HIGHLY PURIFIED RECOMBINANT HUMAN INSULIN (RHI) API AND METHODS OF PRODUCING THE SAME

20200216511 ยท 2020-07-09

    Inventors

    Cpc classification

    International classification

    Abstract

    Methods are disclosed for producing highly purified recombinant human insulin (RHI) having a purity of 99.0% (w/w) or greater, a Total Impurity (not including the related substance desamido Asn.sup.A21-RHI, as specified by USP) of 0.8% (w/w) or less, and an impurity C of 0.1% (w/w) or less. Also disclosed are API compositions of highly purified RHI having a purity of 99.0% (w/w) or greater, a Total Impurity of 0.8% (w/w) or less, and an impurity C of 0.1% (w/w) or less.

    Claims

    1. A method for producing highly purified recombinant human insulin (RHI) active pharmaceutical ingredient (API), the method comprising: protecting two Lysine residues on a single-chain precursor (SCP) using a Lysine protecting group, wherein the SCP has a formula of [(Leader Peptide)-(B-Chain)-(C-peptide)-(A-Chain)], wherein the C-peptide is a short peptide consisting of Arg.sup.C2-Lys.sup.C1, wherein the two Lysine residues are a first Lysine residue at a first residue of the C-peptide (C1) of the SCP (Lys.sup.C1), and a second Lysine residue at residue 28 of the B-chain (B28) of the SCP (Lys.sup.B28); enzyme-cleaving the SCP to produce an Arg.sup.C2-Lys.sup.C1-RHI; applying a first column purification action to separate the Leader Peptide from the Arg.sup.C2-Lys.sup.C1-RHI to generate Arg.sup.C2-Lys.sup.C1-RHI; enzyme-cleaving a half of the C-peptide in the Arg.sup.C2-Lys.sup.C1-RHI to produce Lys.sup.C1-RHI and an Impurity C, wherein the Impurity C is acetylated Lys.sup.B31-RHI; de-protecting the two Lysine residues in the Lys.sup.C1-RHI; applying a second column purification action to separate one or more impurities from the Lys.sup.C1-RHI; applying a third column purification action to the Lys.sup.C1-RHI to reduce an amount of the Impurity C in the Lys.sup.C1-RHI to 0.1% (w/w) or less based on the total weight of the Lys.sup.C1-RHI; enzyme-cleaving the Lys.sup.C1-RHI to produce Lys.sup.C1 and the RHI; applying a fourth column purification action to separate one or more impurities from the RHI to produce highly purified RHI for use as an API; and crystallizing the highly purified RHI API to produce highly purified RHI API in a solid form; wherein the method produces highly purified RHI API, in a solid form, having a purity of 99.0% (w/w) or more, a total impurity of 0.8% (w/w) or less, wherein the total impurity does not include desamido Asn.sup.A21-RHI, and the Impurity C of 0.1% (w/w) or less, and wherein w/w denotes weight by weight and is based on the total weight of the highly purified RHI API in the solid form.

    2. The method of claim 1, wherein the highly purified RHI API, in the solid form, has a purity of 99.3% (w/w) or more, the total impurity of 0.5% (w/w) or less, the total impurity does not include desamido Asn.sup.A21-RHI, and the Impurity C of 0.1% (w/w) or less.

    3. The method of claim 1, wherein the step of enzyme-cleaving the half of the C-peptide in the Arg.sup.C2-Lys.sup.C1-RHI comprises applying carboxypeptidase B (CPB) to the Arg.sup.C2-Lys.sup.C1-RHI to produce Lys.sup.C1-RHI.

    4. The method of claim 3, wherein the step of enzyme-cleaving the Arg.sup.C2-Lys.sup.C1-RHI comprises applying the CPB to the Arg.sup.C2-Lys.sup.C1-RHI at a pH of about 8.0 to about 10.0.

    5. The method of claim 1, wherein the third column purification action that reduces the amount of the Impurity C to 0.1% (w/w) or less comprises applying reverse-phase high performance liquid chromatography (RP-HPLC) utilizing a C18 column to separate the Impurity C from the Lys.sup.C1-RHI.

    6. The method of claim 5, wherein the third column purification action that reduces the amount of the Impurity C to 0.1% (w/w) or less further comprises utilizing an aqueous solution comprising (NH.sub.4).sub.2SO.sub.4, isopropyl alcohol (IPA), or a combination thereof in the RP-HPLC.

    7. The method of claim 5, wherein the third column purification action that reduces the amount of the Impurity C to 0.1% (w/w) or less is carried out at a pH of about 2.5 to about 3.0.

    8. The method of claim 5, wherein the RP-HPLC utilizes a preparation column.

    9. The method of claim 5, wherein the RP-HPLC utilizes a semi-preparation column.

    10. The method of claim 1, wherein the first column purification action and the second column purification action each utilizes anion-exchange column chromatography.

    11. The method of claim 1, wherein the third column purification action and the fourth column purification action each utilizes RP-HPLC.

    12. The method of claim 11, wherein the third column purification action and the fourth column purification action each utilizes RP-HPLC having a C18 column.

    13. The method of claim 11, wherein the third column purification action and the fourth column purification action each utilizes RP-HPLC having a C8 column.

    14. The method of claim 1, wherein the Lysine protecting group comprises citraconic anhydride, tert-Butyloxycarbonyl (Boc), Benzyloxycarbonyl (Cbz, Z), Allyloxycarbonyl (Alloc), or a combination thereof.

    15. The method of claim 1, wherein the step of enzyme-cleaving the SCP to produce the Arg.sup.C2-Lys.sup.C1-RHI comprises applying trypsin to the SCP.

    16. The method of claim 15, further comprising removing the trypsin using aprotinin.

    17. The method of claim 1, wherein the step of enzyme-cleaving the Lys.sup.C1-RHI to produce RHI comprises applying CPB.

    18. The method of claim 1, further comprising refolding the SCP using a refolding buffer.

    19. The method of claim 1, wherein the one or more impurities separated at the second column purification action comprise at least Arg.sup.C2.

    20. The method of claim 1, wherein the one or more impurities separated at the fourth column purification action comprise at least Lys.sup.C1.

    21. The method of claim 1, wherein the method further reduces an amount of impurity E to 0.2% (w/w) or less, wherein the impurity E is Thr.sup.B30 deletion-RHI, thereby producing highly purified RHI API having a purity of 99.0% (w/w), total impurity of 0.8% (w/w) or less, Impurity C of 0.1% (w/w) or less, and impurity E of 0.2% (w/w) or less, based on the total weight of the highly purified RHI API in the solid form or liquid form, respectively.

    22. A method for producing highly purified recombinant human insulin (RHI), the method comprising: protecting at least two Lysine residues on a single-chain precursor (SCP) using a Lysine protecting group, wherein the SCP has a formula of [(Leader Peptide)-(B-Chain)-(C-peptide)-(A-Chain)], wherein the C-peptide comprises at least Arg.sup.C2-Lys.sup.C1, wherein the Lysine residues comprise a first Lysine residue at a first residue of the C-peptide (C1) of the SCP (Lys.sup.C1), and a second Lysine residue at residue 28 of the B-chain (B28) of the SCP (Lys.sup.B28); enzyme-cleaving the Arg.sup.C2-Lys.sup.C1-RHI to produce Lys.sup.C1-RHI and an Impurity C, wherein the Impurity C is acetylated Lys.sup.B31-RHI; de-protecting the Lysine residues in Lys.sup.C1-RHI; applying a plurality of column purification actions to produce highly purified RHI for use as an API, wherein at least one of the column purification actions reduces an amount of the Impurity C in the Lys.sup.C1-RHI to 0.1% (w/w) or less based on the total weight of the Lys.sup.C1-RHI; enzyme-cleaving the Lys.sup.C1-RHI to produce RHI; and crystallizing the highly purified RHI API to produce highly purified RHI API in a solid form; wherein the method produces highly purified RHI API, in a solid form, having a purity of 99.0% (w/w) or more, a total impurity of 0.8% (w/w) or less, wherein the total impurity does not include desamido Asn.sup.A21-RHI, and the Impurity C of 0.1% (w/w) or less, and wherein w/w denotes weight by weight and is based on the total weight of the highly purified RHI API in the solid form.

    23. The method of claim 22, wherein the plurality of column purification actions comprise: a first column purification action to separate at least the Leader Peptide from the Arg.sup.C2-Lys.sup.C1-RHI, wherein the first column purification action occurs after the step of enzyme-cleaving the SCP to produce the Arg.sup.C2-Lys.sup.C1-RHI but before the step of enzyme-cleaving the Arg.sup.C2-Lys.sup.C1-RHI to produce the Lys.sup.C1-RHI and the Impurity C; a second column purification action to separate at least Arg.sup.C2 from the Lys.sup.C1-RHI, wherein the second purification action separates one or more impurities after the step of de-protecting the Lysine residues in the Lys.sup.C1-RHI; a third column purification action, which is the column purification action that reduces the amount of the Impurity C to 0.1% (w/w) or less in the Lys.sup.C1-RHI, and this third column purification action occurs after the step of de-protecting the Lysine residues in the Lys.sup.C1-RHI but before the step of enzyme-cleaving of the Lys.sup.C1-RHI to produce the RHI; and a fourth column purification action to separate at least Lys.sup.C1 from the RHI, wherein the fourth column purification action occurs after the step of enzyme-cleaving the Lys.sup.C1-RHI.

    24. The method of claim 22, wherein the C-peptide comprises the Lys.sup.C1, the Arg.sup.C2, and an Arg as a last residue of the C-peptide that bonds to Gly.sup.A1 of the A-chain.

    25. The method of claim 22, wherein the method further reduces an amount of impurity E to 0.2% (w/w) or less, wherein the impurity E is Thr.sup.B30 deletion-RHI, thereby producing highly purified RHI API having a purity of 99.0% (w/w), total impurity of 0.8% (w/w) or less, Impurity C of 0.1% (w/w) or less, and impurity E of 0.2% (w/w) or less, based on the total weight of the highly purified RHI API in the solid form or liquid form, respectively.

    26. A method for producing highly purified recombinant human insulin (RHI), the method comprising: protecting at least two Lysine residues on a single-chain precursor (SCP) using a Lysine protecting group, wherein the SCP has a formula of [(Leader Peptide)-(B-Chain)-(C-peptide)-(A-Chain)], wherein the C-peptide comprises at least Arg.sup.C2-Lys.sup.C1, wherein the Lysine residues comprise a first Lysine residue at a first residue of the C-peptide (C1) of the SCP (Lys.sup.C1), and a second Lysine residue at residue 28 of the B-chain (B28) of the SCP (Lys.sup.B28); enzyme-cleaving the Arg.sup.C2-Lys.sup.C1-RHI to produce Lys.sup.C1-RHI and an Impurity C, wherein the Impurity C is acetylated Lys.sup.B31-RHI; de-protecting the Lysine residues in Lys.sup.C1-RHI; applying a plurality of column purification actions to produce highly purified RHI for use as an API, wherein at least one of the column purification actions reduces an amount of the Impurity C in the Lys.sup.C1-RHI to 0.1% (w/w) or less based on the total weight of the Lys.sup.C1-RHI; and enzyme-cleaving the Lys.sup.C1-RHI to produce RHI; wherein the method produces highly purified RHI API, in a liquid form, having a purity of 99.0% (w/w) or more, a total impurity of 0.8% (w/w) or less, wherein the total impurity does not include desamido Asn.sup.A21-RHI, and the Impurity C of 0.1% (w/w) or less, and wherein w/w denotes weight by weight and is based on the total weight of the highly purified RHI API in the liquid form.

    27. The method of claim 26, wherein the plurality of column purification actions comprise: a first column purification action to separate at least the Leader Peptide from the Arg.sup.C2-Lys.sup.C1-RHI, wherein the first column purification action occurs after the step of enzyme-cleaving the SCP to produce the Arg.sup.C2-Lys.sup.C1-RHI but before the step of enzyme-cleaving the Arg.sup.C2-Lys.sup.C1-RHI to produce the Lys.sup.C1-RHI and the Impurity C; a second column purification action to separate at least Arg .sup.C2 from the Lys.sup.C1-RHI, wherein the second purification action separates one or more impurities after the step of de-protecting the Lysine residues in the Lys.sup.C1-RHI; a third column purification action, which is the column purification action that reduces the amount of the Impurity C to 0.1% (w/w) or less in the Lys.sup.C1-RHI, and this third column purification action occurs after the step of de-protecting the Lysine residues in the Lys.sup.C1-RHI but before the step of enzyme-cleaving of the Lys.sup.C1-RHI to produce the RHI; and a fourth column purification action to separate at least Lys.sup.C1 from the RHI, wherein the fourth column purification action occurs after the step of enzyme-cleaving the Lys.sup.C1-RHI.

    28. The method of claim 26, wherein the C-peptide comprises the Lys.sup.C1, the Arg.sup.C2, and an Arg as a last residue of the C-peptide that bonds to Gly of the A-chain.

    29. The method of claim 26, wherein the method further reduces an amount of impurity E to 0.2% (w/w) or less, wherein the impurity E is Thr.sup.B30 deletion-RHI, thereby producing highly purified RHI API having a purity of 99.0% (w/w), total impurity of 0.8% (w/w) or less, Impurity C of 0.1% (w/w) or less, and impurity E of 0.2% (w/w) or less, based on the total weight of the highly purified RHI API in the solid form or liquid form, respectively.

    30. The method of claim 29, wherein at the step of enzyme-cleaving the Lys.sup.C1-RHI to produce RHI, a water dilution of at least two times is applied at this step to further reduce the amount of impurity E to 0.2% (w/w) or less.

    31. A composition comprising: a highly purified recombinant human insulin (RHI) active pharmaceutical ingredient (API) comprising: a purity of 99.0% (w/w) or more, a total impurity of 0.8% (w/w) or less, wherein the total impurity does not include desamido Asn.sup.A21-RHI, and an Impurity C of 0.1% (w/w) or less, wherein the Impurity C is acetylated Lys.sup.B31-RHI, wherein w/w denotes weight by weight and is based on the total weight of the highly purified RHI API.

    32. The composition of claim 31, wherein the highly purified RHI API is in a solid form.

    33. The composition of claim 31, wherein the highly purified RHI API is in a liquid form.

    34. The composition of claim 31, wherein the highly purified RHI API has a purity of 99.3% (w/w) or more, the total impurity is 0.5% (w/w) or less, the total impurity does not include desamido Asn.sup.A21-RHI, and the Impurity C is 0.1% (w/w) or less, based on the total weight of the highly purified RHI API.

    35. The composition of claim 31, wherein the highly purified RHI API has a purity of 99.0% (w/w) or more, the total impurity is 0.8% (w/w) or less, the Impurity C is 0.1% (w/w) or less, and an impurity E is 0.2% (w/w) or less, based on the total weight of the highly purified RHI API, and wherein the impurity E is Thr.sup.B30 deletion-RHI.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0060] The above and other exemplary features and advantages of certain exemplary embodiments of the present disclosure will become more apparent from the following description of certain exemplary embodiments thereof when taken in conjunction with the accompanying drawings in which:

    [0061] FIG. 1 is a process flow chart illustrating an exemplary embodiment of the disclosed methods, depicted as method 100, for producing highly purified RHI API.

    [0062] FIG. 2, which includes FIGS. 2A, 2B, 2C, 2D, 2E, 2F, 2G and 2H depict the processing of SCP and proinsulin into highly purified RHI API according to embodiments of the present disclosure.

    [0063] FIG. 3 is a process flow chart depicting Comparative Example 1 for a method of producing RHI API with less purity.

    [0064] FIG. 4 is a process flow chart depicting Comparative Example 2 for a method of producing RHIAPI with less purity.

    [0065] FIG. 5 is a process flow chart depicting Comparative Example 3 for a method of producing RHIAPI with less purity.

    [0066] Throughout the drawings, like reference numerals will be understood to refer to like elements, features and structures.

    DETAILED DESCRIPTION

    [0067] The matters exemplified in the present disclosure are provided to assist in a comprehensive understanding of exemplary embodiments of the present disclosure with reference to the accompanying drawing figures. While the present disclosure has been described in connection with certain embodiments, it is to be understood that the disclosure is not limited to the disclosed embodiments, but, on the contrary, is intended to cover various modifications and equivalent arrangements included within the spirit and scope of the appended claims, and equivalents thereof. Accordingly, those of ordinary skill in the art will recognize that various changes and modifications of the exemplary embodiments described herein can be made without departing from the scope and spirit of the present disclosure, the disclosed embodiments, or the claimed embodiments.

    [0068] The word exemplary is used herein to mean serving as an example, instance, or illustration. Any embodiment described herein as exemplary is not necessarily to be construed as preferred or advantageous over other embodiments. Likewise, the term embodiments does not require that all embodiments include the discussed feature, advantage or mode of operation.

    [0069] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Nomenclatures used in connection with, and techniques described herein are those known and commonly used in the art. Also, descriptions of well-known functions and constructions are omitted for clarity and conciseness.

    [0070] Throughout the text and claims, the terms about and substantially are used as terms of approximation, not terms of degree, and reflect the inherent variation associated with measurement, significant figures, and interchangeability, all as understood by a person having ordinary skill in the relevant art. Also, it is to be understood that throughout this disclosure and the accompanying claims, even values that are not preceded by the term about are also implicitly modified by that term, unless otherwise specified.

    [0071] As used herein, the singular forms a, an, and the are intended to include the plural forms as well, unless the context clearly indicates otherwise. It will be further understood that the terms comprises, comprising, includes, including, have and/or having when used herein, specify the presence of stated features, integers, actions, steps, operations, elements, and/or components, but do not preclude the presence or addition of one or more other features, integers, actions, steps, operations, elements, components, and/or groups thereof.

    [0072] To be suitable for use as an active pharmaceutical ingredient (API), the RHI produced should have a high purity and a low impurity profile, such as the RHI produced according to the methods disclosed herein, which can produce RHI API, in a solid form or in a liquid form, having a purity of 99.0% (w/w) or greater, a Total Impurity (not including the related substance desamido Asn.sup.A21-RHI) of 0.8% or less, and impurity C of 0.1% (w/w) or less, all based on the total weight of the RHI API, in liquid or solid form, respectively. Also, the USP guidance on RHI specifies that the total impurities of RHI do not include the related substance desamido Asn.sup.A21-RHI.

    [0073] As used herein, Total Impurity or Total Impurities means all impurities in the RHI API except for the related substance desamido Asn.sup.A21-RHI. Examples of the impurities included in the Total Impurity are the impurities provided in, but not limited to, Tables 1-2. In a preferred embodiment, the Total Impurity or Total Impurities does not include additional impurities that may generate and/or increase, as a function of time, after the RHI API is combined or formulated with other components, such as in a scenario where the RHI API is incorporated into a finished RHI drug product, such as an RHI aqueous solution for injection.

    [0074] Highly purified recombinant human insulin API or highly purified RHI API means recombinant human insulin API, in a solid form or a liquid form, with a Total Impurity of 0.8% (w/w) or less based on the total weight of the RHI API, in solid or liquid form, respectively. For brevity herein, RHI API having a Total Impurity of 0.8% (w/w) or less based on the total weight of the RHI API, is deemed highly purified RHI API. For example, RHI API (in solid form or liquid form) having a purity of 99.0% (w/w) or more, a Total Impurity of 0.8% (w/w) or less, and an impurity C of 0.1% (w/w) or less, based on the total weight of the RHI API, is deemed highly purified RHI API.

    [0075] Aspects of embodiments of the present disclosure include methods for reducing a difficult-to-remove impurity known as impurity C. Impurity C refers specifically to acetylated lysine at position 31 of the B-chain (Lysine.sup.B31, Lys.sup.B31, or K.sup.B31) of RHI. Accordingly, as used herein, impurity C refers to a RHI bonded to an acetylated Lys.sup.B31 wherein the acetylated Lys.sup.B31 bonds to Thr.sup.B30 on the B-chain. The Lys.sup.B31 originates from the Lys.sup.C1 of the C-peptide, as described herein. An acetylated Lys.sup.B31 means that the Lys.sup.B31 residue has an added group in (-CO-CH.sub.3), as illustrated below:

    ##STR00001##

    [0076] Impurity C is produced from an impurity C precursor during the processing of the single chain precursor (SCP) to RHI. The synthesis (e.g., processing) of RHI includes an immature form of RHI known as a single-chain precursor (SCP) molecule made of the A-chain polypeptide and the B-chain polypeptide with a C-peptide there-between. Various recombinant forms of the SCP molecule have utilized various lengths of the C-peptide, such as the SCP sequences having Formulae I, II, or III. SCP sequences known in the art include a C-peptide sequence from 1 amino acid residue to as many as 35 (or more) amino acid residues. One of the actions in the processing of RHI API from SCP is the cleavage and removal of the C-peptide from the A-chain and B-chain. However, to remove the C-peptide, enzyme cleavage actions are applied, which often produce additional impurities because of misdirected cleavages at sites susceptible to the particular enzyme. Accordingly, the difficult-to-remove impurities of RHI processing may vary according to the specific C-peptide sequence.

    [0077] An impurity C precursor can be acetylated Lysine.sup.C1 in the SCP. The impurity C precursor can be developed during the synthesis of the SCP, such as during the fermentation, gene expression, and/or inclusion body isolation of the SCP. Prior to the processing of SCP to RHI, the impurity C precursor can be as high as about 2-3% (w/w) in the SCP batch. Subsequently, impurity C is produced during enzymatic cleavage (e.g., enzymatic digestion) when processing the SCP into RHI. Thus, in some embodiments, in order for impurity C to be produced during enzymatic cleavage, a precursor to impurity C is developed during the synthesis of SCP, such as an acetylated Lysine.sup.C1 in the SCP. Even after the application of several purification actions during the processing of the SCP to RHI, impurity C can still be as high as 0.7% (w/w) as an impurity in the final purified RHI API composition.

    [0078] Impurity C may account for 0.5-0.7% (w/w) impurity in the final purified RHI API. Thus, the ability to produce highly purified RHI API, 99.0% (w/w) purity or above, and Total Impurities of 0.8% (w/w) or less, may be achieved if the amount of impurity C in the final purified RHI composition was lowered to 0.1% (w/w) or lower. One reason impurity C is difficult to remove is because it has an isoelectric point of about 5.40, which is similar to the isoelectric point of RHI and other impurities. Further, impurity C is difficult to remove because it is resistant to CPB enzyme digestion. Another reason impurity C is difficult to remove is that routine optimization of purification actions, as described in the Comparative Examples, were unable to significantly reduce the amount of the impurity C to 0.1% (w/w) or less based on the total weight of the RHI API. Therefore, a technical solution to removing or significantly reducing impurity C is needed.

    [0079] Accordingly, the present disclosure solves this technical challenge by presenting methods for significantly reducing impurity C during the processing of the SCP into RHI. In particular, the disclosed methods significantly reduced the amount of the impurity C to 0.1% (w/w) or lower and Total Impurities to 0.8% (w/w) or less based on the total weight of the RHI API.

    [0080] Embodiments of the present disclosure introduce methods for producing a solid form of RHI API having 99.0% (w/w) purity or greater and Total Impurities of 0.8%(w/w) or less based on the total weight of the RHI API in solid form. In particular, embodiments of the present disclosure include methods for reducing impurity C during the processing of SCP to RHI to 0.1% (w/w) or lower, which in turn results in the production of highly purified RHI API, in solid form, having 99.0% (w/w) purity or greater, and Total Impurities of 0.8% or less, based on the total weight of the RHI API in solid form.

    [0081] Another difficult to remove impurity is Impurity E, which is Thr.sup.B30 deletion-RHI. RHI API may have Impurity E at high concentrations, typically more than 0.3% (w/w). The disclosed methods can reduce Impurity E to less than 0.20% (w/w) as previously described. Impurity E can be produced during enzyme digestion, such as during enzyme cleavage actions 103 and 105 of method 100.

    [0082] In some embodiments, the disclosed methods produced RHI API having a purity of about 99.0% (w/w), 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or more based on the total weight of the RHI API. In some embodiments, the disclosed methods produced RHI API having a Total Impurity of about 0.8% (w/w), 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1% or less based on the total weight of the RHI API. In some embodiments, the disclosed methods reduced impurity C in RHI API to about 0.10% (w/w), 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, or less based on the total weight of the RHI API.

    [0083] % (w/w) denotes a percentage based on weight per weight or weight by weight, as is customarily understood in the art. Throughout this disclosure, % is used synonymously and interchangeably with % (w/w). In the interest of brevity throughout this disclosure, when (w/w) is made in reference to an RHI (i.e. highly purified RHI API; RHI API; RHI; Lys.sup.C1-RHI, and the like), it means that the % (w/w) or % is determined based on the weight of the component of interest divided by the total weight of the corresponding RHI. For example, RHI having a purity of 99.0%, or 99.0% (w/w), means that it has 99.0% RHI by weight (or mass) based on the total weight of the RHI, and 1.0% impurities by weight (or mass) based on the total weight of the RHI, wherein the 1.0% impurities by weight (or mass) includes the Total Impurities and the related substance desamido Asn.sup.A21-RHI. Alternatively, RHI having impurity C of 0.1% means that it has 0.1% impurity C by weight (or mass) based on the total weight of the RHI, and the remaining 99.9% consists of RHI and other types of impurities (if any) by weight (or mass) based on the total weight of the RHI, such as the Total Impurities and desamido Asn.sup.A21-RHI. Other types of impurities may include those listed in Tables 1 and 2.

    [0084] Additionally, the purity or impurity percentages (w/w) can be assessed at different points in time within the disclosed methods with respect to the total weight of the particular components at that point in time. For example, the purity or impurity percentages (w/w) can be assessed after a column purification step. For instance, after action 109 of method 100, the amount of impurity C in Lys.sup.C1-RHI is reduced to 0.1% (w/w) or less based on the total weight of the Lys.sup.C1-RHI.

    [0085] Human insulin is unmodified human insulin as it would exist in native human insulin. As known in the art, human insulin is a hormone that regulates glucose metabolism, and is made up of two polypeptide chainsan A-chain of 21 amino acids and a B-chain of 30 amino acids for a total of 51 amino acids. The A and B polypeptide chains are linked by disulfide bonds between A-chain cysteines paired with a respective B-chain cysteine. The disulfide bonds and corresponding cysteines (Cys) are Cys.sup.A7-Cys.sup.B7, Cys.sup.A20-Cys.sup.B19, and Cys.sup.A6-Cys.sup.A11. RHI is generally synthesized using recombinant DNA technology. The RHI produced according to the methods disclosed herein is RHI produced artificially. Throughout this disclosure, human insulin or insulin may be used interchangeably and synonymously with recombinant human insulin or RHI.

    [0086] As described herein, human insulin consists of two polypeptide chains, an A-chain of 21 amino acids, and a B-chain of 30 amino acids, a total of 51 amino acids, having three disulfide bonds between the cysteines (Cys) in Cys.sup.A7-Cys.sup.B7, Cys.sup.A20-Cys.sup.B19, and Cys.sup.A6-Cys.sup.A11, respectively. The B-chain of human insulin or RHI from B.sub.1 to B.sub.30 has the amino acid sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2). The A-chain of human insulin or RHI from A.sub.1-A.sub.21 has the amino acid sequence GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1).

    [0087] An amino acid residue or residue means an amino acid in which a hydroxyl group (i.e. OH) has been removed from a carboxy group (i.e. COOH), and/or a hydrogen atom (i.e. H.sup.+) has been removed from an amino group (i.e. NH.sub.2).

    [0088] As used herein, cleavage digestion, enzymatic cleavage, enzymatic digestion, cleaving, digesting, enzyme-cleaving and like terms refer to the disruption of bonds between amino acids in a peptide chain carried out by an enzyme (e.g., carboxypeptidase B (CPB) or trypsin).

    [0089] RHI is synthesized using a single chain precursor (SCP) molecule commonly known as a preproinsulin. SCP is used interchangeably and synonymously with the term preproinsulin. An SCP typically includes a leader peptide sequence, an A-chain having 21 amino acids, a B-chain having 30 amino acids, and a C-peptide made of 1-35 (or more) amino acids connecting the A-chain and the B-chain. The leader peptide sequence may also be referred to as the signal peptide. An SCP may be synthesized using any suitable series of actions comprising gene expression, fermentation, inclusion body isolation, solubilization, and sulfonation. Commonly used master host cells for SCP synthesis include Escherichia coli (E. coli), yeast, Bacillus subtilis, Salmonella or other modified strains that are suitable for recombinant protein expression. Thus, the SCP in embodiments of the present disclosure may be produced by any suitable means known in the art. In some embodiments of the present disclosure, the SCP is synthesized using the techniques disclosed in Ferring. See European Patent No. EP087147461, entitled Generation of Human Insulin, filed Dec. 29, 1994, and granted Mar. 1, 2007, the entire contents of which are incorporated herein by reference. In some embodiments of the present disclosure, the SCP is synthesized using E. coli as the master host cell. In other embodiments of the present disclosure, the SCP is synthesized using yeast as the master host cell.

    [0090] In some embodiments of the present disclosure, the SCP has a C-peptide made of 2 amino acids, Arginine as X.sub.C2 and Lysine as X.sub.C1, in which the Arg.sup.C2 connects to (binds to) Gly.sup.A1 of the A-chain, and the Lys.sup.C1 connects to Thr.sup.B30 of the B-chain. The amino acid abbreviations, such as Arg or R for Arginine and Lys or K for Lysine, are well-known in the art and in the interest of brevity, do not need to be detailed herein. Typically, the C-peptide is a long peptide chain of about 32 amino acids or more. However, in a preferred embodiment, the C-peptide is a short peptide chain consisting of 2 amino acids, Arg.sup.C2-Lys.sup.C1. In such case, when the Arg.sup.C2-Lys.sup.C1-RHI is enzyme-cleaved to produce Lys.sup.C1-RHI and an Impurity C, the C-peptide is essentially cleaved in half.

    [0091] In other embodiments, the C-peptide comprises the Lys.sup.C1, the Arg.sup.C2, and an Arg as a last residue of the C-peptide that bonds to Gly.sup.A1 of the A-chain. In still other embodiments, the C-peptide is a short peptide chain comprising the Lys.sup.C1, the Arg.sup.C2, and an Arg as a last residue of the C-peptide that bonds to Gly.sup.A1 of the A-chain, in which the short peptide chain consists of 10 amino acids or less, including 9 amino acids, 8 amino acids, 7 amino acids, 6 amino acids, 5 amino acids, 4 amino acids, 3 amino acids, or 2 amino acids.

    [0092] In some embodiments, the SCP molecule is represented by Formula I:


    (X.sub.n-X.sub.C-term)(X.sub.B1-X.sub.B30)-(X.sub.C1-X.sub.C2)(X.sub.A1-X.sub.A21)Formula I

    [0093] With reference to Formula I,

    [0094] X.sub.n-X.sub.C-term is a leader peptide sequence, wherein:

    [0095] X.sub.n-X.sub.C-term is the C-terminal residue of the leader peptide that bonds with Phe.sup.B1 of the B-chain, and

    [0096] X.sub.n denotes any number of amino acids suitable for use together with X.sub.C-term as a leader peptide sequence. In some embodiments, X.sub.n-X.sub.C-term is at least 1, 2, 3, 4, and up to 40, 50, 60, 70 (or more) amino acids. In some embodiment X.sub.C-term is Arginine.

    [0097] With reference to Formula I,

    [0098] X.sub.B1- X.sub.B30 is the B-chain of native human insulin from amino acid residue 1 to 30 of the B chain having the amino acid sequence

    TABLE-US-00001 (SEQIDNO:2) FVNQHLCGSHLVEALYLVCGERGFFYTPKT.

    [0099] With reference to Formula I,

    [0100] X.sub.C1- X.sub.C2 is a C-peptide wherein:

    [0101] X.sub.C1is Lysine (Lys.sup.C1), and Lys.sup.C1 bonds with Thr.sup.B30 of the B-chain,

    [0102] X.sub.C2 is Arginine (Arg.sup.C2), and Arg.sup.C2 bonds with Gly.sup.A1 of the A-chain, thus C-peptide has an amino acid sequence of KR (SEQ ID NO: 3).

    [0103] With reference to Formula I,

    [0104] X.sub.A1-X.sub.A21 is the A-chain of native human insulin from amino acid residue 1 to 21 of the A-chain having the amino acid sequence GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1).

    [0105] In some embodiments of the present disclosure, an SCP according to Formula I includes the leader peptide sequence X.sub.n-X.sub.C-term having AX.sub.mR, in which the carboxyl terminal of the R connects to Phe.sup.B1 of the B-chain, and X.sub.m is any suitable number of amino acids, such as 1, 2, 3, 4, and up to 40, 50, 60, or 70 amino acids. Therefore, an exemplary embodiment of an SCP according to Formula I has the amino acid sequence of:

    TABLE-US-00002 5AXmR-FVNQHLCGSHLVEALYLVCGERGFFYTPKT-KR- GIVEQCCTSICSLYQLENYCN3

    [0106] In some embodiments of the present disclosure, SCP is represented by Formula II:


    (X.sub.n-X.sub.Cterm)-(X.sub.B1-X.sub.B30)-(X.sub.C1-X.sub.C2-X.sub.C-term)-(X.sub.A1-X.sub.A21)Formula II

    [0107] With reference to Formula II,

    [0108] X.sub.n-X.sub.C-term is a leader peptide sequence, wherein:

    [0109] X.sub.C-term is the C-terminal residue of the leader peptide that bonds with Phe.sup.B1 of the B-chain,

    [0110] X.sub.n denotes any number of amino acids suitable for use as a leader peptide sequence. In some embodiments, X.sub.n-X.sub.C-term is at least 1, 2, 3, 4, and up to 40, 50, 60, 70 amino acids. In some embodiment X.sub.C-term is Arginine.

    [0111] With reference to Formula II,

    [0112] X.sub.B1-X.sub.B30 is the B-chain of native human insulin from amino acid residue 1 to 30 of the B chain having the amino acid sequence

    TABLE-US-00003 (SEQIDNO:2) FVNQHLCGSHLVEALYLVCGERGFFYTPKT.

    [0113] With reference to Formula II,

    [0114] X.sub.C1-X.sub.C2-X.sub.C-term is a C-peptide, wherein:

    [0115] X.sub.C1is Lysine (Lys.sup.C1), Lys.sup.C1 bonds with Thr.sup.B30 of the B-chain,

    [0116] X.sub.C2 is Arginine (ArG.sup.C2),

    [0117] X.sub.C-term is Arginine (Arg.sup.C3), Arg.sup.C3 that bonds with Gly.sup.A1 of the A-chain.

    [0118] With reference to Formula II,

    [0119] X.sub.A1- X.sub.A21 is the A-chain of native human insulin from amino acid residue 1 to 21 of the A-chain having the amino acid sequence GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1).

    [0120] In some embodiments, the SCP according to Formula II, the leader peptide sequence X.sub.n includes at least AX.sub.mR as defined above, in which the carboxyl terminal of the Arg.sup.Xn connects to Phe.sup.B1 of the B-chain, and X.sub.C1-X.sub.C2-X.sub.C-term is KRR (SEQ ID NO: 4). Therefore, an exemplary embodiment of an SCP according to Formula II has the amino acid sequence of:

    TABLE-US-00004 5AX.sub.mR-FVNQHLCGSHLVEALYLVCGERGFFYTPKT-KRR- GIVEQCCTSICSLYQLENYCN3

    [0121] In some embodiments, the SCP may be represented by Formula III:


    (X.sub.n-X.sub.C-term)-(X.sub.B1-X.sub.B30)-(KR-X.sub.Cn-R)-(X.sub.A1-X.sub.A21),Formula III

    [0122] wherein in Formula III, a C-peptide is represented by KR-X.sub.Cn-R, wherein X.sub.Cn represents any suitable number of amino acids, such as up to 32 amino acids or more, which may include any amino acid except for Lysine, and all other variables are as defined in Formulae I and II. In some embodiments, KR-X.sub.Cn-R is KRQGR (SEQ ID NO: 5), wherein the C-peptide comprises a Lys.sup.C1, an ArG.sup.C2, and an Arg as a last residue of the C-peptide that bonds to Gly.sup.A1 of the A-chain.

    [0123] In some embodiments of Formulae I, II, or III, the SCP further includes a precursor to impurity C, such as an acetylated Lysine.sup.C1 in the C-peptide, or any other precursor that can result in impurity C. As discussed, the impurity C precursor can develop during SCP synthesis.

    [0124] Embodiments of the present disclosure include synthesizing the SCP following any suitable method expression or synthesizing technique. After synthesis, action the SCP (i.e., preproinsulin) may be processed to remove (e.g., by enzymatic cleavage) the leader peptide to produce proinsulin. In some embodiments preproinsulin is digested with trypsin, to remove the leader peptide sequence. Following removal of the leader peptide, the proinsulin has the A-chain, the B-chain, and the C-peptide, as shown in FIG. 2A. Accordingly, additional purification and enzyme cleavage actions are applied to convert the proinsulin to RHI by removing the C-peptide and impurities.

    Methods of Producing Highly Purified RHI API Having Purity of 99.0% or More, Total Impurity of 0.8% or Less, and Impurity C of 0.1% or Less.

    [0125] Embodiments of the present disclosure are directed to methods for processing the SCP into a highly purified RHI API, with 99.0% (w/w) purity or greater, a Total Impurity of 0.8% (w/w) or less, and an amount of impurity C of 0.1% (w/w) or less, based on the total weight of the RHI API. In a preferred embodiment, the highly purified RHI API is in a solid form. In other embodiments, the highly purified RHI API is in a liquid form, such as in an aqueous form.

    [0126] In some embodiments, the method 100 as presented in FIG. 1 includes actions 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, and 111 as shown, for purifying RHI with 99.0% (or more) (w/w) purity based on the total weight of the RHI API. The method 100 begins with an SCP having Formulae I, II, or III. In this exemplary embodiment of method 100, the SCP sequence has Formula I, which has a short C-peptide sequence of only two amino acids, Arg.sup.C2-Lys.sup.C1 (denoted in SEQ ID NO: 3).

    [0127] At action 101, the SCP is refolded using refolding buffers, which are known in the art. Action 101 refolds the SCP to form the proper disulfide bonds that are present in native human insulin and RHI (e.g., Cys.sup.A7-Cys.sup.B7, Cys.sup.A20-Cys.sup.B19, and Cys.sup.A6-Cys.sup.A11, respectively) as shown in FIG. 2A.

    [0128] At action 102, a Lysine protecting group, (e.g., citraconic anhydride, tert-Butyloxycarbonyl (Boc), Benzyloxycarbonyl (Cbz, Z), or Allyloxycarbonyl (Alloc)), is applied to the preproinsulin to protect the two Lysine residues present in the proinsulin. In this exemplary embodiment, Lysine residues of the proinsulin protein are present at Lys.sup.C1 of the C-peptide and Lys.sup.B29 of the B-chain. FIG. 2A shows the protected Lys.sup.C1 and Lys.sup.B29 in the refolded proinsulin.

    [0129] Action 103 is a first enzyme cleavage action. In this exemplary embodiment of method 100, trypsin is applied to the proinsulin. As shown in FIGS. 2B-2C, trypsin cleaves: (i) the peptide bond between Arg.sup.R1 of the leader peptide sequence and Phe.sup.B1 of the B-chain, and (ii) the peptide bond between Gly.sup.A1 of A-chain to ArG.sup.C2 of the C-peptide. Thus, after this first enzyme-cleaving (i.e., enzyme digestion) action, Arg.sup.R1 is no longer bonded to Phe.sup.B1 and Gly.sup.A1 is no longer bonded to Arg.sup.C2, as shown in FIGS. 2B-2C. Even though Gly.sup.A1 is no longer bonded to Arg.sup.C2, the A-chain is still bonded to the B-chain because of the disulfide bonds formed at Cys.sup.A7-Cys.sup.B7 and Cys.sup.A20-Cys.sup.B19, as also shown in FIGS. 2B-2C. FIG. 2D depicts the proinsulin at the conclusion of action 103. Also shown in FIG. 2D, Lys.sup.C1 and Lys.sup.B29 of the proinsulin are still protected by the Lysine protecting group.

    [0130] At action 104, the first column purification action utilizes anion-exchange column chromatography to separate the cleaved leader peptide sequence from the Arg.sup.C2-Lys.sup.C1-RHI. The terms Arg.sup.C2-Lys.sup.C1-RHI, Arg(C2)-Lys(C1)-RHI, Arg-Lys-RHI, Arg-Lys-insulin and Arg-Lys-RHI each have the same meaning and are used interchangeably herein to refer to human insulin A-chain and B-chain with a C-peptide of Arginine at position 2 (X.sub.C2) and Lysine at position 1 (X.sub.C1) in Formulae I and II. Other impurities may also be separated or reduced at action 104. Column chromatography, such as anion-exchange column chromatography, is known in the art for the separation of a protein of interest from the solution mixture, and/or to reduce impurities relative to the protein of interest.

    [0131] In an anion-exchange column chromatography, the ion-exchange resin contains positively-charged groups (i.e. cations), which in turn will bind to negatively-charged molecules. An anion-exchange column chromatography may be performed at a higher pH level, and in particular, at a pH above the isoelectric point of the peptide of interest so that the protein of interest has a negative charge and will bind to the positively-charged resin. Accordingly, at the end of action 104, the batch continuing onto the next actions includes primarily Arg-Lys-RHI and impurities.

    [0132] Action 105 includes a second enzyme-cleaving action. At action 105, carboxypeptidase B (CPB) is applied to the Arg-Lys-RHI. CPB is particularly effective in enzyme-cleaving the peptide bonds of basic amino acids such as Arginine and Lysine. At action 105, in some embodiments, CPB having a concentration of about 1/10000 of protein (w/w) is applied to the Arg-Lys-RHI. At action 105, in some embodiments, CPB can be applied at a pH having a range of about 7.0 to about 10.0, about 7.0 to about 8.0, about 7.5 to about 8.5, about 8.0 to about 9.0, about 8.5 to about 9.5, or about 9.0 to about 10.0. At action 105, in some embodiments, CPB can be applied at a temperature in the range of about 22 to about 28 Celsius, about 23 to about 27 Celsius, or about 24 to about 26 Celsius. At action 105, in some embodiments, CPB can be applied for at least about 1, 2, 3, 4, 5, 6, or more hours.

    [0133] As shown in FIG. 2E, because the Lysine residue at (X.sub.C1) is still protected, CPB only cleaves the peptide bond between Arg.sup.C2 and Lys.sup.C1, thereby resulting in Lys.sup.C1-RHI and unbound Arg.sup.C2. In embodiments where the C-peptide is a short peptide consisting of Arg.sup.C2-Lys.sup.C1only, then this enzyme-cleaving action 105 essentially cleaves the C-peptide in half. Subsequently, the unbound ArG.sup.C2 may be removed at action 108 as described below. Lys.sup.C1-RHI, Lys(C1)-RHI, Lys-RHI, Lys-insulin, and Lys-RHI each have the same meaning and are used interchangeably herein to refer to human insulin of A-chain and B-chain polypeptides with Lysine of the C-peptide bonded to the Threonine at position 30 of the B chain (Thr.sup.B30) after Arg.sup.C2 has been cleaved from the Arg-Lys-RHI.

    [0134] With reference to action 105, the result of adding CPB to the Arg-Lys peptide is the production of impurity C. With impurity C produced in action 105, the technical challenge was removing impurity C from Lys-RHI.

    [0135] With continued reference to action 105, because the C-peptide has only two amino acid residues, this effectively cuts the C-peptide in half, as shown in FIG. 2E. This is a deviation from the protocols in which the C-peptide has been cleaved in full in a single enzyme cleavage action. The motivation to cleave the full C-peptide (e.g., both or all amino acids) in a single enzyme cleavage action is to avoid additional impurities caused by multiple enzyme actions, which would be contrary to the goal of producing highly purified RHI. Moreover, additional impurities would require additional purification actions, which reduce yield and further complicate the overall manufacturing process. Therefore, previous protocols have cleaved the full C-peptide with one digestion action.

    [0136] While the present disclosure and methods according to embodiments of the present disclosure are not bound by any specific theory, the methods (e.g., 100) for enzyme-cleaving a C-peptide using an additional enzyme digestion action 105 in combination with action 109, unexpectedly produced a RHI API having an amount of impurity C of 0.1% (w/w) or less, which enabled the production of highly purified RHI API, in a solid form, having a purity of 99.0% (w/w) or greater and a Total Impurity of 0.8% (w/w) or less, based on the total weight of the RHI API in solid form. According to embodiments of the present disclosure, by increasing the number of enzyme-cleaving actions, it is possible to lower the amount of impurity C to 0.1% (w/w) or less in the RHI API.

    [0137] With reference to action 106, the Lysine residues at Lys.sup.C1 and Lys.sup.B29 in the Lys-RHI are de-protected by removing the Lysine protecting group. Thus, as demonstrated in FIG. 2F, the Lysine residues at Lys.sup.C1 and Lys.sup.B29 in the Lys-RHI are now susceptible of being cleaved by enzymatic digestion.

    [0138] In some embodiments, with reference to action 107, aprotinin may be optionally applied to the de-protected Lys-RHI to remove the trypsin leftover from action 103.

    [0139] Action 108 is a second column purification action, which utilizes anion-exchange column chromatography to separate the Arg.sup.C2 and other impurities from the Lys-RHI based on their charge. At action 108, the one or more impurities separated may include those commonly known in the art as well as the impurities identified herein, including the impurities identified in the Tables 1-6. Note that the separation of impurities may include the type of impurities, the amount of the impurities, or the combination thereof. In some embodiments, at action 108, anion-exchange column chromatography is performed using a pH in the range of 7.0 to 9.5, or any range subsumed therein, including but not limited to 7.0 to 9.0, 7.0 to 8.5, 7.0 to 8.0, 7.0 to 7.5, 7.5 to 9.0, 7.5 to 8.5, 7.5 to 8.0, 8.0 to 9.5, 8.0 to 9.0, or 8.0 to 8.5. In others embodiments, at action 108, anion-exchange column chromatography is performed using a pH in the range of about 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1, 9.2, 9.3, 9.4 or 9.5

    [0140] At the end of action 108, the batch continuing onto the next actions contains primarily Lys-RHI and impurities not removed in action 108, such as impurity C.

    [0141] Action 109 is a third column purification action. Prior to action 109, the batch has NMT (no more than) 20% (w/w) impurities. Action 109 utilizes reverse phase high performance liquid chromatography (RP-HPLC) utilizing a C18 phase column. Note that other phase column sizes can also be utilized at action 109, such as a C8 phase column. In some embodiments, the RP-HPLC may further include a semi-preparation column, a preparation column, or a combination thereof. In some embodiments, the semi-preparation column is a column having a length of about 250 mm and an internal diameter of about 10.0 mm, as shown in Table 1. In some embodiments, the preparation column is a column having a length of about 250 mm and an internal diameter of about 21.20 mm. In still other embodiments, the preparation column is a column having a length of about 350 mm and an internal diameter of about 100 mm. The C18 phase column can utilize a particle size of 3 m to 50 m (or any range subsumed therein), such as 3 m 5 m 10 m 15 m 20 m 25 m 30 m 35 m 40 m 45 m or 50 um.

    [0142] At action 109, this C18 phase column and RP-HPLC process is used to separate impurity C and other impurities from Lys-RHI on the basis of their respective hydrophobicity. At action 109, in some embodiments, the column chromatography is performed using mixtures of water or aqueous buffers such as (NH.sub.4).sub.2SO.sub.4 and organic solvents such as isopropyl (IPA) as mobile phase. At action 109, in some embodiments, the column chromatography is performed using a pH in the range of about 1.5 to about 3.5 or any range subsumed therein, including but not limited to, about 2.0 to about 3.0, about 2.5 to about 3.0, about 3.0 to about 3.5, about 2.2 to about 2.8, or about 2.5 to about 3.0. In some embodiments, at action 109, column chromatography is performed using a pH of about 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, or 3.5. Other impurities may also be separated or reduced at action 109.

    [0143] At the end of action 109, the batch continuing onto the next actions contains primarily Lys-RHI with impurity C (acetylated Lys-RHI) at about 0.10% (w/w) or less. This column purification action 109 in combination with the enzyme digestion action 105, unexpectedly produced Lys-RHI with 0.1% (w/w) or less impurity C based on the total weight of Lys-RHI, which in turn, ultimately produces highly purified RHI API having impurity C of 0.1% (w/w) or less based on the total weight of the highly purified RHI API.

    [0144] The process of RP-HPLC may include any suitable silica-based resin. A non-limiting example of a silica-based resin for RP-HPLC includes C18 resin, which includes 18 carbon atoms as the stationary phase. In some embodiments, other size carbon molecules may also be used in the column, such as C4 (4 carbon atoms), C5 (5 carbons), C6 (6 carbon atoms), C8 (8 carbon atoms), C12 (12 carbon atoms), C16 (16 carbon atoms), C18 (18 carbon atoms), and C20 (20 carbon atoms). In addition to carbon-bonded silica, pure silica, cyano-bonded silica, phenyl-bonded silica, and other suitable silica may be used in the RP-HPLC.

    [0145] In other embodiments, the RP-HPLC has an internal diameter of about 50 mm, 100 mm, 200 mm, 300 mm, 400 mm, 500 mm, 600 mm, or more, depending on the scale needs of the commercial production of the RHI API. In still other embodiments, the RP-HPLC has a column length of about 200 mm, 250 mm, 300 mm, 350 mm, 400 mm, 450 mm, 500 mm, 550 mm, 600 mm, or more, depending on the scale needs of the commercial production of the RHI API.

    [0146] Action 110 is a third enzyme-cleaving action. At action 110, because Lys is no longer protected, CPB is capable of enzyme-cleaving the peptide bond between Lys.sup.C1 and Thr.sup.B30, as depicted in FIG. 2G, thereby removing the C-peptide (Lys.sup.C1 residue) from the B-chain, and producing RHI. At the conclusion of action 110, the RHI is shown in FIG. 2H. Optionally, at action 110, RP-HPLC can be diluted with water to further reduce Impurity E. For example, RP-HPLC can be diluted 2, 3, 4, or more, which in turn, reduces Impurity E, as shown in Example 9.

    [0147] Action 111 is a fourth column purification action. Action 111 utilizes reverse phase high performance liquid chromatography (RP-HPLC) utilizing a C18 column to remove Lys.sup.C1 and other impurities to produce highly purified RHI having a Total Impurity of 0.8% (w/w) or less. At action 111, the one or more impurities separated may include those commonly known in the art as well as the impurities identified herein, including the impurities identified in the Tables 1-6. Note that the separation of impurities may include the type of impurities, the amount of the impurities, or the combination thereof. Note that other phase column sizes can also be utilized at action 111, such as a C8 phase column. In some embodiments, at action 111, RP-HPLC is performed using a pH in the range of about 1.5 to about 3.5 or any range subsumed therein, including but not limited to, about 2.0 to about 3.0, about 2.5 to about 3.0, about 3.0 to about 3.5, about 2.2 to about 2.8, or about 2.5 to about 3.0. In some embodiments, at action 109, column chromatography is performed using a pH of about 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, or 3.5. At the end of action 111, highly purified RHI, in liquid form, is produced and is suitable for use as an API.

    [0148] After action 111, method 100 further includes a crystallization action (not shown in FIG. 1) to produce the solid form of the RHI by using any suitable crystallization techniques, such as applying zinc and vacuum drying. With action 111, the highly purified RHI is in a solid form.

    [0149] Accordingly, method 100 produces highly purified RHI API, having a purity of 99.0% (w/w) or more, a Total Impurity of 0.8% (w/w) or less, and impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API, as shown in Examples 1-8 below. Additionally, as shown in Examples 1-4 and 7-8, method 100 can produce RHI API, having a purity of 99.0% (w/w) or more, a Total Impurity of 0.8% (w/w) or less, impurity C of 0.1% (w/w) or less, and impurity E of 0.2% (w/w) or less, all based on the total weight of the highly purified RHI API. This highly purified RHI is suitable for use as an API because of its high purity and low impurity profile. In addition, RHI API is in a solid form.

    EXAMPLES

    Examples 1-4: Disclosed Methods Produced Highly Purified RHI API Having Purity of 99.0% or More, Total Impurity of 0.8% or Less, and Impurity C of 0.1% or Less.

    [0150] Examples 1-4 used method 100 to produce highly purified RHI API, in solid form, having purity of 99.0% (w/w) or more, a Total Impurity of 0.8% (w/w) or less, and impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API in solid form, as shown in Table 1 below. In Table 1, the Total Impurity includes Impurity C, Impurity X4, Impurity D, Impurity E, and Impurity Z. The Total Impurity does not include the related substance desamido Asn.sup.A21-RHI. Table 2 identifies the RHI impurity types identified in Table 1, and the percentages of purity and impurities are based on w/w using the total weight of the highly purified solid RHI API. In Table 1, the purity and impurity percentages (w/w) of the solid RHI API were assessed shortly after the purified RHI API was crystallized into solid form.

    [0151] Also, unexpectedly, in Examples 1-4, method 100 reduced the amount of impurity E to 0.2% (w/w) or less, and as low as 0.12% (w/w), and an average of 0.15% (w/w) of less. Note that Examples 1-4 unexpectedly reduced the amount of impurity E without utilizing the optional water dilution step in action 110 of method 100.

    TABLE-US-00005 TABLE 1 Impurity Profile of Examples 1-4-Highly Purified RHI API in Solid Form Average of Examples Example No. 1 2 3 4 1-4 Column 21.2 mm 21.2 mm 10.0 mm 10.0 mm Chromato- 250 mm 250 mm 250 mm 250 mm graphy (internal diameter length) Purity (w/w) 99.54% 99.32% 99.48% 99.36% 99.43% Impurity C n. d 0.05% n. d 0.07% n.d. (w/w) (because average is 0.03%, which is below 0.05%) Impurity X4 0.06% 0.09% 0.07% 0.08% 0.08% (w/w) Impurity D n. d 0.06% n. d n. d n.d. (w/w) (because average is 0.02%, which is below 0.05%) Impurity E 0.12% 0.15% 0.13% 0.18% 0.15% (w/w) Impurity Z 0.05% 0.13% 0.11% 0.12% 0.10% (w/w) Related 0.23% 0.20% 0.21% 0.21% 0.21% Substance- Desamido Asn.sup.A21-RHI (w/w) Total Impurities 0.23% 0.48% 0.31% 0.45% 0.33% (w/w)

    [0152] In Table 1, n. d. refers to not detected and/or <0.05%.

    TABLE-US-00006 TABLE 2 Impurities Identified in Table 1 RHI-Impurity Type Identity Impurity C Acetylated Lys.sup.B31-RHI Impurity X4 Not identified* Impurity D Methylated-RHI Impurity E Thr.sup.B30 deletion-RHI Impurity Z High molecular weight product (HMWP)-dimer or multimer Impurity B + X Impurity B is Lys-RHI and Impurity X is a peak within Impurity B. *Impurity X4 is not identified because the impurity is less than 0.10% (w/w). The FDA does not generally require impurity identification when the impurity is less than 0.1% (w/w).

    [0153] To illustrate the significant technical advancement achieved by the present disclosure, Comparative Examples 1-3 are provided below to show that routine purification techniques could not produce highly purified RHI API having a purity of 99.0% (w/w) or greater, a Total Impurity of 0.8% (w/w) or less, and impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API.

    Comparative Example 1Alternative Method for Preparing RHI with Less Purity.

    [0154] Comparative Example 1 is an alternative method of producing RHI API and is provided in FIG. 3 as method 300. As shown in FIG. 3, action 301 is the refolding of the preproinsulin using refolding buffers. Comparative Example 1 is based on the RHI produced using at least some of the methods disclosed in Ferring.

    [0155] At action 302, a Lysine protecting group, citraconic anhydride, ert-Butyloxycarbonyl (Boc), Benzyloxycarbonyl (Cbz, Z), or Allyloxycarbonyl (Alloc). is applied to the proinsulin to protect the Lysine residues present in the proinsulin, which are present at Lys.sup.C1 of the C-peptide and Lys.sup.B29 of the B-chain.

    [0156] Action 303 is a first enzyme cleavage action. At action 303, trypsin is applied to the proinsulin. At action 303, trypsin cleaves: (i) the peptide bond between Arg.sup.R1 of the leader peptide sequence and Phe.sup.B1 of the B-chain, and (ii) the peptide bond between Gly.sup.A1 of A-chain to Arg.sup.C2 of the C-peptide. Thus, after this first enzyme digestion action, Arg.sup.R1 is no longer bonded to Phe.sup.B1, and Gly.sup.A1 is no longer bonded to Arg.sup.C2. However, even though Gly.sup.A1 is no longer bonded to Arg.sup.C2, the A-chain is still bonded to the B-chain because of the disulfide bonds formed at Cys.sup.A7-Cys.sup.B7 and Cys.sup.A20-Cys.sup.B19, as described in refolding action 301.

    [0157] Action 304 is a first column purification action. At action 304, the first column purification action is an anion-exchange column chromatography to separate the cleaved leader peptide sequence from the Arg.sup.C2-Lys.sup.C1-RHI. Thus, at the end of action 304, the batch continuing onto the next actions contains primarily Arg-Lys-RHI and impurities.

    [0158] At action 305, the Lysine residues at Lys.sup.C1 and Lys.sup.B29 are de-protected by removing the Lysine protecting group. Thus, the Lysine residues at Lys.sup.C1 and Lys.sup.B29 are no longer protected and susceptible to enzyme cleavage.

    [0159] Optionally, at action 306, aprotinin is applied to eliminate the trypsin leftover from action 303.

    [0160] Action 307 is a second column purification action, which is an anion-exchange column chromatography to separate the C-peptide from RHI. At the end of action 307, the batch continuing onto the next actions contains primarily RHI and impurities, such as impurity C.

    [0161] Action 308 is a second enzyme cleavage action. At action 308, because Lys is no longer protected, CPB cleaves the peptide bond between Lys.sup.C1 and Thr.sup.B30, thus disconnecting the C-peptide from B-chain, and producing RHI.

    [0162] Action 309 is a third column purification action. At action 309, a reverse phase high performance liquid chromatography (RP-HPLC), using a C18 column, is applied to remove the C-peptide and other impurities to produce RHI. The RHI was then crystallized into solid form.

    [0163] Method 300 could only achieve RHI API, in solid form, having a purity of about 97.8% (w/w), a Total Impurity of about 1.7%, impurity C of about 0.5%-0.8% (w/w), and impurity E of about 0.3%-0.5% (w/w), based on the total weight of the RHI API. In Comparative Example 1, the purity and impurity percentages (w/w) of the solid RHI API were assessed shortly after the RHI API was crystallized into the solid form.

    [0164] Significantly, method 300 differed from method 100 because method 100 includes enzyme digestion action 105 and column purification action 109, which produced an unexpected and surprising result of reduced impurity C, 0.1% (w/w) or less, which in turn enabled the production of highly purified RHI having a purity of 99.0% (w/w) or greater and a Total Impurity of 0.8% (w/w) or less, based on the total weight of the highly purified RHI API. Additionally, method 100 reduced the amount of impurity E to 0.2% (w/w) or less.

    TABLE-US-00007 TABLE 3 Examples 1-4 (Averaged) versus Comparative Example 1 Examples 1-4 Comparative Substance (Averaged) Example 1 Purity of Recombinant Human 99.43% 97.73% Insulin (RHI) (w/w) Related Substances (RSub) 0.21% 0.53% Desamido Asn.sup.A21-RHI 99.64% 98.26% RHI + Rsub (w/w) Total Impurities (w/w) 0.33% 1.73% RSub + Total Impurities (w/w) 0.54% 2.26%

    [0165] In Table 3, the purity profile of RHI API of Examples 1-4 are averaged, and compared to the purity profile of Comparative Example 1. Significantly, as shown in Table 3, Examples 1-4 had a Total Impurity of about 0.33% (w/w), which is significantly lower than the about 1.73% (w/w) Total Impurity of Comparative Example 1. In Table 3, the percentages of purity and impurities are based on w/w and more particularly w/w using the total weight of the corresponding RHI API.

    Comparative Example 2Alternative Method for Preparing RHI API with Less Purity.

    [0166] Comparative Example 2 is provided in FIG. 4 as method 400. Notably, Comparative Examples 1-2 differ primarily because of additional column purification action 407. Thus, in method 400, actions 401-406 are equivalent to actions 301-306, and actions 408-410 are equivalent to actions 307-309, and thus for brevity do not need to be described again. Column purification action 407 is a RP-HPLC using a C18 column similar to action 309. The RHI was crystallized into solid form. In Comparative Example 2, the purity and impurity percentages (w/w) of the solid RHI API were assessed shortly after the RHI API was crystallized into the solid form.

    [0167] Significantly, even with several column purification actions in method 400, method 400 could not produce highly purified RHI API, in solid form, having a purity of 99.0% (w/w) or greater and impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API. Instead, method 400 produced RHI API, in solid form, having a purity of about 98.1%/0(w/w), a Total Impurity of about 1.73% (w/w), and impurity C of about 0.5-0.7% (w/w), based on the total weight of the RHI API.

    Comparative Example 3Alternative Method for Preparing RHI API with Less Purity.

    [0168] Comparative Example 3 is provided in FIG. 5 as method 500. Notably, Comparative Examples 1 and 3 differ primarily on the switching of the anion-exchange column actions, action 509 and 307, the RP-HPLC actions, actions 507 and 309. Thus, in method 500, actions 501-506 are equivalent to actions 301-306, action 507 is equivalent to action 309, action 508 is equivalent to action 308, and action 509 is equivalent to action 307, and thus for brevity do not need to be described again. Method 500 could not produce highly purified RHI API, in solid form, having a purity of 99.0% (w/w) or greater and impurity C of 0.1% (w/w) or less based on the total weight of the highly purified RHI API. Instead, method 500 produced RHI API, in solid form, having a purity of about 96.5% (w/w) and impurity C of about 0.5-0.7% (w/w) based on the total weight of the RHI API. In Comparative Example 3, the purity and impurity percentages (w/w) of the solid RHI API were assessed shortly after the RHI API was crystallized into the solid form.

    [0169] Significantly, Comparative Examples 1-3 show that routine optimization of the column purification actions did not solve the technical problem of significantly reducing impurity C in RHI API. Instead, the unique combination of the enzyme digestion action 105 and column purification action 109, as disclosed in method 100, were instrumental in producing highly purified RHI API, in solid form, having a purity of 99.0% (w/w) or greater, a Total Impurity of 0.8% (w/w) or less, and impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API in solid form.

    Comparative Example 4Humulin R RHI

    [0170] Humulin R RHI is a commercially available RHI and is used as Comparative Example 4. In Comparative Example 4, four lots of Humulin R RHI were tested for their purity profile, as shown in Table 4, and compared to Examples 1-4.

    TABLE-US-00008 TABLE 4 Examples 1-4 (Averaged) versus Humulin R RHI Examples 1-4 Humulin R Substance (Averaged) 4 Lots Average Purity of Recombinant Human 99.43% 98.11% Insulin (RHI) (w/w) Related Substances (RSub) 0.21% 0.24% Desamido Asn.sup.A21-RHI 99.64% 98.35% RHI + Rsub (w/w) Total Impurities (w/w) 0.33% 1.65% RSub + Total Impurities (w/w) 0.54% 1.89%

    [0171] Significantly, as shown in Table 4, Examples 1-4 had a Total Impurity of about 0.33%, which is significantly lower than the about 1.65% (w/w) Total Impurity of the four lots of Humulin R RHI averaged. In Table 4, the percentage of purity and impurities are based on w/w using the total weight of the corresponding RHI API.

    Examples 5-8: Scale-up Examples of Highly Purified RHI API in Solid Form.

    [0172] To demonstrate the capability of method 100 in a scale up environment, such as large scale manufacturing, method 100 was applied to a column of 100mm350mm, which are represented as Examples 5-8 in Table 5. Refer to Table 2 for the description of the impurities in Table 5. In Table 5, the purity and impurity percentages (w/w) of the RHI API were assessed shortly after the purified RHI API was crystallized into solid form.

    TABLE-US-00009 TABLE 5 Impurity Profile of Scale-Up Examples 5-8-Highly Purified RHI API in Solid Form. Average of Examples Example No. 5 6 7 8 5-8 Column 100 mm 100 mm 100 mm 100 mm Chromato- 350 mm 350 mm 350 mm 350 mm graphy (internal diameter length) Purity (w/w) 99.16% 99.29% 99.20% 99.31% 99.24% Impurity C n. d n. d n. d n. d n.d. (w/w) Impurity X4 n. d n. d n. d n. d n.d. (w/w) Impurity D n. d 0.06% n. d n. d n.d. (w/w) Impurity E 0.36% 0.31% 0.20% 0.20% 0.27% (w/w) Impurity Z 0.08% 0.06% 0.14% 0.08% 0.09% (w/w) Impurity B + X 0.16% 0.15% 0.17% 0.21% 0.17% (w/w) Related 0.24% 0.19% 0.29% 0.19% 0.23% Substance- Desamido Asn.sup.A21-RHI (w/w) Total 0.23% 0.48% 0.31% 0.45% 0.33% Impurities (w/w)

    [0173] In Table 5, n. d. refers to not detected and/or <0.05%

    [0174] As demonstrated in scale up Examples 5-8 in Table 5, method 100 produced highly purified RHI API, in solid form, having purity of 99.0% (w/w) or more, a Total Impurity of 0.8% (w/w) or less, and impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API in solid form. Also, Examples 7-8 reduced the amount of impurity E to 0.20% (w/w). Note that Examples 7-8 unexpectedly reduced the amount of impurity E without utilizing the optional water dilution step in action 110 of method 100. However, as demonstrated in Example 9, the amount of impurity E may be further reduced using the optional water dilution step in action 110 of method 100.

    Example 9Further Reduce Amount of Impurity E.

    [0175] Optionally, at action 110, RP-HPLC can be diluted with water to further reduce Impurity E. To demonstrate, Example 9 shown in Table 6, is a study that applies water dilution to the RP-HPLC at action 110 to three (3) separate samples by 2 times (2), 3 times (3), or 4 times (4), respectively. As demonstrated in Table 6, as the water dilution times increase in action 110, the impurity E percentage decreases.

    [0176] Therefore, if Examples 1-8 utilize this optional water dilution step in action 110 of method 100, the amount of impurity E can be further reduced.

    TABLE-US-00010 TABLE 6 Further Reduce Impurity E. Sample No. 1 2 3 Lys-RHI (mg/mL) 4 4 4 Solvent (NH.sub.4).sub.2SO.sub.4/IPA Times of Water 4x 3x 2x Dilution Stop Point Lys-RHI % 2.60% 3.20% 2.10% Impurity E % 0.25% 0.35% 0.48%

    Compositions for Highly Purified RHI API Having Purity of 99.0% or More, a Total Impurity of 0.8% or Less, and Impurity C of 0.1% or Less.

    [0177] Also disclosed are compositions for active pharmaceutical ingredient (API) comprising highly purified recombinant human insulin (RHI) having a purity of 99.0% (w/w) or more, a Total Impurity of 0.8% (w/w) or less, and an impurity C of 0.1% (w/w) or less, based on the total weight of the highly purified RHI API, and wherein w/w denotes weight by weight of the highly purified RHI API. As disclosed herein, the Total Impurity does not include the related substance desamido Asn.sup.A21-RHI, and impurity C is acetylated Lys.sup.B31-RHI. Examples 1-8 provide exemplary embodiments of such compositions.

    [0178] Additionally, in other embodiments of the compositions, the highly purified RHI API has a purity of 99.0% (w/w) or greater, a Total Impurity of 0.8% or less, impurity C of 0.1% (w/w) or less, and impurity E of 0.2% (w/w) or less, based on the total weight of the highly purified RHI API. Examples 1-4 and 7-8 provide exemplary embodiments of such compositions.

    [0179] In some embodiments of the compositions, the highly purified RHI API has a purity of 99.3% (w/w) or more based on the total weight of the highly purified RHI API. In some embodiments, the highly purified RHI API composition is in a solid form. In other embodiments, the highly purified RHI API composition is in a liquid form, such as an aqueous form. Exemplary embodiments of these API compositions are provided in Examples 1-8 and these API compositions can be produced using method 100.

    [0180] The disclosed highly purified API RHI compositions will provide the basis for developing recombinant human insulin drug products with high purity and less impurity, such as recombinant human insulin drug formulations for subcutaneous or intravenous injection.