FUSION PROTEIN
20200216513 ยท 2020-07-09
Inventors
- Heidrun Degen (Martinsried, DE)
- Silvia Goebel (Martinsried, DE)
- Kristin Adler (Martinsried, DE)
- Martin Ungerer (Martinsried, DE)
Cpc classification
C12Y306/01005
CHEMISTRY; METALLURGY
C07K19/00
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C07K14/70596
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
C12R2001/01
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to a fusion protein selectively binding collagen and having ectonucleotidase activity. The fusion protein comprises an amino acid sequence of the extracellular domain of glycoprotein VI fused via a first linker sequence to the N-terminus of an amino acid sequence of an Fc region, whereby the C-terminus of the Fc region is linked via a second linker sequence to an amino acid sequence of the extracellular domain of a CD39 protein.
The fusion protein is useful in the treatment or prevention of cardiovascular disease or diabetes, such as in the treatment of acute atherothrombotic events with a favorable risk-benefit ratio.
Claims
1. A fusion protein selectively binding collagen and having ectonucleotidase activity, which comprises an amino acid sequence of the extracellular domain of glycoprotein VI fused via a first linker sequence to the N-terminus of an amino acid sequence of an Fe region, whereby the C-terminus of the Fc region is linked via a second linker sequence to an amino acid sequence of the extracellular domain of a CD39 protein, the fusion protein comprising (a) an amino acid sequence of the extracellular domain of human glycoprotein VI at least 90% identical to SEQ ID NO: 2; (b) an amino acid sequence of an Fc region at least 90% identical to SEQ ID NO: 3; (c) an amino acid sequence of a CD39 protein at least 90% identical to SEQ ID NO: 4; and/or (d) an amino acid sequence of the second linker at least 90% identical to SEQ ID NO: 5.
2. The fusion protein according to claim 1, produced from a host cell deposited with DMSZ under Accession Number DSM ACC3322 (identification reference CHO GPVI-Fc-linker-CD39).
3. The fusion protein according to claim 1, wherein the second linker sequence comprises at least five amino acid residues.
4. The fusion protein according to claim 1, which is a dimer.
5. The fusion protein according to claim 1, which has at least 75% identity with amino acid sequence of SEQ ID No.: 1.
6. A polynucleotide comprising a nucleotide sequence that encodes a fusion protein as defined in claim 1.
7. The polynucleotide according to claim 6, which is selected from the group consisting of: a) a polynucleotide having a nucleotide sequence at least 60% identical to SEQ ID NO: 6; b) a polynucleotide having a nucleotide sequence encoding an amino acid sequence at least 60% identical to SEQ ID NO: 1; or c) a polynucleotide having a nucleotide sequence comprising an amino acid sequence at least 60% identical to SEQ ID NO: 2, 3, or 4.
8. An expression vector comprising a promoter operably associated with the polynucleotide defined in claim 6 or 7.
9. A host cell line transformed or transfected with a polynucleotide as defined by claim 6.
10. The host cell line according to claim 9, which is a stable mammalian cell line, preferably a CHO cell line CHO GPVI-Fc-linker-CD39 deposited with DSMZ under Accession Number DSM ACC 3322 (identification reference CHO GPVI-Fc-linker-CD39).
11. A pharmaceutical composition comprising the fusion protein as defined in claim 1, and a pharmaceutically acceptable carrier.
12. The fusion protein according to claim 1 for use in a method for the treatment of the human or animal body by therapy or a diagnostic method practiced on the human or animal body.
13. The fusion protein according to claim 1 for use in the treatment or prevention of cardiovascular disease or diabetes.
14. A process for the preparation of a fusion protein, which comprises: (a) transforming a host cell comprising at least one vector of claim 9; (b) culturing the transformed host cell in suitable conditions for expression of the fusion protein; and (c) isolating the fusion protein.
Description
DESCRIPTION OF THE FIGURES
[0038]
[0039] A: Structure (left panel) and putative 3D-modelling (right panel) of bifunctional, recombinant GPVI-CD39 compared to GPVI-Fc. The 3D model shows the extracellular GPVI domains in blue, the Fc part in green, and the CD39 domain in light red. The N-terminal leader peptides of each protein are cleaved before secretion of each protein.
[0040] B: Coomassie staining of GPVI-CD39 as purified from supernatants of GPVI-CD39-expressing cells (left column, nr: non-reducing conditions; right column, r: reducing conditions).
[0041] C: Specific ADPase activity of recombinant GPVI-CD39 (333 nmol/L) in comparison to that of commercially available soluble CD39 (666 nmol/L) (n=3, meanSEM). Both specific activities were determined at other enzyme molarities and did not differ, as expected, because substrate concentrations were not limiting.
[0042]
[0043] A: Platelet aggregation after stimulation with 12 g/mL collagen extracted from rabbit aorta. Pre-incubation with increasing concentrations of GPVI-CD39 reduces platelet aggregation more strongly than GPVI-Fc alone (n=5; **p<0.01 and ***p<0.001 as compared to GPVI-Fc).
[0044] B: Platelet aggregation after stimulation with 103 g/ml collagen from cultured human fibroblasts (VitroCol), as determined by impedance aggregometry. Pre-incubation with increasing concentrations of GPVI-CD39 reduces platelet aggregation more strongly than GPVI-Fc alone (n=5; *p<0.05 and **p<0.01 as compared to GPVI-Fc).
[0045] C: Platelet aggregation after stimulation with 6.5 mol/L ADP. Pre-incubation with increasing concentrations of either GPVI-CD39 (n=8) or of soluble CD39 markedly reduces ADP-induced platelet aggregation, whereas GPVI-Fc alone has no effect (**p<0.01 and ***p<0.001).
[0046]
[0047] Administration of 3 mg/kg (10 nmol/kg) GPVI-CD39 strongly delayed ferric chloride-induced thrombus formation in vivo, as compared to administration of 1.5 mg/kg (10 nmol/kg) GPVI-Fc or vehicle only. Mean values of 7 independent experiments are shown with SEM. **p<0.01 by ANOVA.
[0048]
[0049] A: Effects of ticagrelor, GPVI-CD39, GPVI-Fc or ASA at the indicated concentrations on closure times in collagen/ADP cartridges (n=8 samples from independent donors). No significant differences between groups occurred.
[0050] B: Effects of ticagrelor, GPVI-CD39, GPVI-Fc or ASA at the indicated concentrations on closure times in collagen/epinephrine cartridges (n=8 samples from independent donors). No significant differences between results for GPVI-CD39 and GPVI-Fc occurred. Closure time was significantly (p=0.04) prolonged after addition of ASA compared to buffer PBS only.
[0051] C: Effects of ticagrelor, GPVI-CD39, GPVI-Fc or ASA at the indicated concentrations on closure times in specific P2Y cartridges (n=8 samples from independent donors; **p<0.01 and ***p<0.001 versus PBS only).
[0052]
[0053] A: plasma concentrations in mice up to 48 hours after administration of GPVI-CD39 or Fc control protein.
[0054] Blood samples were taken at the indicated times after IV administration of 4 mg/kg (13 nmol/kg) GPVI-CD39, and plasma levels were detected by ELISA. Means+/SEM are shown. (n=3 animals).
[0055] B: ADPase activities in mice up to 48 hours after administration of GPVI-CD39 or Fc controls.
[0056] Blood samples were taken at the indicated times after IV administration of either 4 mg/kg GPVI-CD39 (13 nmol/kg, corresponding to 26 nmol/kg ADPase moieties) or 26 nmol/kg solCD39, and ADP turnover (means+/SEM) was measured by using a malachite green phosphate detection kit. Time is shown at a logarithmic scale to visualise decrease in activity during early time points (n=3 animals).
[0057] C: tail bleedings times
[0058] Tails were incised 15 minutes after IV administration of the indicated doses of GPVI-CD39, GPVI-Fc or buffer, and tail bleeding times were determined.
[0059] Mean values of 8 independent experiments are shown with SEM. No significant differences between groups occurred.
[0060]
DETAILED DESCRIPTION OF THE INVENTION
[0061] The present invention relates generally to fusion proteins, polynucleotides encoding fusion proteins, and describes methods of treating, preventing, or ameliorating diseases or disorders using fusion proteins.
Definitions
[0062] The following definitions are provided to facilitate understanding of certain terms used throughout this specification.
[0063] As used herein, fusion protein refers to a protein formed by fusing the N-terminus of at least one molecule of an Fc portion (or fragment or variant thereof) via a first linker head-to-tail to at least one molecule of the extracellular domain of glycoprotein VI (or a fragment or variant thereof) and the C-terminus of at least one molecule of an Fc portion (or fragment or variant thereof) head-to-tail via a second linker to an extracellular domain of a CD39 protein (or fragment or variant thereof). A fusion protein of the invention comprises an amino acid sequence selected from (a) the amino acid sequence of SEQ ID NO: 1; (b) a variant of (a) which is at least 90% identical to the amino acid sequence of SEQ ID NO: 1, wherein said variant selectively binding collagen and having ectonucleotidase activity; (c) a fragment wherein said fragment selectively binding collagen and having ectonucleotidase activity and comprising the amino acid sequence of SEQ ID NO: 2, 3, or 4, or a variant the amino acid sequence of which is at least 90% identical to the amino acid sequence of SEQ ID NO: 2, 3, or 4, or (d) a fusion protein expressed by the cell line GPVI-Fc-linker-CD39 as deposited with Leibniz-Institut DSMZ. The GPVI, Fc and CD39 portions and the first and second linker of the fusion protein of the present invention are associated with one another by genetic fusion, whereby the fusion protein is generated by translation of a nucleic acid in which a polynucleotide encoding all or a portion of an extracellular domain of GPVI, is joined in-frame with a polynucleotide encoding a first linker, an Fc portion, a second linker, and CD39 portions.
[0064] A fusion protein of the invention may be processed by a host cell and secreted into the culture medium. Processing of the nascent fusion protein that occurs in the secretory pathways of the host cell may include signal peptide cleavage, assembly into dimeric proteins, formation of disulfide bonds, proper folding, and addition and processing of carbohydrates by N- and O-linked glycosylation. A fusion protein of the invention is preferably in the processed form. The processed form of a fusion protein refers to a fusion protein product which has undergone N-terminal signal peptide cleavage (mature fusion protein).
[0065] As used herein, polynucleotide refers to a nucleic acid molecule having a nucleotide sequence encoding a fusion protein comprising at least one molecule of the extracellular domain of glycoprotein VI (or a fragment or variant thereof) joined in frame via a first linker sequence to an Fc portion (or fragment or variant thereof), joined in frame via a second linker sequence to an extracellular domain of a CD39 protein (or fragment or variant thereof); a nucleic acid molecule having a nucleotide sequence encoding a fusion protein comprising the amino acid sequence of SEQ ID NO: 1 or a fragment or variant thereof; a nucleic acid molecule having a nucleotide sequence comprising the sequence shown in SEQ ID NO:6; a nucleic acid molecule having a nucleotide sequence encoding a fusion protein comprising the amino acid sequence of SEQ ID NO: 2, 3, 4, or 5; a nucleic acid molecule having a nucleotide sequence encoding a fusion protein of the invention generated as described in the Examples; a nucleic acid molecule having a nucleotide sequence encoding a fusion protein of the invention; or a polynucleotide having a nucleotide sequence contained in a fusion construct in the cell line CHO GPVI-Fc-linker-CD39 as deposited with Leibniz-lnstitut DSMZ.
[0066] As used herein, fusion construct refers to a nucleic acid molecule comprising, a polynucleotide according to the present invention and further comprising one or more of the following elements: (1) a region for initiation of transcription (e.g., a promoter region, such as for example, an inducible or regulable promoter, a constitutive promoter), (2) a functional self-replicating vector (including, for example, a shuttle vector, an expression vector, an integration vector, and/or a replication system), (3) a region for termination of transcription, (4) a leader sequence, and (5) a selectable marker.
[0067] By a fusion protein displaying a therapeutic activity or a fusion protein that is therapeutically active is meant a polypeptide fusion protein selectively binding collagen and having ectonucleotidase activity. As used herein, therapeutic activity or activity may refer to an activity whose effect is consistent with a desirable therapeutic outcome in humans, or to desired effects in non-human mammals or in other species or organisms. Therapeutic activity may be measured in vivo or in vitro. For example, a desirable effect may be assayed in cell culture. Such in vitro or cell culture assays are commonly available as described in the art. Examples of assays include, but are not limited to those described herein in the Examples.
[0068] A polypeptide having functional activity refers to a polypeptide capable of displaying one or more known functional activities associated with the full-length, pro-protein, and/or mature form of the fusion protein of the present invention. Such functional activities include, but are not limited to, biological activity, antigenicity, immunogenicity, ability to form multimers, and ability to bind to a receptor or ligand for a polypeptide.
[0069] A polypeptide having biological activity refers to a polypeptide exhibiting activity similar to, but not necessarily identical to, an activity of the fusion protein of the present invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. In the case where dose dependency does exist, it need not be identical to that of the polypeptide, but rather substantially similar to the dose-dependence in a given activity as compared to the polypeptide of the present invention.
[0070] A fusion protein of the present invention has at least one biological and/or therapeutic activity associated with the GPVI or CD39 protein portion (or fragment or variant thereof). The fusion proteins of the present invention can be assayed for therapeutic activity using or routinely modifying assays known in the art, as well as assays described in the Examples.
[0071] The term variant refers to a polynucleotide or polypeptide differing from a reference nucleic acid or polypeptide, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to a reference nucleic acid or polypeptide.
[0072] In a preferred embodiment, a fusion protein of the invention comprises
[0073] (a) an amino acid sequence of the extracellular domain of human glycoprotein VI at least 75% identical to SEQ ID NO: 2;
[0074] (b) an amino acid sequence of an Fc region at least 75% identical to SEQ ID NO: 3;
[0075] (c) an amino acid sequence of a CD39 protein at least 75% identical to SEQ ID NO: 4; and/or
[0076] (d) an amino acid sequence of the second linker at least 75% identical to SEQ ID NO: 5.
[0077] According to a further preferred embodiment, the second linker sequence of the fusion protein according to the present invention consists of at least five amino acid residues.
[0078] According to a further preferred embodiment the fusion protein of the present invention is a dimer.
[0079] According to a further preferred embodiment, the fusion protein according to the present invention has at least 90 percent identity with amino acid sequence of SEQ ID No.: 1.
[0080] Fusion proteins of the invention may be modified by glycosylation, i.e. the attachment of one or more oligosaccharide groups. Glycosylation can affect the physical properties of proteins and may have an effect on protein secretion, stability, and localization. Glycosylation occurs at specific locations along the polypeptide chain. Two major types of glycosylation may be distinguished: glycosylation forming O-linked oligosaccharides attached to serine or threonine residues, and glycosylation forming N-linked oligosaccharides attached to asparagine residues in an Asn-X-Ser or Asn-X-Thr sequence, where X can be any amino acid except proline. Protein structure and cell type may influence the number and nature of the carbohydrate units within the chains at different glycosylation sites. Glycosylation isomers are also common at the same site within a given cell type.
[0081] A fusion protein of the invention, as well as analogs and variants thereof, may be modified so that glycosylation at one or more sites is altered as a result of manipulation of their nucleic acid sequence, by the host cell in which they are expressed, or due to other conditions of their expression. For example, glycosylation isomers may be produced by abolishing or introducing glycosylation sites, e.g., by substitution or deletion of amino acid residues, such as substitution of glutamine for asparagine, or unglycosylated recombinant proteins may be produced by expressing the proteins in host cells that will not glycosylate them.
[0082] The GPVI proteins, CD39 proteins, Fc portion proteins, Revacept (GPVIFc), and nucleic acid and amino acid sequences are well known in the art and available in public databases such as GenBank, Chemical Abstracts Services Databases including the CAS Registry, and GenSeq published by Derwent). Exemplary nucleotide sequences of the GPVI proteins, CD39 proteins, Fc portion proteins, Revacept (GPVIFc), may be used to derive a polynucleotide of the invention. Sequences may be a wild type polynucleotide sequence encoding a given protein. Sequence may be a variant of said wild type polynucleotide sequence. Examples are polynucleotides encoding the wild type protein, wherein the DNA sequence has been optimized for expression in a particular species. Alternatively, variants may be polynucleotides encoding a variant of the wild type protein such as a site directed mutant or an allelic variant.
[0083] A preferred mature fusion protein according to the present invention is a fusion protein having an amino acid sequence of the following SEQ ID NO: 1.
TABLE-US-00001 QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQ AVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITV TAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSSV AEFSEATAELTVSFTNKVFTTETSRSITTSPKESDSPAGPARQYYTKGNG GRVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCK VSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSTQNKALPENV KYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQK VNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRMESEELADR VLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFS IVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYN VYTHSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLY KTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNG IFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEI KTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSD AGWTLGYMLNLTNMIPAEQPLSTPLSHST
[0084] The fusion protein of the present invention preferably contains an amino acid sequence of an extracellular portion of GPVI according to the following SEQ ID NO. 2.
TABLE-US-00002 SEQIDNO.:2 QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQ AVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP GRAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITV TAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSSV AEFSEATAELTVSFTNKVFTTETSRSITTSPKESDSPAGPARQYYTKGN
[0085] The fusion protein of the present invention preferably contains an amino acid sequence of an Fc portion according to the following SEQ ID NO. 3.
TABLE-US-00003 SEQIDNO.:3 VECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK
[0086] The fusion protein of the present invention preferably contains an amino acid sequence of an extracellular portion of a CD 39 protein according to the following SEQ ID NO. 4.
TABLE-US-00004 SEQIDNO:4 TQNKALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVK GPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLL RMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLG KFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNAL QFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGY KKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSY CPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMK KFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHI HFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHST
[0087] The fusion protein of the present invention preferably contains an amino acid sequence of the second linker according to the following SEQ ID NO. 5.
TABLE-US-00005 SEQIDNO:5 GGGGSGGGGSGGGGS
[0088] The present invention further relates to fragments of the fusion protein of the present invention and to polynucleotides encoding fragments of the fusion protein of the present invention.
[0089] A preferred polynucleotide is shown in the following SEQ ID NO. 6:
TABLE-US-00006 SEQIDNO.:6 Polynucleotidesequence(withoutstopcodon): ATGGAAACCCCTGCTCAGCTGCTGTTCCTGCTGCTGCTGTGGCTGCCTGA CACCACCGGCCAGTCCGGACCTCTGCCTAAGCCTTCCCTGCAGGCCCTGC CTTCCTCCCTGGTGCCTCTGGAAAAGCCTGTGACCCTGAGGTGTCAGGGA CCTCCTGGCGTGGACCTGTACCGGCTGGAAAAGCTGTCCTCCAGCAGATA CCAGGACCAGGCCGTGCTGTTCATCCCTGCCATGAAGCGGTCCCTGGCCG GCAGGTACAGGTGCTCCTACCAGAACGGCTCCCTGTGGTCTCTGCCTTCT GACCAGCTGGAACTGGTGGCTACCGGCGTGTTCGCCAAGCCTTCTCTGTC TGCCCAGCCTGGACCTGCTGTCTCCTCTGGAGGCGACGTGACACTGCAGT GCCAGACCAGATACGGCTTCGATCAGTTCGCCCTGTACAAAGAGGGCGAC CCTGCCCCTTACAAGAACCCTGAGCGGTGGTACAGGGCCTCCTTCCCTAT CATCACCGTGACCGCCGCTCACTCCGGCACCTACCGGTGCTACAGCTTCT CCTCCCGGGACCCTTACCTGTGGTCCGCCCCTAGCGACCCTCTCGAACTG GTCGTCACCGGAACCTCCGTGACCCCTTCCAGGCTGCCTACCGAGCCTCC TAGCTCCGTGGCCGAGTTCTCTGAGGCCACCGCCGAGCTGACCGTGTCCT TCACCAACAAGGTGTTCACCACCGAGACATCCCGGTCCATCACCACCTCC CCCAAAGAGTCCGACTCTCCTGCCGGCCCTGCTCGGCAGTACTACACCAA GGGCAACGGCGGCAGAGTGGAGTGTCCTCCTTGCCCTGCCCCTCCTGTGG CTGGCCCTTCCGTGTTCCTGTTCCCTCCAAAGCCTAAGGACACCCTGATG ATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCACGA GGACCCTGAGGTGCAGTTCAATTGGTACGTGGACGGCGTGGAGGTGCACA ACGCCAAGACCAAGCCTCGGGAGGAACAGTTCAACTCCACCTTCCGGGTG GTGTCCGTGCTGACCGTGGTGCACCAGGACTGGCTGAACGGCAAAGAATA CAAGTGCAAGGTGTCCAACAAGGGCCTGCCTGCCCCTATCGAAAAGACCA TCAGCAAGACCAAGGGACAGCCTCGCGAGCCTCAGGTGTACACCCTGCCT CCAAGCCGGGAGGAAATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT CAAGGGCTTCTACCCTTCCGATATCGCCGTGGAGTGGGAGTCTAACGGCC AGCCTGAGAACAACTACAAGACCACCCCTCCTATGCTGGACTCCGACGGC TCCTTCTTCCTGTACTCCAAACTGACCGTGGACAAGTCCCGGTGGCAGCA GGGCAACGTGTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACT ACACCCAGAAGTCCCTGTCCCTGTCTCCTGGCAAGGGTGGAGGCGGTTCA GGCGGAGGTGGCAGCGGCGGTGGCGGATCGACCCAGAACAAGGCCCTGCC TGAGAACGTGAAGTACGGCATCGTGCTGGATGCTGGCTCCTCCCACACCT CCCTGTACATCTACAAGTGGCCTGCCGAGAAAGAAAACGACACCGGCGTG GTGCACCAGGTGGAGGAATGCAGAGTGAAGGGCCCTGGCATCTCCAAGTT CGTGCAGAAAGTGAACGAGATCGGCATCTACCTGACCGACTGCATGGAAC GGGCCAGGGAAGTGATCCCTCGGTCCCAGCATCAGGAAACCCCCGTCTAC CTGGGCGCTACCGCCGGCATGCGGCTGCTGCGGATGGAATCCGAGGAACT GGCCGACAGGGTGCTGGACGTGGTGGAGCGGTCCCTGTCCAACTACCCAT TCGACTTTCAGGGCGCCAGGATCATCACCGGCCAGGAAGAGGGCGCTTAC GGCTGGATCACCATCAACTACCTGCTGGGCAAGTTCTCCCAGAAAACCCG GTGGTTCTCCATCGTGCCCTACGAGACAAACAACCAGGAAACCTTCGGCG CTCTGGATCTGGGCGGAGCCTCTACCCAGGTGACCTTCGTGCCTCAGAAC CAGACCATCGAGTCCCCCGACAACGCCCTGCAGTTCCGGCTGTACGGCAA GGACTACAACGTGTACACCCACAGCTTTCTGTGCTATGGCAAGGACCAGG CCCTGTGGCAGAAGCTGGCCAAGGACATCCAGGTGGCCTCCAACGAGATC CTGCGGGACCCTTGCTTCCACCCTGGCTACAAGAAAGTGGTGAACGTGTC CGACCTGTACAAGACCCCTTGCACCAAGCGGTTCGAGATGACCCTGCCTT TCCAGCAGTTCGAGATCCAGGGCATCGGCAACTACCAGCAGTGCCACCAG TCCATCCTGGAACTGTTCAACACCAGCTACTGCCCTTACTCCCAGTGCGC CTTCAACGGCATCTTCCTGCCCCCTCTGCAGGGCGACTTCGGCGCCTTCT CCGCCTTCTACTTCGTGATGAAGTTCCTGAACCTGACCTCCGAGAAGGTG TCCCAAGAAAAAGTGACCGAGATGATGAAGAAGTTCTGCGCCCAGCCTTG GGAGGAAATCAAGACCTCCTACGCTGGCGTGAAAGAGAAGTACCTGTCCG AGTACTGCTTCTCCGGCACCTACATCCTGTCTCTGCTGCTGCAGGGCTAC CACTTCACCGCCGACTCTTGGGAGCACATCCACTTCATCGGCAAGATCCA GGGAAGCGACGCCGGCTGGACCCTGGGCTACATGCTGAATCTGACCAACA TGATCCCTGCCGAGCAGCCTCTGTCCACCCCTCTGTCCCACTCCACC
[0090] The present invention further provides polypeptides having one or more residues deleted from the N-terminus of the amino acid sequence of a fusion protein of the present invention or an amino acid of any of the GPVI proteins, CD39 proteins, Fc portion proteins corresponding to the GPVI portion, CD39 portion, and Fc portion contained in the fusion protein of the present invention.
[0091] The present invention further provides polypeptides having one or more residues deleted from the carboxy terminus of the amino acid sequence of a fusion protein of the present invention or an amino acid of any of the GPVI proteins, CD39 proteins, Fc portion proteins corresponding to the GPVI portion, CD39 portion, and Fc portion contained in the fusion protein of the present invention.
[0092] Moreover, any of the N- or C-terminal deletions can be combined to produce a N- and C-terminal deleted fusion protein of the present invention. Accordingly, the invention also provides polypeptides having one or more amino acids deleted from both the amino and the carboxyl termini.
[0093] Polynucleotides encoding any of the polypeptides are also encompassed by the invention.
[0094] Whether a particular polypeptide lacking N-terminal residues and/or carboy terminal residues of a complete polypeptide retains such therapeutic activities can readily be determined by routine methods.
[0095] The present invention is also directed to fusion proteins containing polypeptides at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to polypeptide sequence of SEQ ID NO: 1). In preferred embodiments, the application is directed to proteins comprising polypeptides at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to reference polypeptides having the amino acid sequence of N-and C-terminal deletions as described above. Polynucleotides encoding these polypeptides are also encompassed by the invention.
[0096] Preferred polypeptide fragments of the invention are fragments comprising, or alternatively, consisting of, an amino acid sequence that displays therapeutic activity by selectively binding collagen and having ectonucleotidase activity.
[0097] The present invention is also directed to proteins which comprise an amino acid sequence which is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 1, 2, 3, 4, or 5.
[0098] The present invention also provides polypeptides encoded by polynucleotides which hybridize to the complement of a nucleic acid molecule encoding a fusion protein of the invention under the following stringent hybridization conditions:
[0099] Hybridization to filter bound DNA in 6Sodium chloride/Sodium citrate (SSC) at about 45 degrees Celsius, followed by one or more washes in 0.2SSC, 0.1% SDS at about 50-65 degrees Celsius.
[0100] The present invention also provides polypeptides encoded polynucleotides which hybridize to the complement of a nucleic acid molecule encoding a fusion protein of the invention under the following highly stringent conditions:
[0101] Hybridization to filter bound DNA in 6sodium chloride/Sodium citrate (SSC) at about 45 degrees Celsius, followed by one or more washes in 0.1SSC, 0.2% SDS at about 68 degrees Celsius.
[0102] A polypeptide having an amino acid sequence at least, for example, 95% identical to a query amino acid sequence, means that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence such as up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid. These alterations of the reference sequence may occur at the amino- or carboxy-terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
[0103] Sequence identity can be determined by using conventionally known computer programs. A method for global sequence alignment uses the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci. 6:237-245 (1990)). Homology or identity at the nucleotide or amino acid sequence level may be determined by BLAST analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al., Proc. Natl. Acad. Sci. USA 87: 2264-2268 (1990) and Altschul, J. Mol. Evol. 36: 290-300 (1993)).
[0104] The polynucleotide variants of the invention may contain alterations in the coding regions, non-coding regions, or both. Polynucleotide variants can be produced for a variety of reasons such as to optimize codon expression for a particular host.
[0105] Especially preferred are polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. Nucleotide variants produced by silent substitutions due to the degeneracy of the genetic code are preferred. Moreover, polypeptide variants in which less than 50, less than 40, less than 30, less than 20, less than 10, or 5-50, 5-25, 5-10, 1-5, or 1-2 amino acids are substituted, deleted, or added in any combination are also preferred.
[0106] In a preferred embodiment, a polynucleotide of the invention which encodes the fusion protein of the present invention is optimized for expression in mammalian cells such as CHO cells.
[0107] Naturally occurring variants are allelic variants, and refer to one of several alternate forms of a gene occupying a given locus on a chromosome of an organism. Allelic variants can vary at either the polynucleotide and/or polypeptide level and are included in the present invention. Alternatively, non-naturally occurring variants may be produced by mutagenesis techniques or by direct synthesis.
[0108] Using methods of protein engineering and recombinant DNA technology, variants may be generated to improve or alter the characteristics of the polypeptides of the present invention. Moreover, ample evidence demonstrates that variants often retain a biological activity similar to that of the naturally occurring protein.
[0109] The invention provides variants of fusion proteins that have a functional activity. Such variants include deletions, insertions, inversions, repeats, and substitutions selected according to general rules known in the art so as have little effect on activity. Polynucleotides encoding such variants are also encompassed by the invention.
[0110] In preferred embodiments, the variants of the invention have conservative substitutions, which are swaps within groups such as replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and Ile; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gln, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Trp, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly. The resulting mutant molecules can then be tested for functional activity. Amino acid changes are likely to be permissive at certain amino acid positions in the protein as follows. Most amino acid residues buried in the tertiary structure require nonpolar side chains, whereas few features of surface side chains are generally conserved. Tolerated conservative amino acid substitutions involve replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and Ile; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gln, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Trp, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly.
[0111] Besides conservative amino acid substitution, variants of the present invention include (i) polypeptides containing substitutions of one or more of the non-conserved amino acid residues, where the substituted amino acid residues may or may not be one encoded by the genetic code, or (ii) polypeptides containing substitutions of one or more of the amino acid residues having a substituent group, or (iii) polypeptides which have been fused with or chemically conjugated to another compound, such as a compound to increase the stability and/or solubility of the polypeptide (for example, polyethylene glycol), (iv) polypeptide containing additional amino acids, such as, for example, an IgG Fc fusion region peptide. Polypeptide variants containing amino acid substitutions of charged amino acids with other charged or neutral amino acids may produce proteins with improved characteristics, such as less aggregation.
[0112] In specific embodiments, the fusion proteins of the invention comprise, or alternatively, consist of, fragments or variants of the amino acid sequence of SEQ ID No: 1, wherein the fragments or variants have 1-5, 5-10, 5-25, 5-50, 10-50 or 50-150, amino acid residue additions, substitutions, and/or deletions when compared to SEQ ID No: 1. In preferred embodiments, the amino acid substitutions are conservative. Nucleic acids encoding these polypeptides are also encompassed by the invention.
[0113] The polypeptide of the present invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain amino acids other than the 20 gene-encoded amino acids. The polypeptides may be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications.
[0114] The ability of a fusion protein of the invention to bind or compete with a reference protein for binding to ligands such as collagen, ADP or an antibody, various immunoassays known in the art can be used, including but not limited to, competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, agglutination assays (e.g., gel agglutination assays, hemagglutination assays), in situ immunoassays (using colloidal gold, enzyme or radioisotope labels), western blots, precipitation reactions, complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc.
[0115] The ability of the fusion protein of the present invention to multimerize, in particular to dimerize, or association with other components of the multimer can be assayed, for example, by reducing and non-reducing gel chromatography, protein affinity chromatography, and affinity blotting.
[0116] Assays for the ability of the fusion proteins of the present invention to (specifically) bind a specific protein or epitope may be performed in solution (e.g., Houghten, Bio/Techniques 13:412-421(1992)), on beads (e.g., Lam, Nature 354:82-84 (1991)), or on chips (e.g., Fodor, Nature 364:555-556 (1993)).
[0117] Immunoassays which can be used to analyze (immunospecific) binding and cross-reactivity include competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays, (Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York, which is incorporated by reference herein in its entirety).
The Extracellular Domain of Glycoprotein VI (GPVI)
[0118] A fusion protein of the invention comprises an extracellular domain of glycoprotein VI, or a fragment or variant thereof, which is associated with the other portions of the fusion protein by genetic fusion.
[0119] The term extracellular domain of glycoprotein VI refers collectively to GPVI protein or amino acid sequence, or a GPVI fragment or variant, which selectively bind collagen. In particular, extracellular domain of glycoprotein VI refers to human extracellular domain of glycoprotein VI or fragments thereof (see for example, EP1511770) especially the mature form of human extracellular domain of glycoprotein VI as shown in SEQ ID NO: 2, or GPVI from other vertebrates or fragments thereof, or analogs or variants of these molecules or fragments thereof. Preferably, the first linker linking the extracellular domain of glycoprotein VI is linked to the Fc portion is a short linker having 2 to 8 amino acids, in particular a GGR linker.
The Fc Portion
[0120] A fusion protein of the invention comprises an Fc portion, or a fragment or variant thereof, which is associated with the other portions of the fusion protein by genetic fusion.
[0121] The term Fc portion refers collectively to the Fc portion of IgG1 or IgG2 protein or amino acid sequence, or an Fc portion fragment or variant, which is able to dimerize. In particular, Fc refers to human Fc portions or fragments thereof (see for example, EP1511770). Preferably, the Fc portion includes a partial hinge region, and the CH2 and CH3 domain of human IgG1 or IgG2, especially an Fc portion derived from IgG as shown in SEQ ID NO: 3, or Fc portions from other vertebrates or fragments thereof, or analogs or variants of these molecules or fragments thereof.
The Extracellular Domain of CD39 Protein (CD39)
[0122] A fusion protein of the invention comprises, furthermore, an extracellular domain of a CD39 protein, or a fragment or variant thereof, which is associated with the other portions of the fusion protein by genetic fusion.
[0123] The term extracellular domain of CD39 protein refers collectively to CD39 protein or amino acid sequence, or a CD39 fragment or variant, which have ectonucleotidase activity. In particular, extracellular domain of CD39 refers to human CD39 protein or fragments thereof especially the mature form of a human extracellular domain of CD 39 as shown in SEQ ID NO: 4, or from other vertebrates or fragments thereof, or analogs or variants of these molecules or fragments thereof.
[0124] Preferred fusion proteins of the invention are fusion proteins encoded by a nucleic acid molecule comprising, or alternatively consisting of, a polynucleotide encoding at least one molecule of the extracellular domain of GPVI (or a fragment or variant thereof) joined in frame via a first linker sequence to at least one polynucleotide encoding at least one molecule of an Fc portion (or fragment or variant thereof) joined in frame via a second linker sequence to a polynucleotide encoding at least one molecule of the extracellular domain of CD39 (or a fragment or variant thereof).
Preparation of the Fusion Proteins of the Present Invention
[0125] The fusion proteins of the invention may be produced as recombinant molecules by secretion from a mammalian cell line, yeast, or a microorganism such as a bacterium. Preferably, the polypeptide is secreted from the host cells.
[0126] A particular embodiment of the invention comprises a DNA construct encoding a signal sequence effective for directing secretion in a host cell such as a mammalian host cell, particularly a signal sequence of SEQ ID No: 7, and the fusion protein of the invention without any further sequence between the signal and the mature polypeptide.
TABLE-US-00007 SEQIDNO:7 METPAQLLFLLLLWLPDTTG
[0127] The above signal is a preferred example of a mammalian cell derived signal sequence.
[0128] The present invention also relates to a cell line, preferably a mammalian cell line transformed to express a fusion protein of the invention. In addition to the transformed host cell lines, the present invention also relates to a culture of those cells, preferably a monoclonal culture, or a culture derived from a monoclonal culture, in a nutrient medium, wherein the secreted polypeptide is contained in the medium with the cells, or without the cells.
[0129] A representative clone CHO GPVI-Fc-linker-CD39 containing a fusion construct of the invention was deposited with the Leibniz-Institut DSMZ-Deutsche Sammlung von Microorganismen and Zellkulturen on Jun. 29, 2017 under DSMZ under Accession Number DSM ACC3322 (identification reference CHO GPVI-Fc-linker-CD39). The DSMZ is located at Inhoffenstrae 7 B, 38124 Braunschweig, Germany. The DSMZ deposits were made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for the purposes of patent procedure.
[0130] Many expression systems are known and may be used, including mammalian cells such as CHO cell, bacterial cells (for example E. coli and Bacillus subtilis), yeasts (for example Saccharomyces cerevisiae), filamentous fungi (for example Aspergillus), plant cells, animal cells and insect cells. Flp-In-CHO cells (Life Technologies, Carlsbad, Calif.) which had been genetically modified to harbor the cDNA for a Tet repressor protein, are preferred.
[0131] The fusion protein of the present invention is produced in conventional ways, for example from a coding sequence inserted in the host chromosome or on a free plasmid. The cells are transformed with a coding sequence for the desired protein in any of the usual ways.
[0132] Useful fusion constructs are vectors which are generally available e.g. from Life Technologies, Carlsbad, Calif. A mammalian expression vector pcDNA5/FRT/TO is particularly preferred.
[0133] Preferably, Flp-In-CHO cells are stably transfected with a fusion construct and pOG44 helper plasmid using a transfection reagent. A suitable transfection reagent is Lipofectamine, including Lipofectamine 2000.
[0134] Successfully transformed cells, i.e., cells that contain a DNA construct of the present invention, can be identified by conventional techniques. For example, cells resulting from the introduction of an expression construct can be grown to produce the desired polypeptide. Preferably, stable adherent cells are adapted to growth in suspension in a chemically defined growth medium. In case of mammalian expression vector pcDNA5/FRT/TO, recombinant protein expression may be induced by addition of Doxycycline followed by incubation in a humidified atmosphere.
[0135] Cells can be harvested and lysed and their DNA content examined for the presence of the DNA using a method such as that described by Southern (1975) J. Mol Biol. 98, 503 or Berent et al. (1985) Biotech. 3, 208. Alternatively, the presence of the protein in the supernatant can be detected using antibodies. The presence and quantity of fusion proteins of the invention may be determined using ELISA comprising the steps of coating an ELISA plate with an anti-human serum antibody, blocking the plate to prevent non-specific binding, washing the ELISA plate, adding a solution containing the fusion protein of the invention, adding a secondary anti-fusion protein specific antibody coupled to a detectable label, and detecting the presence of the secondary antibody.
[0136] Fusion proteins of the invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, hydrophobic charge interaction chromatography and lectin chromatography. Preferably, the fusion proteins of the invention are purified using Affinity Chromatography including peptide affinity and antibody affinity columns that are selective for the fusion protein molecules of the present invention.
[0137] Most preferably, high performance affinity chromatography using a protein G sepharose column and their equivalents and comparables is employed for purification.
[0138] Fusion proteins of the present invention may be recovered from: products produced by recombinant techniques from mammalian cells, a prokaryotic or eukaryotic host or products of chemical synthetic procedures. Depending upon the host employed in a recombinant production procedure, the polypeptides of the present invention may be glycosylated or may be non-glycosylated.
[0139] In addition, fusion proteins of the invention can be chemically synthesized using techniques known in the art (e.g., see Creighton, 1983, Proteins: Structures and Molecular Principles, W.H. Freeman & Co., N.Y., and Hunkapiller et al., Nature, 310:105-111 (1984)). For example, a polypeptide corresponding to a fragment of a polypeptide can be synthesized by use of a peptide synthesizer.
[0140] Furthermore, if desired, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the polypeptide sequence. Non-classical amino acids include the D-isomers of the common amino acids, a-amino isobutyric acid, 2,4-diaminobutyric acid, 4-aminobutyric acid, 2-amino butyric acid, g-Abu, e-Ahx, Aib, 6-amino hexanoic acid, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, cysteic acid, b-alanine, fluoro-amino acids, and amino acid analogs in general.
[0141] The fusion proteins may also be modified with a detectable label, such as an enzymatic, fluorescent, isotopic or affinity label to allow for detection and isolation of the protein.
[0142] The fusion proteins of the invention may be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide.
[0143] Chemically modified derivatives of the fusion proteins of the invention may provide additional advantages such as increased solubility, stability and circulating time of the polypeptide, or decreased immunogenicity. The chemical moieties for derivatization may be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like. The fusion proteins may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.
[0144] The polymer may be of any molecular weight, and may be branched or unbranched. For polyethylene glycol, the preferred molecular weight is between about 1 kDa and about 100 kDa for ease in handling and manufacturing. For example, the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000,2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 11,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,000, 40,000, 45,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 kDa.
[0145] The fusion proteins of the invention or formulations thereof may be administered by any conventional method including parenteral infusion. The term parenteral refers to modes of administration which include intravenous, intramuscular, intraperitoneal, subcutaneous and intraarticular injection and infusion.
[0146] The treatment may consist of a single dose or a plurality of doses over a period of time.
[0147] While it is possible for a fusion protein of the invention to be administered alone, it is preferable to present it as a pharmaceutical formulation, together with one or more acceptable carriers compatible with the fusion protein and not deleterious to the recipients thereof. Typically, the carriers will be sterile and pyrogen free water or saline. The formulations of the invention are typically non-immunogenic, in part, because of the use of the components of the fusion protein being derived from the proper species. For instance, for human use, the GPVI portion and the CD39 portion will typically be human. In some cases, wherein either component is non human-derived, that component may be humanized by substitution of key amino acids so that specific epitopes appear to the human immune system to be human in nature rather than foreign.
[0148] The formulations may be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. Such methods include the step of bringing into association the fusion protein with the carrier that constitutes one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product.
[0149] Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain antioxidants, buffers, bacteriostats and solutes which render the formulation appropriate for the intended recipient as well as aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampules, vials or syringes, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders.
[0150] The invention also provides methods of treatment and/or prevention of diseases or disorders by administration to a subject of an effective amount of a fusion protein of the invention in a pharmaceutically acceptable carrier. The fusion protein will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient, the site of delivery, the method of administration, the scheduling of administration, and other factors known to practitioners. The effective amount for purposes herein is thus determined by such considerations. As a general proposition, the total pharmaceutically effective amount of the fusion protein administered parenterally per dose will be in the range of about 1 ug/kg/day to 10 mg/kg/day of patient body weight, although, as noted above, this will be subject to therapeutic discretion.
[0151] For parenteral administration, in one embodiment, the fusion protein is formulated generally by mixing it at the desired degree of purity, in a unit dosage injectable form, with a pharmaceutically acceptable carrier, i.e., one that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation.
[0152] Generally, the formulations are prepared by contacting the fusion protein and/or polynucleotide uniformly and intimately with liquid carriers or finely divided solid carriers or both. Then, if necessary, the product is shaped into the desired formulation. Preferably, the carrier is a parenteral carrier, more preferably a solution that is isotonic with the blood of the recipient. Examples of such carrier vehicles include water, saline, Ringer's solution, and dextrose solution. Non-aqueous vehicles such as fixed oils and ethyl oleate are also useful herein, as well as liposomes.
[0153] The carrier suitably contains minor amounts of additives such as substances that enhance isotonicity and chemical stability. Such materials are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, succinate, acetic acid, and other organic acids or their salts; antioxidants such as ascorbic acid; low molecular weight (less than about ten residues) polypeptides, e.g., polyarginine or tripeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids, such as glycine, glutamic acid, aspartic acid, or arginine; monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; counterions such as sodium; and/or nonionic surfactants such as polysorbates (including, for example, Tween-20), poloxamers, or PEG.
[0154] The fusion protein is typically formulated in such vehicles at a concentration of about 0.1 mg/ml to 100 mg/ml, preferably 1-10 mg/ml, at a pH of about 3 to 8. It will be understood that the use of certain of the foregoing excipients, carriers, or stabilizers will result in the formation of polypeptide salts.
[0155] The invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the fusion proteins of the invention. Associated with such container can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
EXAMPLES
Methods
Reageants and Antibodies
[0156] Standard laboratory chemicals were purchased from Carl Roth (Karlsruhe, Germany). Hams' F-12 growth medium, fetal bovine serum, PBS, and glutamine were from Biochrom (Berlin, Germany). Blasticidin S was obtained from InvivoGen (San Diego, Calif.). Hygromycin B came from Carl Roth (Karlsruhe, Germany). ProCHO4 growth medium was from LONZA (Basel, Switzerland). All enzymes for cloning were bought from New England Biolabs (Frankfurt, Germany). Doxycycline hydrochloride, Adenosine 5-diphosphate (ADP) sodium salt, and Adenosine 5-triphosphate (ATP) disodium salt hydrate were purchased from Sigma Aldrich (Munich, Germany). A part of the recombinant hirudin was a kind gift from Prof. Sommerhoff (University of Munich), another part was purchased from Celgene (Summit, N.J.). Collagen-related peptide (CRP) was synthetized at AnaSpec (Fremont, Calif.) and chemically cross linked to gain CRP-XL. DiOC6 was from Life Technologies (Eugene, Oreg.). Midazolam (Dormicum) was purchased from Roche (Basel, Switzerland), Medetomidin (Dormitor) and Fentanyl were both from Janssen-Cilag (Neuss, Germany). Recombinant soluble human CD39 (solCD39) was obtained from R&D Systems (Minneapolis, Minn.). Goat-anti-human Fc and goat-anti-human IgG (H+L)-POD were purchased from Jackson ImmunoResearch (West Baltimore Pike, Pa.).
Cloning and Protein Production
[0157] GPVI-Fc (Revacept) was taken from existing stocks. The cDNA coding for the fusion protein consisting of the extracellular domain of platelet glycoprotein VI, Fc (partial hinge region, CH2 and CH3 domain) of human IgG2 and the extracellular domain of human CD39 which was connected by a 15 amino acid linker (GPVI-CD39) was established by gene synthesis (Life Technologies, Carlsbad, Calif.). For steric reasons, the sequence coding for the Fc part of human IgG2 was inserted into the GPVI-CD39 fusion protein, whereas the original GPVI-Fc (also termed Revacept, which is currently in clinical investigation) is composed of the Fc derived from human IgG1. The cDNA was cloned into the mammalian expression vector pcDNA5/FRT/TO (Life Technologies, Carlsbad, Calif.) using HindIII and BamHI sites. Flp-In-CHO cells (Life Technologies, Carlsbad, Calif.) which had been genetically modified to harbor the cDNA for a Tet repressor protein were stably transfected with the expression construct and pOG44 helper plasmid using Lipofectamine 2000 transfection reagent according to the instructions of the supplier (both Life Technologies, Carlsbad, Calif.). Stable adherent cells were adapted to growth in suspension in the chemically defined growth medium ProCHO4 supplemented with 4 mM glutamine, 600 g/ml Hygromycin B, and 20 g/ml Blasticidin S. Recombinant protein expression was induced in dense cultures by addition of 30 ng/ml Doxycycline followed by incubation at 31 C. and 5% CO.sub.2 for 6-7 d in a humidified atmosphere. The construct for the control protein was produced by gene synthesis, accordingly. Expression of Fc(IgG2) control proteins was performed in stably transfected Flp-In-CHO cells grown at 37 C., 5% CO2 for 3-4 d in Ham's F-12 medium with 2% fetal bovine serum which had been depleted for bovine IgG in advance. Recombinant proteins were purified from cell culture supernatants using HiTrap Protein G HP affinity chromatography columns (VWR, Darmstadt, Germany) according to the manufacturer's manual. All proteins were dialyzed against phosphate-buffered saline (PBS). Purified GPVI-CD39 protein was separated in non-reducing and reducing sample buffer on a Tris-Hepes NH 4-20% gradient gel (NuSep, Bogart, Ga.) which was stained with Coomassie Brilliant Blue G250.
ADPase Activity
[0158] Various concentrations of GPVI-CD39 or solCD39 protein or plasma samples from the pharmacokinetic study diluted 1:500-1:2000 in assay buffer were incubated in 25 mM Tris-HCl, 5 mM CaCl.sub.2, pH 7.5 with 200 M ADP in a total volume of 100 l for 30 min or 5 min at 37 C. Enzymatically released Pi was detected using the Malachite Green Phosphate Detection Kit (R&D Systems, Minneapolis, Minn.) according to the supplier's manual. A serial dilution of Pi standard was analyzed in parallel which facilitates quantification of released Pi. Absorbance was measured at a wave length of 630 nm using a Tecan Infinite 200 ELISA reader. Enzymatic activity of purified protein was calculated taking incubation time and protein amount into account and expressed as Units per mg of protein.
Blood Collection
[0159] Blood was withdrawn from healthy volunteers that did not take any anti-coagulative medication within the last 14 days, with either recombinant hirudin (200 U/ml; 13 g/ml) or citrate as anti-coagulant. Informed consent was obtained as approved by the local Ethics Committee. An overall number of 58 healthy volunteers was included into the study: blood samples from 39 subjects were taken for in vitro experiments using vascular agonists, and blood samples from 19 subjects for experiments involving human plaque material.
Platelet Aggregation
[0160] The effect of GPVI-CD39 and control proteins on platelet aggregation was analyzed using the Multiplate device(25). 1:1 diluted hirudin-anticoagulated blood was pre-incubated with antagonist for 3 min in the test cell without stirring to avoid platelet pre-activation(26). Agonist was added and samples were incubated for 6 min at 37 C. with stirring. The following agonists were used: 6.5 M ADP, 12 g/ml collagen isolated from rabbit aorta, or 103 g/ml collagen type I secreted by human fibroblasts (VitroCol, Advanced BioMatrix, San Diego, Calif.). Platelet aggregation was measured in arbitrary units over the time period (arbitrary units (AU)*min) (cumulative aggregation values).
In Vivo Thrombus Formation after FeCl.SUB.3 .Injury in Carotid Arteries
[0161] For examination of arterial thrombus formation in vivo, 6-8 weeks old C57BL/6J wild type mice were anesthetized by injection of midazolame (5 mg/kg body weight), medetomidine (0.5 mg/kg body weight) and fentanyl (0.05 mg/kg body weight). In the ferric chloride model, an overall number of 21 mice was studied.
[0162] The common carotid artery was dissected free and the mice were injected intravenously 30 minutes before carotid injury with GPVI-CD39 (3 mg/kg body weight) or its control and with GP1b-488 (Emfret Analytics, Eibelstadt, Germany) for platelet visualization. The carotid was exteriorized and injured by topical application of a filter paper saturated with 15% ferric chloride for 1 minute. Thrombus formation in arteries was monitored for 20 minutes or until complete occlusion (stop of blood flow for >1 min). Digital films and images were recorded with a Nikon eclipse intravital microscope and analysed offline.
Pharmacokinetic Analysis
[0163] ale and female wild type C57BL/6J mice of the age of 12-22 weeks were used in this small scale study. An overall number of 9 mice were investigated. GPVI-CD39 or solCD39 were applied in a volume of 5 ml/kg into the right tail vein. At time points indicated in the figure blood sampling was performed by incision of the left tail vein using 25 l heparinized capillaries. Blood samples were recovered by centrifugation at 2400g for 10 min. The upper plasma phase was transferred to fresh tubes and stored frozen at 20 C.
Determination of Protein Concentration in Plasma Samples of Mice
[0164] The concentration of GPVI-CD39 or Fc control protein in plasma samples was determined by Fc-specific sandwich ELISA. Wells of a MaxiSorp 96-well plate (Thermo Fisher Scientific, Waltham, Mass.) were coated with 0.1 g/well goat-anti-human Fc antibody. Wells were washed three times with phosphate-buffered saline and tween-20 (PBST) between incubations. After blocking with 3% skimmed milk in PBST wells were incubated for 1 h with 50 l of plasma from GPVI-CD39 treated (1:200) or Fc (1:500) treated mice diluted in PBST. Wells were incubated for 1 h with 100 l of 80 ng/ml goat-anti-human IgG (H+L)-POD detection antibody. POD activity was visualized using 100 l of Ultra TMB-ELISA substrate (Thermo Fisher Scientific, Waltham, Mass.) and signal intensities were read with a Tecan Infinite F200 ELISA reader.
Analysis of In Vivo Tail Bleeding Time in Mice
[0165] Test or control substances were applied into the tail vein of C57BL/6J mice. Animals were anesthetized by intraperitoneal injection of 0.5 mg/kg medetomidine, 5 mg/kg midazolame, and 0.05 mg/kg fentanyl. 10 min after protein delivery a blood sample of 20 l was drawn for analysis of recombinant protein content and ADPase activity using a heparinized capillary. 15 min after protein application the distal 2 mm of the tail were cut off, the tail was immediately immersed into pre-warmed PBS (37 C.) buffer and time-monitored until bleeding stopped for at least 30 s. The process was standardized to yield comparable results over time and results were reproducible. Animals were sacrificed and a final blood sample stored for analysis.
Determination of In Vitro Closure Time with Innovance PFA-200 (Siemens Healthcare Diagnostics)
[0166] Citrated blood of healthy donors was mixed with antagonist in concentrations indicated in the figures, and added to Dade PFA COL/EPI, Dade PFA COL/ADP, or Innovance PFA P2Y test cartridges (Siemens Healthcare, Erlangen, Germany). Blood was aspirated under high shear conditions (>5000/s) through a capillary onto a membrane with a small aperture coated with substances which activate platelets and lead to closure of this aperture. The time until closure of this aperture is monitored and expressed as in vitro closure time with a maximum closure time of 300 s.
Statistics
[0167] Normal distribution of all analysed parameters was verified and confirmed by Kolmogorov-Smirnov testing. Differences between two or more experimental groups were analyzed by ANOVA using SPSS software (version 19), followed by Fisher's LSD (least significant difference) post-hoc testing. Specifically, 2-way-repeated measures ANOVA was used where indicated. Student's t-test Bonferroni's method was additionally used when absence of differences in ADPase activity was investigated.
Results
Description of GPVI-CD39 Protein and its Properties
[0168] To enhance the anti-thrombotic potential of Revacept (GPVI-Fc), we created a fusion protein which combines the extracellular collagen binding domain of GPVI with the extracellular domain of CD39 harbouring enzymatic ADPase activity (
Effect of GPVI-Fusion Proteins on Collagen-, ADP- or Plaque-Induced Platelet Aggregation in Human Blood under Static Conditions
[0169] The effect of GPVI-CD39 on collagen induced aggregation of human platelets was analyzed in blood using collagens from different sources as well as human plaque material and the secondary agonist ADP. GPVI-CD39 exhibited a highly significant, dose-dependent inhibition of platelet aggregation induced by 12 g/ml collagen isolated from rabbit aorta (
Anti-thrombotic Effects of GPVI-CD39 In Vivo in a FeCl.SUB.3.-Model
[0170] To investigate the anti-thrombotic effects of GPVI-CD39 in vivo in mice the common carotid artery was injured using 15% ferric chloride and the time to occlusion of the vessel was monitored. In wild type mice the mean time to vessel occlusion was 480 s (not shown). IV administration of either vehicle (NaCl) or of 1.5 mg/kg (10 nmol/kg) GPVI-Fc resulted in similar occlusion times, whereas 3 mg/kg (10 nmol/kg) GPVI-CD39 significantly delayed vessel occlusion to 1083 s (
Assessment of Closure Times by PFA-200
[0171] The efficacy of GPVI-CD39 was also analyzed by measuring closure times in response to various agonists with a platelet function analyzer (Innovance PFA-200). Four different concentrations of GPVI-CD39 were tested ranging from 21.7 to 217 nmol/L. Using either COL/ADP or COL/EPI cartridges, no significant increase of closure times of the aperture compared to the buffer control (phosphate-buffered salinePBS) was observed (
Pharmacokinetic Analysis and In Vivo Bleeding Time Determination in Mice
[0172] Since the application of effective doses of solCD39 in various animal models of thrombosis caused higher bleeding risks, the hazard potential of GPVI-CD39 was analyzed by measuring in vivo bleeding times in mice. In order to determine a proper time point after protein application for an in vivo bleeding study, a pharmacokinetic study of GPVI-CD39 plasma concentrations was performed. Mice were injected with 4 mg/kg of GPVI-CD39 or 2 mg/kg solCD39these doses relate to 26.6 nmol of the CD39 moieties of both agents.
[0173] Blood sampling was performed at intervals indicated in
[0174] ADPase activity was measured in the same plasma samples for solCD39, and comparable to that of GPVI-CD39 (
[0175] The analysis of tail bleeding time 15 min after IV administration showed no differences for 4 mg/kg (13 nmol/kg) GPVI-CD39 compared to 2 mg/kg (13 nmol/kg) GPVI-Fc or vehicle or buffer controls (
REFERENCES
[0176] 1. Mackay J, Mensah G. The Atlas of heart disease and stroke. World Health Organisation 30-9-2004.
[0177] 2. Marsh J D, Keyrouz S G. Stroke Prevention and Treatment. J Am Coll Cardiol 2010; 56: 683-691.
[0178] 3. Stoll G, Kleinschnitz C, Nieswandt B. The role of glycoprotein Ibalpha and von Willebrand factor interaction in stroke development. Hamost 2010; 30: 136-138.
[0179] 4. Penz S, Reininger A J, Brandl R, Goyal P, Rabie T, Bernlochner I, Rother E, Goetz C, Engelmann B, Smethurst P A, Ouwehand W H, Farndale R, Nieswandt B, Siess W. Human atheromatous plaques stimulate thrombus formation by activating platelet glycoprotein VI. Faseb J 2005; 19(8):898-909.
[0180] 5. Reininger A J, Bernlochner I, Penz S M, Ravanat C, Smethurst P, Farndale R W, Gachet C, Brandl R, Siess W. A 2-step mechanism of arterial thrombus formation induced by human atherosclerotic plaques. J Am Coll Cardiol 2010; 55:1147-58.
[0181] 6. Schulz C, Penz S, Hoffmann C, Langer H, Gillitzer A, Schneider S, Brandl R, Seidl S, Massberg S, Pichler B, Kremmer E, Stellos K, Schonberger T, Siess W, Gawaz M. Platelet GPVI binds to collagenous structures in the core region of human atheromatous plaque and is critical for atheroprogression in vivo. Basic Res Cardiol 2008; 103:356-67.
[0182] 7. Jandrot-Perrus M, Busfield S, Lagrue A H, Xiong X, Debili N, Chickering T, Le Couedic J P, Goodearl A, Dussault B, Fraser C, Vainchenker W, Villeval J L. Cloning, characterization, and functional studies of human and mouse glycoprotein VI: a platelet-specific collagen receptor from the immunoglobulin superfamily. Blood 2000; 96:1798-1807
[0183] 8. Zahid M, Mangin P, Loyau S, Hechler B, Billiald P, Gachet C, Jandrot-Perrus M. The future of glycoprotein VI as an antithrombotic target. J Thromb Haemost 2012; 10:2418-27.
[0184] 9. Massberg S, Konrad I, Bltmann A, Schulz C, Mnch G, Peluso M, Lorenz M, Schneider S, Besta F, Mller I, Hu B, Langer H, Kremmer E, Rudelius M, Heinzmann U, Ungerer M, Gawaz M. Soluble glycoprotein VI dimer inhibits platelet adhesion and aggregation to the injured vessel wall in vivo. Faseb J 2004; 18:397-9.
[0185] 10. Ungerer M, Rosport K, Bultmann A, Piechatzek R, Uhland K, Schlieper P, Gawaz M, Munch G. Novel antiplatelet drug revacept (dimeric glycoprotein VI-Fc) specifically and efficiently inhibited collagen-induced platelet aggregation without affecting general hemostasis in humans. Circulation 2011; 123:1891-1899.
[0186] 11. Dutting S, Bender M, Nieswandt B. Platelet GPVI: a target for antithrombotic therapy?! Trends Pharmacol Sci 2012; 33:583-590.
[0187] 12. Jamasbi J, Megens R T, Bianchini M, Mnch G, Ungerer M, Faussner A, Sherman S, Walker A, Goyal P, Jung S, Brandl R, Weber C, Lorenz R, Farndale R, Elia N, Siess W. Differential inhibition of human atherosclerotic plaque-induced platelet activation by dimeric GPVI-Fc and anti-GPVI antibodies: Functional and imaging studies. J Am Coll Cardiol 2015; 65:2404-2415
[0188] 13. Arthur J F, Dunkley S, Andrews R K. Platelet glycoprotein VI-related clinical defects. Brit J Haematol 2007; 139:363-372
[0189] 14. Eikelboom J W, Hirsh J, Spencer F A, Baglin T P, Weitz J I. Antiplatelet drugs: antithrombotic therapy and prevention of thrombosis. American College of Chest Physicians Evidence-Based Clinical Practice Guidelines. Chest 2012; 141(2 suppl):e89S-e119S
[0190] 15. Ungerer M, Mnch G. Novel antiplatelet drugs in clinical development. Thromb Haemost, 2013; 110:868-75.
[0191] 16. Birk A V, Broekman M J, Gladek E M, Robertson H D, Drosopoulos J H, Marcus A J, Szeto H H. Role of extracellular ATP metabolism in regulation of platelet reactivity. J Lab Clin Med 2002; 140:166-175.
[0192] 17. Marcus A J, Broekman M J, Drosopoulos J H, Islam N, Alyonycheva T N, Safier L B, Hajjar K A, Posnett D N, Schoenborn M A, Schooley K A, Gayle R B, Maliszewski C R. The endothelial cell ecto-ADPase responsible for inhibition of platelet function is CD39. J Clin Invest 1997; 99: 1351-1360
[0193] 18. Marcus A J, Broekman M J, Drosopoulos J H, Olson K E, Islam N, Pinsky D J, Levi R. Role of CD39 (NTPDase-1) in thromboregulation, cerebroprotection, and cardioprotection. Semin Thromb Hemost 2005; 2: 234-246
[0194] 19. Penz S M, Reininger A J, Toth O, Deckmyn H, Brandl R, Siess W. Glycoprotein Ibalpha inhibition and ADP receptor antagonists, but not aspirin, reduce platelet thrombus formation in flowing blood exposed to atherosclerotic plaques. Thromb Haemost 2007; 97: 435-443.
[0195] 20. Gayle R B III, Maliszewski C R, Gimpel S D, Schoenborn M A, Caspary R G, Richards C, Brasel K, Price V, Drosopoulos J H, Islam N, Alyonycheva T N, Broekman M J, Marcus AJ. Inhibition of platelet function by recombinant soluble ecto-ADPase/CD39. J Clin Invest 1998; 101:1851-1859.
[0196] 21. Buergler J M, Maliszewski C R, Broekman M J, Kaluza G L, Schulz D G, Marcus A J, Raizner A E, Kleiman N S, Ali N M. Effects of SolCD39, a novel inhibitor of Platelet Aggregation, on Platelet Deposition and Aggregation after PTCA in a Porcine Model. J Thromb Thrombolysis 2005; 19:115-122
[0197] 22. Dwyer K M, Robson S C, Nandurkar H H, Campbell D J, Gock H, Murray-Segal L J, Fisicaro N, Mysore T B, Kaczmarek E, Cowan P J, d'Apice A J. Thromboregulatory manifestations in human CD39 transgenic mice and the implications for thrombotic disease and transplantation. J Clin Invest. 2004; 113:1440-1446.
[0198] 23. Hohmann J D, Wang X, Krajewski S, Selan C, Haller CA, Straub A, Chaikof E L, Nandurkar H H, Hagemeyer C E, Peter K H. Delayed targeting of CD39 to activated platelet GPIIb/IIIa via a single-chain antibody: breaking the link between antithrombotic potency and bleeding? Blood 2013; 121: 3067-3075
[0199] 24. Brandl R., Richter T, Haug K, Wilhelm M G, Maurer P C, Nathrath W. Topographic analysis of proliferative activity in carotid endarterectomy specimens by immunocytochemical detection of the cell cycle-related antigen Ki-67. Circulation 1997; 96: 3360-3368
[0200] 25. Toth O, Calatzis A, Penz S, Losonczy H, Siess W. Multiple electrode aggregometry: A new device to measure platelet aggregation in whole blood. Thromb Haemost 2006; 96:781-788
[0201] 26. Bampalis V G, Brantl S A, Siess W. Why and how to eliminate spontaneous platelet aggregation in blood measured by multiple electrode aggregometry. J Thromb Haemost 2012; 10: 1710-1714
[0202] 27. Liu, B. Tang D. Influence of non-Newtonian properties of blood on the wall shear stress in human atherosclerotic right coronary arteries. Mol Cell Biomech 2011; 8: 73-90
[0203] 28. Huttinger Z M, Milks M W, Nickoli M S, Aurand W L, Long L C, Wheeler D G, Dwyer K M, d'Apice A J, Robson S C, Cowan P J, Gumina R J. Ectonucleotide triphosphate diphosphohydrolase-1 (CD39) mediates resistance to occlusive arterial thrombus formation after vascular injury in mice. Am J Pathol 2012; 181:322-333
[0204] 29. Cai M, Huttinger Z M, He H, Zhang W, Li F, Goodman L A, Wheeler D G, Druhan L J, Zweier J L, Dwyer K M, He G, d'Apice A J, Robson S C, Cowan P J, Gumina R J. Transgenic over-expression of ectonucleotide triphosphate diphosphohydrolase-1 protects against murine myocardial ischemic injury. J Mol Cell Cardiol 2011; 51:927-935
[0205] 30. Wheeler D G, Joseph M E, Mahamud S D, Aurand W L, Mohler P J, Pompili V J, Dwyer K M, Nottle M B, Harrison S J, d'Apice A J, Robson S C, Cowan P J, Gumina R J. Transgenic swine: expression of human CD39 protects against myocardial injury. J Mol Cell Cardiol. 2012; 52: 958-961
[0206] 31. Pinsky D J, Broekman MJ, Peschon J J, Stocking K L, Fujita T, Ramasamy R, Connolly E S Jr, Huang J, Kiss S, Zhang Y, Choudhri T F, McTaggart R A, Liao H, Drosopoulos J H, Price V L, Marcus A J, Maliszewski C R. Elucidation of the thromboregulatory role of CD39/ectoapyrase in the ischemic brain. J Clin Invest 2002; 109:1031-1040
[0207] 32. Kanthi Y, Hyman M C, Liao H, Baek A E, Visovatti S H, Sutton N R, Goonewardena S N, Neral M K, Jo H, Pinsky D J. Flow-dependent expression of ectonucleotide tri(di)phosphohydrolase-1 and suppression of atherosclerosis. J Clin Invest. 2015; 125: 3027-3036
[0208] 33. Schnberger T, Ziegler M, Borst O, Konrad I, Nieswandt B, Massberg S, Ochmann C, Jrgens T, Seizer P, Langer H, Mnch G, Ungerer M, Preissner K T, Elvers M, Gawaz M P. The platelet collagen receptor GPVI-Fc reduces platelet adhesion to activated endothelium and preserves myocardial function after transient ischemia in mice. Am J Physiol (Cell Physiol.) 2012; 303: C757-C766
[0209] 34. Gbel S, Li Z M, Vogelmann J, Holthoff H P, Degen H, Hermann D M, Gawaz M, Ungerer M, Mnch G. The GPVI-Fc fusion protein Revacept improves cerebral infarct volume and functional outcome in stroke. PLOS ONE 2013: 8:e66960
[0210] 35. Ungerer M, Li Z M, Baumgartner C, Gbel S, Vogelmann J, Holthoff H P, Bltmann A, Gawaz M, Mnch G. The GPVI-Fc fusion protein Revacept reduces thrombus formation and improves vascular dysfunction in atherosclerosis without any impact on bleeding times. PLOS ONE 2013; 8:e71193
[0211] 36. Bltmann A, Li Z, Wagner S, Peluso M, Schnberger T, Weis C, Konrad I, Stellos K, Massberg S, Nieswandt B, Gawaz M, Ungerer M, Mnch G. Impact of glycoprotein VI and platelet adhesion on atherosclerosisa possible role of fibronectin. J Mol Cell Cardiol 2010; 49: 532-542
[0212] 37. Jamasbi J, Megens R T A, Bianchini M, Uhland K, Mnch G, Ungerer M, Sherman S, Faussner A, Brandl R, John C, Buchner J, Weber C, Lorenz R, Elia N, Siess W. Cross-linking GPVI-Fc by anti-Fc antibodies potentiates its inhibition of atherosclerotic plaque- and collagen-induced platelet activation. J Am Coll Cardiol: Translat Med 2016; 1: 131-142; doi: 10.1016/j.jacbts.2016.03.008
[0213] 38. Mojica Muoz A K, Jamasbi J, Degen H, Uhland K, Mnch G, Ungerer M, Brandl R, Megens R, Weber C, Lorenz R, Siess W. Recombinant GPVI-Fc added to single or dual antiplatelet therapy in vitro prevents plaque-induced platelet thrombus formation. Thromb Haemost. 2017; 117. Epub ahead of print as of June. 1, 2017. doi: 10.1160/TH16-11-0856
[0214] 39. Newman D K. CD39 target practice. Blood 2013; 121; 3061-3062
[0215] 40. Jalkanen J, Yegutkin G G, Hollmn M, Aalto K, Kiviniemi T, Salomaa V, Jalkanen S, Hakovirta H. Aberrant circulating levels of purinergic signaling markers are associated with several key aspects of peripheral atherosclerosis and thrombosis. Circ Res 2015; 116: 1206-1215
[0216] 41. Lecka J, Rana M S, Sevigny J. Inhibition of vascular ectonucleotidase activities by the pro-drugs ticlopidine and clopidogrel favours platelet aggregation. Br J Pharmacol 2010; 161:1150-1160
[0217] 42. Hohmann J D, Peter K. Activated-platelet targeting of CD39 as a potential way forward. Hmostaseologie 2016:1: 1-7
[0218] 43. Fung C Y E, Marcus A J, Broekman M J, Mahaud-Smith M P. P2X1 receptor inhibition and soluble CD39 administration as novel approaches to widen the cardiovascular therapeutic window. Trends Cardiovasc Med 2009; 19:1-5