protein to interact with Fc-receptors.
(33) In an embodiment, the Fc domain is linked via a peptide linker that permits flexibility. In an embodiment, the linker is rigid. In an embodiment the linker is cleavable. Non-limiting examples of flexible linkers are Gn, and GGGGS, and (GGGGS)n where n=2, 3, 4 or 5. Non-limiting examples of rigid linkers are (EAAAK)n, (XP)n. Non-limiting examples of cleavable linkers include disulfide links and protease cleavable linkers.
(34) In an embodiment, the fusion protein described herein is recombinantly produced. In an embodiment, the fusion protein is produced in a eukaryotic expression system. In an embodiment, the fusion protein produced in the eukaryotic expression system comprises glycosylation at a residue on the Fc portion.
(35) Also provided are pharmaceutical compositions comprising any of the fusion proteins disclosed herein and a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers are well known in the art. Pharmaceutically acceptable carriers that can be used herewith encompasses any of the standard pharmaceutical carriers or diluents, such as, for example, a sterile isotonic saline, phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsions.
(36) Also provided are methods for treating a subject with a disease or disorder selected from the group consisting of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, plaque psoriasis, juvenile idiopathic arthritis, inflammation, autoimmune disease, immune disorder, Crohn's disease, ulcerative colitis and inflammatory bowel disease, the methods comprising administering to the subject any of the fusion proteins disclosed herein in an amount effective to alleviate a sign or symptom of the disease or disorder.
(37) As used herein, to treat a disease or disorder means to alleviate or ameliorate or eliminate a sign or symptom of the disease or disorder that is being treated.
(38) Fusion proteins can be administered to subjects using routes of administration known in the art. The administration can be systemic or localized to a specific site. Routes of administration include, but are not limited to, intravenous, intramuscular, intrathecal or subcutaneous injection, and transdermal administration, and injection into a specific site.
(39) All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
(40) This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specifics discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
(41) Introduction
(42) ENBREL (etanercept) is a fusion protein that links the protein for tumor necrosis factor (TNF) receptor 1B (TNFR-1B) to the protein for Immunoglobulin (Ig)G1 Fc. ENBREL (etanercept) is a leading anti-inflammatory drug. This disclosure describes interactions and pathways that are of immediate therapeutic importance and provides strategies for the design of ENBREL (etanercept) variants with engineered selectivities, which recognize only a subset of its potential ligands, or exhibit increased or reduced affinities for all or subsets of its potential ligands, for the realization of more effective biologics with reduced side effects.
(43) Methods and Results
(44) Data are provided showing results from cell-cell Fluorescence-Activated Cell Sorting (FACS)-based screens utilizing a 400 member secreted protein library, which contains most members of the human Immunoglobulin (Ig) superfamily and the human Tumor Necrosis Factor Receptor (TNFR) superfamily. In this library, all ectodomains were fused to the mouse PD-L1 transmembrane segment, with covalent linkage to cytoplasmic GFP as a proxy marker for expression. The human erythropoietin (EPO) signal sequence was used to direct secretion of all constructs. These screening efforts revealed a remarkable network of interactions, which demonstrate the coupling of a range of immune and neural regulatory pathways (Table 1). Screening with cells expressing ICOS-L resulted in the identification of two of its known binding partners, CD28 and CTLA-4 [1], as well as a novel interaction with TNFR-1B. Screening the library with cells expressing TNFR-1B resulted in the identification of three novel interacting proteins, ICOS-L, MadCAM-1 and ISLR2 (
(45) Further validation studies were performed for the TNFR-1B interactions. Cell-cell FACS assays using cells expressing full-length native versions (i.e., containing native transmembrane and cytoplasmic segments) of TNFR-1B, ICOS-L and MadCAM-1 were fully consistent with the original screen (
(46) Using a high-throughput cell-cell screen, ICOS-L, MadCAM-1 and ISLR2 were identified as three novel ligands of TNFR-1B. To further evaluate these interactions, two different in vitro assays that utilize purified protein reagents were used. The first was a soluble protein-binding assay in which Fc-fusion protein (IgG1 control, ENBREL (etanercept, a IgG1 fusion of TNFR-1B) or ICOS-L IgG1) was added directly to HEK 293 cells expressing a panel of cell surface receptors (
(47) It was also examined whether specific mutants of TNFR-1B could be identified that exhibited selective, enhanced and/or reduced recognition of its multiple ligands. A panel of 71 TNFR-1B point mutants was generated and screened for binding to TNF, ICOS-L and MadCAM-1 using the cell-cell FACS assay (
(48) These data suggest that the binding sites for ICOS-L and MadCAM-1 on TNFR-1B overlap, at least in part, that of TNF. They also demonstrate the feasibility of generating TNFR-1B variants with engineered properties/selectivities (e.g., high selectivity for only TNF, or other subsets of ligands with increased or decreased affinities).
(49) A cell based competition binding experiment was used to determine whether ENBREL (etanercept) could block ICOS-L interactions with CTLA-4 and CD28(
(50) In a subsequent experiment, human peripheral T-cells were isolated from four individual donors and used in in vitro T-cell activation experiments (
(51) With the goal of generating a mouse model to examine the ICOS-L: TNFR-1B dependent effects in vivo, mouse constructs of both TNFR-1B and ICOS-L were tested. Unfortunately the mouse orthologs of ICOS-L and TNFR-1B do not bind to one another nor does ENBREL (etanercept) bind to mouse ICOS-L (data not shown). The mouse versus human percent identify for ICOS-L and TNFR-1B are 45% and 63%, respectively, so it is perhaps not surprising that the binding phenotype is different. Orthologs of ICOS-L and TNFR-1B were next examined from rhesus monkey (Macca mulatta), which shares 91% and 96% homology with human, respectively. Binding was examined in the cell-cell FACS binding assay and significant binding observed between monkey ICOS-L and mTNFR-1B as well as the monkey proteins and their human counterparts, indicating a usefulness of monkey models of autoimmune disease.
DISCUSSION
(52) ICOS-L is the ligand for the inducible costimulatory molecule (ICOS), which controls a major T cell costimulatory pathway that represents a significant therapeutic target. ICOS-L is a major immune regulatory ligand expressed on monocytes, dendritic cells, and B cells, as well as other antigen presenting cells. Expression of ICOS-L on B-cells plays a significant role in the production of antibodies within the germinal center and is necessary for the development of rheumatoid arthritis [2, 3]. Expression of ICOS-L in dendritic cells has been increasingly associated with Crohn's disease and ulcerative colitis [4, 5]. Interestingly, in a subset of cell types (B-cells, monocytes, lung epithelial cells), TNF-alpha induces ICOS-L expression via activation of the NFKappaB pathway [6]. The present data demonstrating a direct interaction between ICOS-L and TNFR-1B suggests the presence of additional cross talk between the ICOS-L/ICOS and TNF-alpha/TNFR-1B pathways, which potentially impacts both therapeutic mechanisms and treatment strategies.
(53) MadCAM-1, mucosal vascular addressin cell adhesion molecule 1, also known as addressin, is an endothelial cell adhesion molecule from the Ig superfamily that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4/beta7), L-selectin, and VLA-4 (alpha4/beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues [7]. MadCAM-1 expression is elevated in the intestinal tissue of both Crohn's disease and ulcerative colitis patients, but was more abundant and appeared in deeper tissues in patients with Crohn's disease [7]. The present results are the first indication of an association between MadCAM-1 and TNFR-1B. Notably, the ICOS-L [8-10] and MadCAM-1 [11] pathways are both themselves active targets for immunotherapy.
(54) ISLR-2 (Immunoglobulin superfamily containing leucine-rich repeat protein 2) is believed to interact with TrkA and Ret receptor tyrosine kinases to regulate axonal extension, guidance and branching during neural development [13].
(55) These interactions are of considerable clinical importance as soluble TNFR-1B is marketed as ENBREL (etanercept), a leading treatment for rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis in adults, as well as juvenile idiopathic arthritis in children. The mechanism of action of ENBREL (etanercept) is thought to be the targeting and binding of TNF, which results in the blockade of the TNF-mediated signaling pathways and an associated global inhibition of immune responsiveness [14, 15]. The identification of these additional off-target interactions for TNFR-1B may provide new insights into the mechanisms of ENBREL (etanercept) function, including its range of effective clinical indications and its considerable deleterious side effects, and offer the opportunity to develop second generation ENBRELs with enhanced potency and reduced side effects. Furthermore, the involvement of both ICOS-L and MadCAM-1 in the onset of Crohn's disease, inflammatory bowel disease and ulcerative colitis suggests that development of new ENBREL proteins with altered activity for one or both of these targets might create a therapeutic agent better suited to treat these diseases than the currently marketed ENBREL (etanercept), which has been proven less effective in their treatment of these particular diseases [12].
(56) The present study identified new TNFR-1B interactors and demonstrated that TNFR-1B is a naturally occurring multi-specific receptor. This multi-specificity offers new opportunities for therapy (based, e.g., on the functional significance of interactions between TNFR-1B and TNF, ICOS-L or MadCAM-1). The present approach provides the identification of new networks of interactions that impact this biology. These findings enable generation of TNFR-1B variants with novel properties and selectivities. This includes, but is not limited to, TNFR-1B variants which only recognize one ligand (e.g., TNFa, or MadCAM-1, or ICOS-L, or ISLR2), or with enhanced affinities for all ligands, or with reduced affinities for all ligands, or with enhanced affinities for some ligands (e.g., to provide more effective multi-specific reagents), or with reduced affinities for some ligands (e.g., to provide more effective multi-specific reagents). These variants can be identified by large-scale mutagenesis. Using single point mutants, it was demonstrated that considerable modulation of selectivity can be achieved (
(57) TABLE-US-00005 TABLE 1 Signaling networks defined by this disclosure. Newly Discovered in this Disclosure Previously Reported interactions TNFR-1B:ICOS-L TNFR-1B:TNF- ICOS-L:CD28; ICOS-L:CTLA-4; ICOS-L:ICOS TNFR-1B:MadCAM-1 MadCAM-1:LPAM-1integrin; MadCAM-1:L-selectin; MadCAM-1:VLA-4 TNFR-1B:ISLR2 ISLR2:TrkA RTK; ISLR2:Ret RTK B7-1:ISLR2 B7-1:CTLA-4; B7-1:CD28; B7-1:PD-L1; B7-1:NGFR
REFERENCES
(58) 1. Yao S, Zhu Y, Zhu G, Augustine M, Zheng L, Goode D J, Broadwater M, Ruff W, Flies S, Xu H et al: B7-h2 is a costimulatory ligand for CD28 in human. Immunity 2011, 34(5):729-740. 2. Liu D, Xu H, Shih C, Wan Z, Ma X, Ma W, Luo D, Qi H: T-B-cell entanglement and ICOSL-driven feed-forward regulation of germinal centre reaction. Nature 2015, 517(7533):214-218. 3. Hamel K M, Cao Y, Olalekan S A, Finnegan A: B cell-specific expression of inducible costimulator ligand is necessary for the induction of arthritis in mice. Arthritis & rheumatology 2014, 66(1):60-67. 4. Xin L, Jiang T T, Chaturvedi V, Kinder J M, Ertelt J M, Rowe J H, Steinbrecher K A, Way S S: Commensal microbes drive intestinal inflammation by IL-17-producing CD4+ T cells through ICOSL and OX40L costimulation in the absence of B7-1 and B7-2. Proceedings of the National Academy of Sciences of the United States of America 2014, 111 (29): 10672-10677. 5. Hedl M, Lahiri A, Ning K, Cho J H, Abraham C: Pattern recognition receptor signaling in human dendritic cells is enhanced by ICOS ligand and modulated by the Crohn's disease ICOSLG risk allele. Immunity 2014, 40(5):734-746. 6. Richter G, Hayden-Ledbetter M, Irgang M, Ledbetter J A, Westermann J, Korner I, Daemen K, Clark E A, Aicher A, Pezzutto A: Tumor necrosis factor-alpha regulates the expression of inducible costimulator receptor ligand on CD34(+) progenitor cells during differentiation into antigen presenting cells. The Journal of biological chemistry 2001, 276(49):45686-45693. 7. Arihiro S, Ohtani H, Suzuki M, Murata M, Ejima C, Oki M, Kinouchi Y, Fukushima K, Sasaki I, Nakamura S et al: Differential expression of mucosal addressin cell adhesion molecule-1 (MadCAM-1) in ulcerative colitis and Crohn's disease. Pathology international 2002, 52(5-6):367-374. 8. Fu T, He Q, Sharma P: The ICOS/ICOSL pathway is required for optimal antitumor responses mediated by anti-CTLA-4 therapy. Cancer research 2011, 71(16):5445-5454. 9. Pan X C, Guo L, Deng Y B, Naruse K, Kimura H, Sugawara Y, Makuuchi M: Further study of anti-ICOS immunotherapy for rat cardiac allograft rejection. Surgery today 2008, 38(9):815-825. 10. Nelson M H, Kundimi S, Bowers J S, Rogers C E, Huff L W, Schwartz K M, Thyagarajan K, Little E C, Mehrotra S, Cole D J et al: The Inducible Costimulator Augments Tc17 Cell Responses to Self and Tumor Tissue. Journal of immunology 2015. 11. Ueha S, Murai M, Yoneyama H, Kitabatake M, Imai T, Shimaoka T, Yonehara S, Ishikawa S, Matsushima K: Intervention of MadCAM-1 or fractalkine alleviates graft-versus-host reaction associated intestinal injury while preserving graft-versus-tumor effects. Journal of leukocyte biology 2007, 81(1):176-185. 12. Sandborn W J, Hanauer S B, Katz S, Safdi M, Wolf D G, Baerg R D, Tremaine W J, Johnson T, Diehl N N, Zinsmeister A R: Etanercept for active Crohn's disease: a randomized, double-blind, placebo-controlled trial. Gastroenterology 2001, 121(5):1088-1094.