VASOPRESSIN-2 RECEPTOR ANTAGONIST PEPTIDES AND USES THEREOF

20230234994 · 2023-07-27

Assignee

Inventors

Cpc classification

International classification

Abstract

A peptide may include a sequence having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1, i.e., RPSX.sub.1CNLPVKPGPCX.sub.2GFFSAFYYSQKX.sub.3NKCHSFTYGGCAGNANRFSTX.sub.4EKCRRTC X.sub.5X.sub.6, wherein, X.sub.1 is the amino acid residue F or G, X.sub.2 is any amino acid residue, except a basic amino acid residue, X.sub.3 is the amino acid residue T or D, X.sub.4 is the amino acid residue I, L, or E, (i) X.sub.5 is V and X.sub.6 is G or (ii) X.sub.5 is G and X6 is V, and the amino acid located at position 39 is A. Such peptides may have various diagnostic and therapeutic uses.

Claims

1. A peptide, comprising: a sequence having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1: TABLE-US-00007 RPSX.sub.1CNLPVKPGPCX.sub.2GFFSAFYYSQKX.sub.3NKCHSFTYGGCAGNANRFST X.sub.4EKCRRTCX.sub.5X.sub.6 (1),  wherein: X.sub.1 is amino acid residue F or G, X.sub.2 is any amino acid residue, except a basic amino acid residue, X.sub.3 is amino acid residue T or D, X.sub.4 is amino acid residue I, L, or E, (i) X.sub.5 is V and X.sub.6 is G or (ii) X.sub.5 is G and X.sub.6 is V, and the amino acid located at position 39 is A.

2. The peptide of claim 1, wherein X.sub.1 is the amino acid residue G.

3. The peptide of claim 1, wherein X.sub.2 is an amino acid residue selected from the group consisting of A, D, E, F, G, I, L, N, M, Q, S, T, V, and Y.

4. The peptide of claim 1, wherein X.sub.3 is the amino acid residue D.

5. The peptide of claim 1, wherein X.sub.4 is the amino acid residue E.

6. The peptide of claim 1, comprising the amino acid sequence of SEQ ID NO. 1.

7. The peptide of claim 1, comprising an amino acid sequence selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 3, SEQ ID NO. 4, SEQ ID NO. 5, and SEQ ID NO. 6.

8. The peptide of claim 1, which is labeled with a detectable molecule.

9. A nucleic acid, encoding the peptide of claim 1.

10. An expression vector, comprising the nucleic acid of claim 9.

11. A pharmaceutical composition, comprising: a peptide of claim 1; and a physiologically acceptable carrier.

12. A method for treating a subject affected with a pathological condition involving the V2R pathway, the method comprising: administering the peptide of claim 1, to the subject in need thereof.

13. A method for treating a subject affected with at least one disease selected from the group consisting of an euvolemic hyponatremia pathologic condition, hypovolemic hyponatremia pathologic condition, Nephrogenic Syndrome of Inappropriate Antidiuresis, Congenital Nephrogenic Diabetes Insipidus, Polycystic kidney disease, cancer, thrombosis, Meniere disease, refractory liver disease, and heart failure, the method comprising: administering the peptide of claim 1 to a subject in need thereof.

14. A method for detecting one or more cells expressing vasopressin-2 receptor, the method comprising: administering the peptide of claim 8 in vitro; and detecting the one or more cells expressing vasopressin-2 receptor.

15. An in vitro method for detecting a dysregulation of vasopressin-2 receptor cell expression, the comprising: (a) bringing cells with the peptide of claim 8; (b) measuring an expression level value of vasopressin-2 receptor cell expression; (c) comparing the expression level value obtained in the measuring (b) with a reference expression level value; and (d) determining an occurrence of a dysregulation of vasopressing-2 receptor cell expression.

16. An in vitro diagnostic, comprising the peptide of claim 1.

17. The peptide of claim 1, wherein X.sub.4 is the amino acid residue L.

Description

DESCRIPTION OF THE FIGURES

[0044] FIG. 1 illustrates in silico prediction of the immunogenicity of the known MQ1 V2R antagonist peptide of SEQ ID NO.7 (which may also be termed “U-Da2a) and a V2R antagonist termed MQ-LEAD according to the disclosure of SEQ ID NO. 6, respectively.

[0045] The sequences of the two peptides have been entered into the NETMHCNETMHCPAN 3.2 software (www.IEDB.org), By selecting HLA-DR molecules among the most frequent in the European and North American population.

[0046] NETMHC software allows predicting the possible association of the sequences with HLA class II molecules. The selected class II HLA molecules are among the most frequent in the European and North American population. The predicted score is a percentile which is reported for each sequence of 9 amino acids on the first amino acid. The lower the score, the stronger the association of the sequence with the HLA class II molecule is expected to be.

[0047] In FIG. 1, each numbered row corresponds to an amino acid residue of each of the 57 amino acid residues long peptide. Upper panel: the known MQ1 V2R antagonist peptide. Lower panel: the MQ-LEAD peptide of SEQ ID NO. 6). In the lines named “DRBx_nnnn”, DRBx is the name of the HLA-DRB locus and nnnn the number of the allele.

[0048] Immunogenicity scores: (i) Score below 10% (black), (ii) between 10 and 20% (dark grey) and (iii) between 20% and 30% (light grey). Bold and underlined positions in the lower panel consist of the differences in amino acid residues in the MQ-LEAD peptide as compared with the MQ1 peptide.

[0049] FIG. 2 illustrates the binding of V2R antagonist peptides according to the disclosure to V2R, as compared with the V2R binding property of the known MQ1 peptide. Abscissa: log of Molar concentration of the tested V2R antagonist peptides or MQ1 peptides. Ordinate: 3H-AVP Bound, % of control

[0050] FIG. 3 illustrates the effects of V2R antagonist peptides on diuresis. The tested V2R antagonist peptides were injected i.p. in rat (SprageDelay) at 3 nmol/kg each day (arrows) and diuresis was followed over time.

[0051] FIG. 3A. Abscissa: Time period, as expressed in hours. Ordinate: diuresis, as expressed in ml/h/kg. Tested conditions; (i) MQ1 peptide [black circle “.circle-solid.”, dashed line], (ii) MQ-LEAD [black square “□”, continuous line] and (iii) MQ K39A [black triangle “.box-tangle-solidup.”, continuous line].

[0052] FIG. 3B. Abscissa: from the left to the right: (i) MQ-LEAD [Black bar], (ii) MQ1 peptide [dashed bar] and (iii) MQ K39A [empty bar].

[0053] FIG. 4 illustrates a schematic representation of the experimental study design.

[0054] FIG. 5 illustrates the effects of MQ-LEAD at 3 doses, tolvaptan at 1 dose and their vehicles on natremia on days 0-2-3-4 in male rats implanted with DDAVP on day 0.

[0055] Abscissa: time period, as expressed in days. Ordinate: blood Na+ concentration, as expressed in mM. Tested conditions: (i) open circle “◯”: vehicle for tolvaptan, 1% HPMC in distilled water, (ii) black square “.square-solid.”: vehicle for the V2R antagonist peptide MQ-LEAD, physiological saline, (iii) open square “□”: tolvaptan, (iv) reverse triangle “.Math.”: MQ-LEAD at 20 μg/kg, (v) diamond “.diamond-solid.”: MQ-LEAD at 60 μg/kg and (vi) black square “.square-solid.”: MQ-LEAD at 200 μg/kg.

[0056] FIG. 6 illustrates inhibition of cAMP production by V2R antagonist peptides. Abscissa: concentration of peptide, as expressed in −Log(M). Ordinate: inhibition of cAMP production, as expressed as percent of control. (i) Circle “.circle-solid.”: MQ1 peptide; (ii) square “.square-solid.”: MQ K39A peptide; (iii) triangle “.box-tangle-solidup.”: MQ-LEAD peptide.

DETAILED DESCRIPTION OF THE DISCLOSURE

Definitions

[0057] The term “subject” refers to any single subject for which therapy is desired or that is participating in a clinical trial, epidemiological study or used as a control, including humans and mammalian veterinary patients such as cattle, horses, dogs and cats. In certain preferred embodiments, the subject is a human.

[0058] The term “treat” or “treating” a cancer as used herein means to administer a combination therapy according to the present invention to a subject having a cancer.

[0059] The term “pharmaceutically acceptable” means what is useful in preparing a pharmaceutical composition generally safe, non-toxic, and neither biologically nor otherwise undesirable and includes what is acceptable for veterinary as well as human pharmaceutical use.

[0060] Within the scope of the present invention, the “percentage identity” between two sequences of nucleic acids or peptides/proteins means the percentage of identical nucleotides or amino acid residues between the two sequences to be compared, obtained after optimal alignment, this percentage being purely statistical and the differences between the two sequences being distributed randomly along their length. The comparison of sequences is traditionally carried out by comparing the sequences after having optimally aligned them, said comparison being able to be conducted by segment or by using an “alignment window”. Optimal alignment of the sequences for comparison can be carried out, in addition to comparison by hand, by means of the local homology algorithm of Smith and Waterman (1981), by means of the local homology algorithm of Neddleman and Wunsch (1970), by means of the similarity search method of Pearson and Lipman (1988) or by means of computer software using these algorithms (GAP, BESTFIT, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis., or by the comparison software BLAST NR or BLAST P).

[0061] The percentage identity between two sequences is determined by comparing the two optimally-aligned sequences in which the sequence to compare can have additions or deletions compared to the reference sequence for optimal alignment between the two sequences. Percentage identity is calculated by determining the number of positions at which the nucleotide or amino acid residue is identical between the two sequences, preferably between the two complete sequences, dividing the number of identical positions by the total number of positions in the alignment window and multiplying the result by 100 to obtain the percentage identity between the two sequences.

[0062] As used herein, “V2R antagonist activity” relates to the activity of a substance, such as the activity of a peptide, to (i) bind to a V2R, most preferably a human V2R, with a binding affinity value of less than 100 nM and (ii) inhibit cAMP production with an IC50 value of less than 1000 nM.

DETAILED DISCLOSURE

[0063] The present disclosure relates to a family of vasopressin-2 receptor antagonists that may be mainly used for medical and diagnostic purposes.

[0064] The inventors have identified a family of peptides, sharing specific structural features, that behave as highly potent vasopressin-2 antagonists, both in vitro and in vivo. These peptides are derived from the known MQ1 peptide (also termed “U-Da2a”) described in the PCT application published under n° WO 2014/041526.

[0065] The inventors have found that a plurality of MQ1-derived peptides, having as the common feature the presence of a Lysine (K) residue at the amino acid position 39, inhibit the activity of the human vasopressin-2 receptor (also termed “V2R” herein) at the nanomolar level. Noticeably, the said family of peptides that are disclosed possesses a significantly higher V2R inhibition capacity than that of the known MQ1 peptide. These peptides have an affinity for V2R which is several times higher than the known MQ1 peptide, such as eight times higher affinity for V2R as compared to the known MQ1 peptide.

[0066] These peptides disclosed herein behave as strong antagonist compounds of the vasopressin-2 receptor and will then be collectively termed “V2R antagonist peptides” herein.

[0067] As shown in the examples, the V2R antagonist peptides disclosed herein strongly inhibit cAMP production by V2R-expressing cells under vasopressin activation, at a much lower concentration than the known MQ1 peptide.

[0068] In vivo, the V2R antagonist peptides of the present disclosure actually induce an aquaretic effect. Noticeably, the V2R antagonist peptides disclosed herein are about 500 times more potent than tolvaptan, the most therapeutically used V2R antagonist compound, for treating hyponatremia, i.e. are about 500 times more potent than the major V2R antagonist compound that is actually used in such a physiological context, to date.

V2R Antagonist Peptides

[0069] The present disclosure relates to a peptide comprising a sequence having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1 below:

TABLE-US-00002 RPSX.sub.1CNLPVKPGPCX.sub.2GFFSAFYYSQKX.sub.3NKCHSFTYGGCAGNANRFST X.sub.4EKCRRTCX.sub.5X.sub.6
wherein, [0070] X1 means the amino acid residue F or G, [0071] X2 means any amino acid residue, excepted a basic amino acid residue, [0072] X3 means the amino acid residue T or D, [0073] X4 means the amino acid residue I, L or E, [0074] (i) X5 means V and X6 means G or (ii) X5 means G and X6 means V, and [0075] the amino acid located at position 39 is A.

[0076] As used herein, “X.sub.n” and “Xn” may be indifferently used for meaning the same variable amino acid residue.

[0077] As used herein, amino acid residues may be selected in the group consisting of Alanine (A), Arginine R, Asparagine (N), Aspartic acid (D), Cysteine (C), Glutamic acid (E), Glutamine (Q), Glycine (G), Histidine (H), Isoleucine (I), Leucine (L), Lysine (K), methionine (M), phenylalanine (F), Proline (P), Serine (S), Threonine (T), Tryptophan (W), Tyrosine (Y) and Valine (V) as well as amino acid analogs including D-amino acids, beta alanine, gamma-aminobutyric acid, delta-aminolevulinic acid, 4-aminobenzoic acid, aminoisobutyric acid, dehydroalanine, cystine, cystathionine, lanthionine, djenkolic acid, diaminopimelic acid, norleucine, alloisoleucine, isoserine, N-ethyl glycine, N-propyl glycine, N-isopropyl glycine, N-methyl alanine, N-ethyl alanine, and isoserine.

[0078] However, amino acid residues are most preferably selected in the group consisting of the 20 conventional amino acid residues.

[0079] All amino acids in the peptides of the invention can be in both D- or L-form, although the naturally occurring L-form is preferred.

[0080] Without wishing to be bound by any particular theory, the inventors believe that there is a direct relationship between the high V2R antagonist properties of the peptides disclosed herein and the presence of an alanine residue (A) at the amino acid position 39 of SEQ ID NO. 1.

[0081] As shown in the examples herein, the V2R antagonist peptides disclosed herein are also expected to be endowed with a reduced immunogenicity. The reduced immunogenicity of these peptides allows qualifying them for being used for treating various pathologic conditions linked to a V2R dysfunction, especially those requiring their repeated administration to a subject, such as, illustratively, Nephrogenic Syndrome of Inappropriate diuresis or congenital Nephrogenic Diabetes Insipidus.

[0082] Further, without wishing to be bound by any particular theory, the inventors believe that the V2R antagonist peptides according to the present disclosure are highly selective for V2R, as it has been shown for the known MQ1 peptide. Indeed, a high selectivity of the V2R antagonist peptides for V2R means that low undesirable effects are to be expected when administered for therapeutic purposes, in contrast, for example, to the largely used V2R antagonist tolvaptan for which a number of undesirable effects have been reported due to its moderate selectivity for V2R.

[0083] The inventors believe that the affinity of a V2R antagonist peptide disclosed herein is not substantially affected by the identity of the amino acid residue X2, excepted if the amino acid residue X2 consists of a basic amino acid residue. In contrast, the presence of a basic amino acid residue as the amino acid residue X2 negatively affect the affinity of the peptide for the V2R, causing an alteration of its capacity of binding to V2R.

[0084] As used herein, including for the amino acid residue X2, a basic amino acid residue consists of an amino acid residue, either being a conventional or an unconventional amino acid residue, that is positively charged at pH 7.0. Basic conventional amino acid residues are selected in the group consisting of K (Lysine), R (Arginine) and H (Histidine).

[0085] Thus, in preferred embodiments, X2 means any amino acid residue excepted K, R and H.

[0086] In preferred embodiments, X2 means an amino acid residue selected in the group consisting of A, D, E, F, G, I, L, N, M, Q, S, T, V and Y.

[0087] In other preferred embodiments, X2 means an amino acid residue selected in the group consisting of N, A, E, F and I.

[0088] In further preferred embodiments, X2 means the amino acid residue N or A.

[0089] Similarly, the identity of the two neutral amino acids X5 and X6 located at the C-terminal end of a V2R antagonist peptide disclosed herein shall not substantially affect the binding ability of the said peptide to V2R.

[0090] In most preferred embodiments, the present disclosure concerns peptides having 80% amino acid identity or more with the peptide of SEQ ID NO. 1 and comprising no deletion and no addition of an amino acid residue as compared with the peptide of SEQ ID NO. 1. Thus, most preferably, a V2R antagonist peptide according to the present disclosure has 57 amino acids in length, the amino acid sequence thereof comprising no amino acid deletion and no amino acid addition as compared with SEQ ID NO. 1

[0091] Peptides having an amino acid sequence which has 80% amino acid identity with SEQ ID NO. 1 most preferably consist of peptides exclusively differing from the peptide of SEQ ID NO. 1 by the presence of one or more substitutions of an amino acid residue as compared with SEQ ID NO. 1, thus peptides having 57 amino acid residues in length and comprising one or more amino acid substitutions as compared with SEQ ID NO. 1.

[0092] A peptide whose sequence has 80% amino acid identity with SEQ ID NO. 1 may comprise up to 11 amino acid substitutions as compared with SEQ ID NO. 1. The present disclosure encompasses peptides having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 substitutions of one amino acid residue as compared with SEQ ID NO. 1.

[0093] The disclosure thus encompasses V2R antagonist peptides comprising an amino acid sequence having 80% or more amino acid identity with SEQ ID NO. 1 and comprising one or more modification into one or more amino acid residues, peptide bonds, N- and/or C-terminal ends of the protein, as long as the V2R antagonist activity is maintained. These modifications which are introduced into the peptide by the conventional methods known to those skilled in the art, include, in a non-limiting manner the substitution of a natural amino acid with a non-proteinogenic amino acid (D amino acid or amino acid analog); the modification of the peptide bond, in particular with a bond of the retro or retro-inverso type or a bond different from the peptide bond; the cyclization, and the addition of a chemical group to the side chain or the end(s) of the protein, in particular for coupling an agent of interest to a V2R peptide antagonist described herein. These modifications may be used to label the V2R antagonist peptide, or alternatively to further increase its affinity for V2R, its bioavailability and/or its stability.

[0094] In some embodiments, in a V2R antagonist peptide as disclosed herein; one or more amino acid residues targeted by endoproteases are replaced by their corresponding non-natural D-form. For example, one or more arginine and/or lysine residues which are targets for trypsin can be replaced by their corresponding non-natural form.

[0095] In some embodiments, in a V2R antagonist peptide as disclosed herein, one or more disulfide bridges are replaced by non-natural links. Preferably, said non-natural link is resistant to reduction, such as, for example, a thiazolidine linker. These linkers increase the resistance of the protein of the invention to reducing agents present in biologic fluids.

[0096] Most preferably, a V2R antagonist peptide according to the present disclosure, which encompasses peptides comprising one or more amino acid substitutions as compared with SEQ ID NO. 1, comprises cysteine residues located at the amino acid positions corresponding to positions 5 and 55 of SEQ ID NO. 1.

[0097] Most preferably, a V2R antagonist peptide according to the present disclosure, which encompasses peptides comprising one or more amino acid substitutions as compared with SEQ ID NO. 1, comprises cysteine residues located at the amino acid positions corresponding to positions 14 and 38 of SEQ ID NO. 1.

[0098] Most preferably, a V2R antagonist peptide according to the present disclosure, which encompasses peptides comprising one or more amino acid substitutions as compared with SEQ ID NO. 1, comprises cysteine residues located at the amino acid positions corresponding to positions 30 and 51 of SEQ ID NO. 1.

[0099] In some embodiments of a peptide as disclosed herein, X1 means the amino acid residue G (Glycine).

[0100] In some embodiments of a peptide as disclosed herein, X2 means the amino acid residue A (Alanine).

[0101] In some embodiments of a peptide as disclosed herein, X3 means the amino acid D (Aspartic acid).

[0102] In some embodiments of a peptide as disclosed herein, X4 means the amino acid residue E (Glutamic acid) or L (Leucine).

[0103] The present disclosure also relates to a peptide comprising the amino acid sequence of SEQ ID NO. 1, wherein each of X1 to X6, one independently from the others, have the meanings described for SEQ ID NO. 1. It also pertains to a peptide consisting of the amino acid sequence of SEQ ID NO. 1, wherein each of X1 to X6, one independently from the others, have the meanings described for SEQ ID NO. 1.

[0104] The present disclosure also concerns a peptide having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1, wherein X1 means F, X2 means N, X3 means T, X4 means I, and X5 and X6 have the same meaning as for SEQ ID NO.1. Most preferably, X5 means V and X6 means G. The present disclosure further concerns a peptide having 80% amino acid identity with the peptide of SEQ ID NO. 2, which encompasses a peptide consisting of SEQ ID NO. 2.

[0105] The present disclosure also relates to a peptide having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1 wherein X1 means F, X2 means N, X3 means T, X4 means L, and X5 and X6 have the same meaning as for SEQ ID NO.1. Most preferably, X5 means V and X6 means G. The present disclosure further relates to a peptide having 80% or more amino acid identity with the peptide of SEQ ID NO. 3. It also pertains to a peptide consisting of the amino acid sequence of SEQ ID NO. 3.

[0106] The present disclosure also relates to a peptide having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1 wherein X1 means F, X2 means A, X3 means T, X4 means L, and X5 and X6 have the same meaning as for SEQ ID NO.1. Most preferably, X5 means V and X6 means G. The present disclosure further relates to a peptide having 80% or more amino acid identity with the peptide of SEQ ID NO. 4. It also pertains to a peptide consisting of the amino acid sequence of SEQ ID NO. 4.

[0107] The present disclosure also relates to a peptide having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1 wherein X1 means G, X2 means N, X3 means D and X4 means I, and X5 and X6 have the same meaning as for SEQ ID NO.1. Most preferably, X5 means V and X6 means G. The present disclosure further relates to a peptide having 80% or more amino acid identity with the peptide of SEQ ID NO. 5. It also pertains to a peptide consisting of the amino acid sequence of SEQ ID NO. 5.

[0108] The present disclosure also relates to a peptide having 80% or more amino acid identity with the amino acid sequence of SEQ ID NO. 1 wherein X1 means G, X2 means N, X3 means D, X4 means E, and X5 and X6 have the same meaning as for SEQ ID NO.1. Most preferably, X5 means V and X6 means G. The present disclosure further relates to a peptide having 80% or more amino acid identity with the peptide of SEQ ID NO. 6. It also pertains to a peptide consisting of the amino acid sequence of SEQ ID NO. 6.

[0109] The present disclosure also relates to a compound of the following formula (I):


[Nt-EXT]n-L1x-[V2R-AP]-L2y-[Ct-EXT]m  (I),

wherein: [0110] [Nt-EXT] means a chemical moiety which is covalently linked to the N-terminal end of a V2R antagonist peptide as disclosed herein, [0111] [V2R-AP] means a V2R antagonist peptide according to the present disclosure, [0112] [Ct-EXT] means a chemical moiety which is covalently linked to the C-terminal end of a V2R antagonist peptide as disclosed herein, and [0113] each of n and m, independently mean an integer equal to 0 or 1, [0114] Each of L1 and L2 is a linker moiety which, when present, may avoid inhibiting interactions (i) between [Nt-EXT] and [V2R-AP] and (ii) between [Ct-EXT] and [V2R-AP], respectively, and. Further importantly, each of L1 and L2, when present, is useful for preventing any of [Nt-EXT] and [Ct-EXT] affecting the binding of the V2R antagonist peptide [V2R-AP] to the V2R. [0115] each of x and y, independently mean an integer equal to 0 or 1.

[0116] In some preferred embodiments [Nt-EXT] and/or [Ct-EXT], when present, independently mean a non-protein chemical moiety, such as a non-protein detectable molecule which is used for labeling a V2R antagonist peptide, like a radioactive chemical moiety or a fluorophore-containing chemical moiety, or a stabilization moiety such as ZZ, DsBa and DsBb. In some of these embodiments, [Nt-EXT] and/or [Ct-EXT] is an agent which increases the bioavailability of a V2R antagonist peptide as described herein, and in particular which reduces its urinary elimination, such as, for example, a polyethylene glycol molecule. In some preferred embodiments, [Nt-EXT] and/or [Ct-EXT], when present, may independently mean a polyalkylene glycol, and especially a polyethylene glycol. These preferred embodiments encompass a polyethylene glycol of formula H—(O—CH.sub.2—CH.sub.2)n-O— wherein n is an integer ranging from 5 to 20, advantageously from 10 to 15, such as n consisting of an integer meaning 12.

[0117] In some other preferred embodiments, [Nt-EXT] and/or [Ct-EXT], when present, independently mean a protein moiety, which encompasses protein/peptide moieties including those which allow the purification, detection, immobilization, and/or cellular targeting of the protein of the invention, and/or which increase the affinity for V2R, the bioavailability, the production in expression systems and/or stability of the V2R antagonist peptide. These protein moieties may be selected from: (i) a labeling moiety such as a fluorescent protein (GFP and its derivatives, BFP and YFP), (ii) a reporter moiety such as an enzyme tag (luciferase, alkaline phosphatase, glutathione-transferase (GST), β-galactosidase), (ii) a binding moiety such as an epitope tag (polyHis6, FLAG, HA, myc), a DNA-binding domain, a hormone-binding domain, a poly-lysine tag for immobilization onto a support, and (iii) a targeting moiety for addressing the compound of formula (I) to a specific cell type or cell compartment. In addition, the compound of formula (I) advantageously comprise a linker (L1, L2) which links each of [Nt-EXT] and/or [Ct-EXT] to [V2R-AP] which linker is long enough to avoid inhibiting interactions between sequence [V2R-AP] and each of [Nt-EXT] and/or [Ct-EXT], when present. The linker L1 and/or L2 may also comprise a recognition site for a protease, for example, for removing affinity tags and stabilization moieties from the purified chimeric protein according to the present invention.

[0118] In some embodiments, a linker moiety L1 and/or L2 may comprise a recognition site for a protease, for example, for removing affinity tags and stabilization moieties from a compound of formula (I) according to the present disclosure.

[0119] In addition, a V2R antagonist peptide as described herein, or some embodiments of a compound of formula (I), may advantageously be modified by means well-known to those skilled in the art, in order to change its physiological properties, and in particular in order to improve its half-life time in the organism (glycosylation: HAUBNE R. et al, J. Nucl. Med., 2001, 42, 326-36; conjugation with PEG: KIM TH. et al, Biomaterials, 2002, 23, 2311-7), its solubility (hybridization with albumin: KOEHLER MF. et al, Bioorg. Med. Chem. Lett., 2002, 12, 2883-6), its resistance to proteases (unnatural amino acids (D conformation, for example)), and/or its intestinal absorption (Lien et al, TIB, 2003, 21, 556-).

Synthesis of a V2R Antagonist Peptide

[0120] A V2R antagonist peptide as described herein can be produced by a known cloning technology or by chemical synthesis.

[0121] For example, DNA encoding a V2R antagonist peptide is prepared by use of a cloning technology and inserted into an autonomously replicable vector to prepare a recombinant DNA. The recombinant DNA is introduced into an appropriate host, such as Escherichia coli, Bacillus subtilis, Actinomyces, yeast, filamentous fungus, a plant cell, an insect cell and an animal cell, to obtain a transformant. From the cultured product of the transformant, a V2R antagonist peptide as disclosed herein can be obtained. Alternatively, DNA encoding a V2R antagonist peptide is prepared and subjected to an acellular protein-synthesis system using wheat germ and a cell extract from Escherichia coli, to synthesize the peptide according to the disclosure.

[0122] The disclosure encompasses the use of a nucleic acid encoding a V2R antagonist peptide as described herein in expressible form or a recombinant vector comprising the said nucleic acid. The nucleic acid encoding a V2R antagonist peptide in expressible form refers to a nucleic acid molecule which, upon expression in a cell or a cell-free system results in a functional peptide.

[0123] Indeed, in the embodiments wherein a compound of formula (I) consists of a protein, the said compound of formula (I) may also be produced as a recombinant protein, according to the same methods as above.

[0124] Moreover, using a customary chemical synthesis method for a V2R antagonist peptide as disclosed herein, such as a “solid phase method” or “a liquid phase method”, amino acids are successively connected and extended by dehydration/condensation. A method of synthesis of V2R antagonist peptides by chemical synthesis is described in the examples herein.

Pharmaceutical Compositions

[0125] The present disclosure further relates to the use of a V2R antagonist peptide described herein, or in some embodiments a compound of formula (I) including the said V2R antagonist peptide, for medical purposes, and especially for treating pathologic conditions involving the V2R pathway.

[0126] The disclosure also encompasses the use of a nucleic acid encoding a V2R antagonist peptide as described herein, or alternatively some protein embodiments of a compound of formula (I), in expressible form, or a recombinant vector comprising the said nucleic acid. The nucleic acid encoding such a protein in expressible form refers to a nucleic acid molecule which, upon expression in a cell or a cell-free system results in a functional protein, i.e. a protein consisting of a V2R antagonist.

[0127] Thus, according to the present disclosure, the said protein, the said nucleic acid and/or the said recombinant vector may be included in a pharmaceutical composition, further comprising a pharmaceutically acceptable carrier.

[0128] A pharmaceutical composition according to the present disclosure may be formulated for administration by a number of routes, including, but not limited to, enteral (e.g., oral), parenteral, intravenous, intramuscular, intra-arterial, subcutaneous, transdermal, intradermal, rectal, intravaginal, intraperitoneal, topical, mucosal, nasal, buccal, sublingual; and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.

[0129] In some embodiments, a pharmaceutical composition according to the disclosure may be in any suitable form encompassed by the state in the art, e.g. in the form of an injectable solution or suspension, a tablet, a coated tablet, a capsule, a syrup, a suppository, a cream, an ointment, a lotion, and the like.

[0130] Pharmaceutical compositions comprising a V2R antagonist peptide or a selected compound of formula (I) may be presented in a powder form of a lyophilizate wherein the active ingredient is combined with a sugar such as mannitol. For its use, such a pharmaceutical composition shall be generally reconstituted with an appropriate volume of water or of chloride sodium solution. Then, the resulting liquid pharmaceutical composition may be administered by the appropriate administration route.

[0131] In a pharmaceutical composition, a V2R antagonist peptide or a selected compound of formula (I) is combined with one or more pharmaceutically acceptable carriers, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.

[0132] In certain embodiments, the pharmaceutical composition may further comprise one or more salts, one or more buffering agents, and/or one or more preservatives.

[0133] The pharmaceutically acceptable carriers are those known from the skilled person and which are conventionally used.

[0134] Within the scope of the instant disclosure, a “pharmaceutically acceptable carrier” refers to a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting a prophylactically or therapeutically active agent.

[0135] In certain embodiments, a suitable pharmaceutically acceptable carrier may be selected in a group including sugars, such as lactose, glucose and sucrose; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; buffering agents, such as magnesium hydroxide and aluminum hydroxide; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and the like.

[0136] A pharmaceutical composition according to the present disclosure comprises a therapeutically effective amount of a V2R antagonist peptide described herein, or of a selected embodiment of a compound of formula (I), or of a nucleic acid or a recombinant vector encoding the same, e.g., an amount sufficient to exert a medical benefit to the individual to whom it is administered. The pharmaceutically effective dose depends upon the kind of composition used, the route of administration, whether the administration is in single or multiple doses, the type of mammal (human or non-human mammal) being treated, the physical characteristics of the individual's parameters including age, physical condition, size, weight, concurrent medication, and other factors, that those skilled in the medical arts will recognize. Thus, within the scope of the instant disclosure, the effective amount of the active ingredient to be administered, especially the amount of an V2R antagonist peptide or of the selected compound of formula (I), may be determined by a physician or an authorized person skilled in the art and can be suitably adapted within the time course of the treatment.

[0137] A V2R antagonist peptide, or a selected compound of formula (I), may be administered at an amount per administration step ranging from 0.1 to 300 nanomoles of the selected V2R antagonist peptides per kg of body weight, depending of the above-described individual parameters. The inventors believe that administering a V2R antagonist peptide as disclosed herein at an amount lower than 0.1 nanomole per kg of body weight will not be therapeutically effective. The inventors also believe that administering a V2R antagonist peptide as disclosed herein at an amount higher than 300 nanomoles per kg of body weight may cause undesirable effects, and possibly some toxic effects, to occur in the subject.

[0138] Indeed, the exact molecular weight (Mw) of each of the V2R antagonist peptide as disclosed is always determinable.

[0139] Assuming a V2R antagonist peptide according to the present disclosure having a Mw of 6500, administering 0.1 nanomole/kg thereof to a subject weighing 80 kg consists of administering 52 ng of the said peptide to the said subject. Still assuming a V2R antagonist peptide according to the present disclosure having a Mw of 6500, administering 300 nanomole/kg thereof to a subject weighing 80 kg consists of administering 0.156 mg of the said peptide to the said subject.

[0140] For the sake of clarity, in some embodiments wherein a selected active ingredient comprises a V2R antagonist peptide according to the present disclosure, the amount of active ingredient to administer to a subject in need thereof is calculated on the basis of the Mw value of the V2R antagonist peptide comprised therein, and not on the basis of the Mw value of the active ingredient per se. Illustratively, in some embodiments wherein a selected active ingredient is a compound of formula (I) as disclosed herein, the amount of active ingredient to administer to a subject in need thereof is calculated on the basis of the Mw value of the [V2R-AP] moiety comprised therein, and not on the basis of the Mw value of the active ingredient per se.

[0141] As used herein, an amount of a selected V2R antagonist peptide of 0.1 nmole/kg or more encompasses amounts of 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or 20 nmoles/kg or more of the said selected V2R antagonist peptides.

[0142] As used herein, an amount of a selected V2R antagonist peptide of 300 nmoles/kg or less encompasses amounts of 290, 280, 270, 260, 250, 240, 230, 220, 210, 200, 150 nmoles/kg or less of the said selected V2R antagonist peptides.

Medical Uses

[0143] The present disclosure pertains to the use of a V2R antagonist peptide described herein, or a selected compound of formula (I) described herein, for preparing a medicament. It also concerns a V2R antagonist peptide described herein, or a selected compound of formula (I) described herein, for use as a medicament.

[0144] The present disclosure also relates to a method for treating a subject affected with a pathological condition involving the V2R pathway comprising a step of administering a V2R antagonist peptide described herein, or a selected compound of formula (I) described herein, or a nucleic acid or a recombinant vector encoding the same, to the said subject.

[0145] This disclosure also pertains to the use of a V2R antagonist peptide described herein, or a selected compound of formula (I) described herein, or a nucleic acid or a recombinant vector encoding the same, for preparing a medicament for treating a subject affected with a pathological condition involving the V2R pathway.

[0146] This disclosure further concerns a V2R antagonist peptide described herein, or a selected compound of formula (I) described herein, or a nucleic acid or a recombinant vector encoding the same, for its use for treating a subject affected with a pathological condition involving the V2R pathway.

[0147] In some embodiments, the active ingredient, i.e. a V2R antagonist peptide as described herein or a selected compound of formula (I), may be administered as a single bolus, as several divided doses administered over time, or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It may be particularly advantageous to formulate a therapeutic agent in a dosage unit form for ease of administration and uniformity of dosage. Dosage unit form, as used herein, refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated, each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the present disclosure may be dictated by and directly dependent on (a) the unique characteristics of the active ingredient and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active ingredient for the treatment of sensitivity in individuals.

[0148] Thus, the skilled artisan would appreciate, based upon the disclosure provided herein, that the dose and dosing regimen is adjusted in accordance with methods well known in the therapeutic arts. That is, the maximum tolerable dose may be readily established, and the effective amount providing a detectable therapeutic benefit to a subject may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the subject.

[0149] Determining appropriate dosages and regimens for administration of the chemotherapeutic agent are well-known in the relevant art and would be understood to be encompassed by the skilled artisan once provided the teachings disclosed herein.

[0150] Pathologies involving the V2R pathway include, with no limitations: (i) pathological conditions characterized by euvolemic or hypovolemic hyponatremia, such as congestive heart failure (CHF), cirrhosis, Syndrome of Inappropriate Antidiuretic Hormone secretion (SIADH) and cerebral oedema, (ii) Nephrogenic Syndrome of Inappropriate Antidiuresis (NSIAD), (iii) Congenital Nephrogenic Diabetes Insipidus (cNDI), (iv) Polycystic kidney disease, (v) cancers, including renal and lung cancers, (vi) thrombosis, (vii) Meniere disease, (viii) refractory liver disease and (ix) heart failure.

Diagnostic

[0151] According to further aspects, this disclosure relates to the use of a V2R antagonist peptide, or alternatively of a selected compound of formula (I), as a diagnostic or imaging reagent that can be applied in optical imaging, magnetic resonance imaging (MRI) and positron emission tomography (PET) for detecting V2R cell expression under physiological or pathological conditions or in response to an endogenous or exogenous stimulus, for diagnostic or research purposes. It may also be used as a drug screening tool, for screening V2R ligands, including V2R agonists and antagonists.

[0152] In a preferred embodiment, the V2R antagonist peptide is labeled by coupling to a detectable molecule.

[0153] Then, the present disclosure further relates to a labeled V2R antagonist peptide as described herein.

[0154] Conventional detectable molecules (labels) may be used which are capable, alone or in concert with other compositions or compounds, of providing a detectable signal. Suitable detection methods include, e.g., detection of an agent which is tagged, directly or indirectly, with a fluorescent label by immunofluorescence microscopy, including confocal microscopy, or by flow cytometry (FACscan); detection of a radioactively labeled agent by autoradiography; electron microscopy; immunostaining; subcellular fractionation, or the like. In some embodiments, a radioactive element (e.g. a radioactive amino acid) is incorporated directly into a peptide chain; in other embodiments, a fluorescent label may be associated with a peptide via biotin/avidin interaction, association with a fluorescein conjugated peptide, or the like.

[0155] In embodiments of the disclosure, the detection procedure comprises visibly inspecting the labelled agent for a colour change, or inspecting the labelled V2R peptide antagonist for a physical-chemical change. Physical-chemical changes may occur with oxidation reactions or other chemical reactions. They may be detected by eye, using a spectrophotometer, or the like.

[0156] Thus, a useful detectable molecule for labeling a V2R antagonist peptide described herein is preferably a labeling agent which produces a detectable and/or quantifiable signal, in particular a radioactive, magnetic or luminescent (radioluminescent, chemiluminescent, bioluminescent, fluorescent or phosphorescent) agent. The labeled protein may be labeled directly or indirectly, via covalent or non-covalent bonds, using standard conjugation techniques that are well-known to those skilled in the art. Examples of labeling agents include radioactive isotopes such as Technetium-99 (.sup.99Tc), Fluorine-18 (.sup.18F), Tritium (.sup.3H) and Iodine-125 (.sup.125I); luminescent agents such as AlexaFluor, FITC and cyanine 3; paramagnetic contrast agents such as gadolinium compounds, and superparamagnetic contrast agents such as iron oxide nanoparticles.

[0157] For the sake of clarity, a V2R antagonist peptide as disclosed herein that is coupled to a detectable molecule may consist of an embodiment of a compound of formula (I) wherein at least one of [Nt-EXT] or [Ct-EXT] is present (i.e. with at least one of integers m or n which means 1) and comprises, or consists of, the said detectable molecule.

[0158] In some preferred embodiments, in the labeled agent, the V2R antagonist peptide is linked covalently to a radioactive or a fluorescent agent.

[0159] Covalent coupling of the labeling agent, for example a fluorescent or radioactive agent, to the V2R antagonist peptide may be achieved by: (i) incorporating the labeling agent at the N- or C-terminal end of the protein during chemical synthesis of the protein, or (ii) incorporating a reactive group (free cysteine.biotinyl, azido moiety) in a recombinant or synthetic protein, and then using the group to link the labeling agent covalently.

[0160] Preferably, the labeling agent is linked covalently to the N- or C-terminus of the protein as none the N-terminal end nor the C-terminal end of the V2R antagonist peptide is involved in its binding to V2R.

[0161] This disclosure relates to the use of a labeled V2R antagonist peptide described herein for detecting cells expressing V2R, in vitro or in vivo. It also pertains to the use of a labeled V2R antagonist peptide described herein, in vitro or in vivo, for measuring the V2R expression level by cells expressing V2R.

[0162] This disclosure also concerns an in vitro method for detecting a dysregulation of vasopressin-2 receptor cell expression comprising the steps of: [0163] a) providing cells to be tested, [0164] b) bringing the cells provided at step a) with a labeled V2R antagonist peptide according to the present disclosure, [0165] c) measuring the expression level value of vasopressin-2 receptor by the cells provided at the end of step b), [0166] d) comparing the expression level value obtained at step c) with a reference expression level value, [0167] e) determining the occurrence of a dysregulation of vasopressing-2 receptor cell expression.

[0168] In some embodiments, the reference expression level value which is used at step d) consists of the mean V2R expression level value which is expected in cells of a subject which is not affected with a dysregulation of V2R cell expression, i.e. of a subject which is not affected with a disorder or a disease involving the V2R pathway.

[0169] In some other embodiments, the reference expression level value which is used at step d) consists of a V2R expression value which is known, or otherwise determined or determinable, in cells of a subject which is affected with a dysregulation of V2R cell expression, i.e. of a subject which is affected with a disorder or a disease involving the V2R pathway.

[0170] As it is well known in the art, ectopic expression of AVP and its receptors has been reported in numerous cancers (North et al., 1999, Peptides, Vol. 20: 837-842; Sinha et al., 2019, Oncogene, Vol. 30(6): 1231-1245) with a potential anti-proliferative effect for V2R agonists in breast, pancreatic, colorectal and lung cancers (Garona et al., 2015, Int J Oncol, Vol. 46: 2335-2345; Ripoll et al., 2013, Breast Cancer Res Treat, Vol. 142: 9-18; Iannucci et al., 2011, Future Med Chem, Vol. 3: 1987-1993; Garona et al., 2018, Cancer Res Treat, Vol. 51(2): 438-450; Pifano et al., 2017, Front Oncol, 7: 11; Garona et al., 2020, in Vitamins and Hormones, Vol. 113: 259-289) and an anti-proliferative effect for V2R antagonists in human renal carcinomas (Sinha et al., 2019, Oncogene, Vol. 30(6): 1231-1245). In this context, a V2R antagonist peptide according to the present disclosure readily constitutes an interesting probe for imaging cancer cells overexpressing V2R.

[0171] Another subject of the present disclosure relates to the use of a V2R antagonist peptide as described herein in an in vitro diagnosis method.

[0172] Another subject of the present disclosure is also the in vitro or in vivo use of a V2R antagonist peptide described herein, or of a selected compound of formula (I) described herein, for diagnosing a pathology involving an increase or a decrease in V2R expression level.

[0173] A further subject of the present disclosure is the V2R antagonist peptide, or a selected compound of formula (I) described herein for use, in vitro or in vivo, for diagnosing a pathology involving an increase or decrease in V2R expression level

[0174] For some diagnostic applications, the labeled V2R antagonist peptide is used to visualize V2R expression, in vitro or in vivo, in a tissue from a patient, and evaluate its expression level in comparison to the same type of tissue from an healthy individual. V2R overexpression is indicative of a pathological condition such as cancer, whereas V2R underexpression is indicative of a pathological condition such as Congenital Nephrogenic Diabetes Insipidus (cNDI). Once, the diagnostic has been established, it is possible to decide on an effective treatment for the diagnosed patient, including the use of V2R antagonists, for example for treating cancer or cNDI.

[0175] A subject of the present invention is also the use of the V2R antagonist peptide, as a research tool for studying V2R.

[0176] Another subject of the present disclosure is a method for detecting V2R, in vitro or in vivo, comprising the steps of: [0177] a) bringing cells to be analyzed into contact with the labeled V2R antagonist peptide, and [0178] b) detecting the labeled cells.

[0179] The labeling of the cells is in particular fluorescent labeling or magnetic labeling, detectable by any technique known to those skilled in the art (fluorescence microscopy, flow cytometry, magnetic resonance imaging).

[0180] The detection of the V2R receptors, in vivo, in the body of a mammal (cell imaging), in particular in real time, comprises a prior step of administering said labeled V2R antagonist peptide to said mammal (parenteral injection, oral administration).

[0181] Another subject of the present disclosure is the use of a V2R antagonist peptide as disclosed herein for screening V2R ligands.

[0182] A subject of the present disclosure is also a method for screening V2R ligands, comprising: [0183] a) incubating V2R with a test molecule and a labeled V2R antagonist peptide of the present disclosure, and [0184] b) measuring the signal obtained respectively in the presence and in the absence of the test molecule, wherein a lower signal in the presence of the molecule compared to the control without the test molecule indicates that the test molecule is a V2R ligand.

[0185] The agonist, antagonist effect of the identified ligands on V2R are then tested in cells expressing V2R using pharmacological assays which are well-known in the art such as those disclosed in the examples of the present application.

[0186] The present disclosure provides also a kit comprising: (a) a first container that contains one or more of: a V2R antagonist peptide, a nucleic acid or a recombinant vector encoding the same, a modified host cell, pharmaceutical composition, diagnostic or imaging reagent as described herein, in solution or in lyophilized form; (b) optionally, a second container containing a diluent or reconstituting solution for the lyophilized formulation; (c) optionally a third container containing an isolated V2R receptor or host cell capable of expressing V2R in solution or in lyophilized form, and optionally instructions for the use of the solution(s) and/or the reconstitution and/or use of the lyophilized formulation(s).

[0187] The present disclosure is further illustrated by, without in any way being limited to, the examples herein.

EXAMPLES

Example 1: Activity of V2R Antagonist Peptides

A. Materials and Methods

Chemical Synthesis of Peptides.

[0188] Peptide synthesis was performed on a Gyros Protein Technologies, Inc Prelude synthesizer at a 12.5 μmole scale, deprotected, purified and folded as described (Ciolek et al., 2017, Proc Natl Acad Sci USA, Vol. 114: 7154-7159).

[0189] Peptide batches with purities higher than 95% were used all along the experiments. The 6-azidohexanoic was coupled on the resin after the automatic synthesis of the MQ1 and the deprotection of the N-terminal amine function. 2 eq of 6-azidohexanoic was coupled twice for 60 minutes with the coupling agent HCTU (1.9 eq) in the presence of 2 eq of diisopropylethylamine. The 6-Azidohexanoic-MQ1 was cleaved from the resin, purified and oxidized as for the MQ1 V2R peptide antagonist. 10 eq of DFO-DBCO (p-isothiocyanatobenzyldesferrioxamine-diarylbicyclooctyne, dissolved in 200 μl DMF), or of Cy5.5-DBCO (dissolved in 200 μl HEPES buffer) or of AFDye-488-DBCO (dissolved in 200 μl HEPES buffer) were mixed with 0.3 μmol of 6-azidohexanoic-MQ1 dissolved in HEPES buffer (200 μl, pH 7.4) and leaved overnight at room temperature and purified by HPLC.

B. Results

[0190] A variety of MQ1-derived peptides have been tested for their binding affinity to the human vasopressin-2 receptor (V2R).

[0191] The results are summarized in Table 1 hereunder.

TABLE-US-00003 TABLE 1 SEQ Ki,  ID peptides nM ratio sequence NO. WT MQ1 peptide  5, 02  1, 00 RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGNANRFSTIEKCRRTCVG 7 (prior art) V2R antagonist peptides of this disclosure K39A    0.57    0.115 RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCAGNANRFSTIEKCRRTCVG 2 K39A + I148L  0, 93  0, 19 RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCAGNANRFSTLEKCRRTCVG 3 N15A + K39A + I148L  2, 05  0, 41 RPSFCNLPVKPGPCAGFFSAFYYSQKTNKCHSFTYGGCAGNANRFSTLEKCRRTCVG 4 F4G K39A T27D    0.74    0.15 RPSGCNLPVKPGPCNGFFSAFYYSQKDNKCHSFTYGGCAGNANRFSTIEKCRRTCVG 5 MQ-LEAD    0.66    0.13 RPSGCNLPVKPGPCNGFFSAFYYSQKDNKCHSFTYGGCAGNANRFSTEEKCRRTCVG 6 F4G + K39A + T27D + I48E  Comparative peptides K10A  9, 38  1, 87 RPSFCNLPVAPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGNANRFSTLEKCRRTCVG 8 K10E  337   67 RPSFCNLPVEPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGNANRFSTLEKCRRTCVG 9 F17A 6684 1331 RPSFCNLPVKPGPCNGAFSAFYYSQKTNKCHSFTYGGCKGNANRFSTLEKCRRTCVG 10 F18A  152   30 RPSFCNLPVKPGPCNGFASAFYYSQKTNKCHSFTYGGCKGNANRFSTLEKCRRTCVG 11 N41A  8, 49  1, 69 RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGAANRFSTIEKCRRTCVG 12 R44A 13, 3  2, 6 RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGNANAFSTLEKCRRTCVG 13 R44E 99, 3 19, 8 RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGNANEFSTLEKCRRTCVG 14

[0192] In case of a discrepancy between the sequences disclosed in Table 1 and those described in a sequence listing, the correct sequences are those listed in Table 1.

[0193] The results depicted in Table 1 show that the most efficient peptides tested, which present a IC.sub.50 ratio value of 0.5 or less, as compared to the known MQ1 V2R antagonist peptide, are all peptides wherein the lysine residue located at the amino acid position 39 in the known MQ 1 V2R antagonist peptide is replaced by an alanine residue (amino acid change conventionally denoted “K39A”). The most effective V2R antagonist peptides are the following: [0194] “K39A” peptide of the amino acid sequence of SEQ ID NO. 2, [0195] “K39A+I48L” peptide of the amino acid sequence of SEQ ID NO. 3, [0196] “N15A+K39A+I48L” peptide of the amino acid sequence of SEQ ID NO. 4, [0197] “F4G+K39A+T27D” peptide of the amino acid sequence of SEQ ID NO. 5. [0198] “F4G+K39A+T27D I48E” peptide, also termed “MQ-LEAD” herein, of the amino acid sequence of SEQ ID NO. 6, and

Example 2: Immunogenicity and Selectivity of V2R Antagonist Peptides

A. Materials and Methods

A.1. Immunogenicity

[0199] The immunogenicity of therapeutic proteins remains a major risk of failure for their development and is therefore a very important concern for the pharmaceutical industry. Immunogenicity is the ability of molecules to induce an immune response. The antibodies (Anti Drug Antibody or ADA) resulting from this response can inhibit the therapeutic activity of the proteins or even induce allergic symptoms. As immune responses are species-dependent, animals such as mice and rats are very poor predictive models of immunogenicity and do not allow the immunogenicity of molecules to be evaluated when injected into humans. The pre-clinical evaluation of immunogenicity is based on the mechanisms regulating the immune response in humans.

[0200] ADA responses against therapeutic proteins primarily involve three different cell types i) B cells that produce antibodies, ii) CD4 T cells that provide the necessary assistance to B cells to secrete the antibodies, and iii) dendritic cells that, by presenting the proteins as peptides to the T cells, cause their activation. When a protein is injected into the body, the protein is taken up by the dendritic cells and is broken down into peptides. Some of the peptides generated have appropriate anchor residues to bind to HLA class II molecules and are presented to T cells.

[0201] Peptides recognized by T cells are called T epitopes. Because HLA class II molecules are polymorphic, T epitopes vary from molecule to molecule and therefore vary between individuals based on their HLA class II molecules.

[0202] Given the role of T lymphocytes in the ADA response, the immunogenicity of therapeutic proteins is highly dependent on their ability to activate T lymphocytes and thus to contain T epitopes in their sequence. An evaluation of the T epitope content can be done using predictive software, the most efficient of which is NETMHC. The presence of potential T epitopes in U-Da2a and MQ-LEAD were tested by NETMHC software.

A.2. Selectivity

[0203] The protease assay general protocol is the following:

1 Deliver 2× Enzyme

[0204] 2 Deliver buffer into No Enzyme wells
3 Deliver MQ-WT (U-Da2a) in water by using Acoustic technology (Echo550; nanoliter range)

4 Incubate for 5-15 min

[0205] 5 Deliver 2× Substrate to initiate the reaction
6 Spin & shake, start measuring in EnVision at room temp; 5 min interval for 25 (2 hours)
7 Analyze data by taking slope*(signal/time) of linear portion of measurement
8 Slope is calculated by using Excel, and curve fits are performed using Prism software

[0206] The specific specifications are disclosed in Table 2, at the end of the present disclosure

Buffer:

A 25 mM Tris pH 8.0, 100 mM NaCl, 0.01% Brij35,

B′ 25 mM MES pH 6, 50 mM NaCl, 0.005% Brij35, 5 mM DTT

B 75 mM Tris pH 7.0, 0.005% Brij35, 3 mM DTT

B+EDTA 75 mM Tris pH 7.0, 1 mM EDTA, 0.005% Brij35, 3 mM DTT

C 100 mM Tris-HCl, pH 8.0, 50 mM NaCl, 10 mM CaCl2, 0.025% CHAPS, 1.5 mM DTT

D 25 mM Sodium Acetate pH 5.5, 0.1 M NaCl, 5 mM DTT

E 25 mM Sodium Acetate pH 3.5, 5 mM DTT

F 25 mM Tris pH 9,150 mM NaCl

L 400 mM NaAcetate pH 5.5, 4 mM EDTA, 8 mM DTT

X (Furin) 100 mM Tris-HCl, pH 7.5, 1 mM CaCl2, 0.5% TX-100, 1 mM DTT

S 0.1 M Sodium Acetate pH 3.5, 0.1 M NaCl

TCN 25 mM Tris pH 7.5, 10 mM CaCl2, 150 mM NaCl

TCNB 25 mM Tris pH 7.5, 10 mM CaCl2, 150 mM NaCl, 0.05% Brij35

Z 25 mM Tris pH 9, 2.5 uM ZnCl2, 0.005% Brij

[0207] KLK 7 buffer 50 mM Tris, 150 mM NaCl, pH 8.5

ACE2 Buffer 75 mM Tris, pH 8.5, 1 M NaCl

Neprilysin Buffer 50 mM Tris, pH 9.0

[0208] CTSD buffer 100 mM Sodium Acetate pH 3.5, 200 mM NaCl, 0.02% Brij35
CTSE buffer 100 mM Sodium Acetate pH3.5, 500 mM NaCl, 0.005% Triton X-100
Elastase buffer 50 mM Tris, pH 7.5, 1 M NaCl, 0.05% Brij35
1× Caspase buffer 1 50 mM HEPES pH7.4, 100 mM NaCl, 0.01% CHAPS, 0.1 mM EDTA, 10 mM DTT
1× Caspase buffer 2 50 mM HEPES pH7.4, 1 M Na Citrate, 100 mM NaCl, 0.01% CHAPS, 0.1 mM EDTA, 10 mM DTT
MMP Buffer: 50 mM HEPES (pH7.5), 10 mM CaCl2, 0.01% Brij-35, Store at 4° C. add 0.1 mg/ml BSA in buffer before use.

B. Results

B.1. Immunogenicity

[0209] Expected immunogenicity of the known MQ1 peptide of SEQ ID NO. 7 and of the MQ LEAD peptide of SEQ ID NO. 6 has been calculated.

[0210] The comparative results are depicted in FIG. 1.

[0211] As it is shown in FIG. 1, the immunogenic regions that are present in the known MQ1 peptide are no more apparent in the MQ LEAD V2R antagonist peptide.

[0212] While on MQ1 (U-Da2a), 15 potential epitopes were identified, including 6 epitopes with high scores (percentile below 10%), only 3 potential T epitopes were identified in the sequence of MQ-LEAD. These 3 potential T epitopes also have low scores (percentiles between 20 and 30%).

[0213] Then, the MQ-LEAD peptide will present a much lower risk of immunogenicity than the known MQ1 peptide.

B.2. Selectivity

[0214] Selectivity of the known MQ1 peptide for the vasopressin-2 receptor has been tested by assaying for its binding to a high number of molecules.

[0215] The results are depicted in Table 3 at the end of the present disclosure.

[0216] The results of Table 3 illustrate the selectivity of the MQ 1 peptide for the vasopressin-2 receptor.

Example 3: Pharmacology of the V2R Antagonist Peptides

A. Materials and Methods—V2R Binding Assay

[0217] Membranes from cells expressing vasopressin receptors were purchased from PERKINELMER (Courtaboeuf, France). Binding experiments were performed with .sup.3H-AVP (PERKINELMER, Courtaboeuf, France) in 96-well plates. Reaction mixtures contained 50 mM Tris-HCl, pH 7.4, 10 mM MgCl.sub.2 and 1 g/L BSA in a final volume of 100 μL. Plates were incubated for 3 h at room temperature. Binding reactions were stopped by filtration through a GF/C filter pre-soaked in 0.5% polyethyleneimine on a cell harvester (PERKINELMER, Courtaboeuf, France) and plates were dried. Ultimagold O (25 μl; PERKINELMER) was added to each well and samples were counted using a TopCount counter (PERKINELMER, Courtaboeuf, France) (Counting yield of 55%). Non-specific binding was measured in the presence of 1 μM AVP. A one-site inhibition mass action curve was fitted to inhibition binding data using Kaleidagraph (SYNERGY SOFTWARE, Reading, Pa., USA). IC.sub.50 values were converted to Ki for competition experiments using the Cheng-Prusoff equation (Cheng et al., Biochem. Pharmacol., 1973, 22, 3099-3108).

B. Results

Binding of a V2R Antagonist Peptide According to the Disclosure to V2R

[0218] The results are depicted in FIG. 2.

[0219] The results of FIG. 2 show that the MQ-LEAD peptide according to this disclosure has a five times increase in affinity for the vasopressin-2 receptor, as compared to the known MQ1 (U-Da2a) peptide. Even better results are obtained with the V2R antagonist peptide MQ K39A.

[0220] These results show that the V2R antagonist peptides MQ-LEAD and MQ K39A behave as a strong V2R antagonist peptides.

Example 4: In Vivo Activity of V2R Antagonists According to the Disclosure

A. Materials and Methods

A.1. In Vivo Assay of Diuresis

[0221] Sprague Dawley rats of ages between 6 and 12 weeks were acclimated in metabolic cages (Techniplast France, Lyon, France) for two days, with food and water ad libidum, before being i.p. injected (fixed volume of 1 ml) with various MQs at 3 nmol/kg dissolved in 0.9% NaCl, (French agreement number 2015082111349702v1). Urines were collected at various times, centrifuged for 30 min at 20,800 g. Urine osmolality was determined with an osmometer (Knauer, Berlin, Germany).

A.2. In Vivo Assay on an Experimental Model of Hyponatremia

[0222] Rat model of hyponatremia. Specific pathogen free adult male Sprague-Dawley rats (body weight between 445 and 525 grams) were obtained from Janvier laboratories (Le Genest St. Isle, 53941, Saint Berthevin Cedex, France) and acclimatized to the animal house conditions for 1 week. We established an experimental protocol derived from a previous paper (Miyazaki T, Yamamura Y, Onogawa T, Nakamura S, Kinoshita S, Nakayama S, et al. Therapeutic effects of tolvaptan, a potent, selective nonpeptide vasopressin V2 receptor antagonist, in rats with acute and chronic severe hyponatremia. Endocrinology. 2005; 146: 3037-43.) to develop a rat hyponatremia model, approved by the French Ministry of Education and Research (n° 18604-2019010915104191). A stock solution of desmopressin (dDAVP) at 2.2 mg/mL was prepared by dissolving 5 mg of drug into physiological saline. dDAVP was administered using subcutaneous ALZET osmotic mini-pumps (model 2002, DURECT Corporation, Cupertino, Calif. 95014, USA) previously filled with a solution of dDAVP (pumping rate of 0.47±0.02 μL/hour and mean fill volume of 233.6±4.7 μL). The dose of dDAVP (10 ng/hour) was determined in preliminary experiments. Buprenorphine (Centravet, 03120 Lapalisse, France) was administered once a day at a dose of 0.02 mg/kg, s.c. from day 0 to day 3 in order to suppress post-operative pain. Water gavage (30 mL/kg) was performed 2 times per day (at 9 am and 4 pm) in the first 3 days following ALZET pump implantation, and at 9 am at day 4. Body weight was taken every day in order to adjust for the volume of water to be administered. Rats had free access to standard rat chow, as well as water in their cages. MQ1, dissolved in physiological saline, was administered at 10 am on days 2-3-4 at 10 or 100 μg/kg (s.c. route, 0.8 mL/kg). On days 0, 2, 3 and 4, at 9 am, 400 μL of blood was collected from isoflurane-anesthetized rats from the tail vein with lithium heparinate (Sanofi-Aventis, Gentilly, France). Samples were centrifugated (4° C., 2000 g, 5 min). Sodium quantifications were performed by the Central laboratory of the ENVT, Toulouse, France, on VITROS 250/350/950/ 5,1 FS, 4600 and integrated system VITROS 5600 (Ortho-Clinical Diagnostics, Buckinghamshire, United Kingdom). P<0.05, ANOVA multiple factors followed by Tukey's test).

B. Results

B.1. Effects of Two V2R Antagonist Peptides According to the Disclosure on Diuresis

[0223] The results are depicted in FIG. 3 (FIGS. 3A and 3B). The results of FIG. 3 show that the MQ-LEAD and the MQ K39A peptides of this disclosure both increase diuresis.

B.2. Effects of V2R Antagonist Peptides According to the Disclosure on Hyponatremia.

[0224] The aim of the present study was to test the effect of a peptide derived from mambaquaretine (MQ-LEAD) a potent and selective antagonist of the V2 receptors, on DDAVP-induced hyponatremia in normal adult male rats of CD strain (Sprague Dawley).

[0225] The MQ-LEAD peptide has been validated on a rat model of hyponatremia. The schedule of the in vivo assay is depicted in FIG. 4.

[0226] The results are depicted in FIG. 5.

[0227] The results depicted I FIG. 5 showed that at D4 the effect of tolvaptan (10 mg/kg, oral route) was significantly different from values on the vehicle-treated group. The mean value for sodium in tolvaptan-treated group (137.6±3.3 mM). At D4 the plasmatic sodium concentrations of the 3 doses of MQ-LEAD (20, 60 and 200 μg/kg, s.c.) were significantly higher than the corresponding value on the vehicle-treated group. A direct comparison with the dose of tolvaptan (10 mg/kg, p.o.) suggests that MQ-LEAD could be 500 times more potent than tolvaptan. The sodium values following MQ-LEAD at 20 and 60 μg/kg on D3 and D4, although increased, were not statistically different with respect to basal values (DO)

Example 5: Inhibition of cAMP Production by V2R Antagonist Peptides of the Closure

A. Materials and Methods

[0228] A.1. The antagonist effects of MQ-WT, MQ-18 (K39A) and MQ-232 (MQ-LEAD) in the U2OS AVPR2A Nomad cell line stably expressing human Arginine Vasopressin were examined.

[0229] U2OS AVPR2 Nomad cell line contains U2OS cells stably expressing human Arginine Vasopressin Receptor 2A (AVPR2A) with no tag. This cell line has been designed to assay compounds or analyze their capability to modulate Arginine Vasopressin Receptor 2A (AVPR2A). When the agonist binds to AVPR2 a Gs protein is activated, which in turn, triggers a cellular response mediated by cAMP. This cellular response can be measured quantifying the increase in fluorescence intensity and its cellular distribution.

[0230] A.2. Receptor 2A (V2R). The test items were assayed at eight concentrations (in triplicate, from 1 μM to 1 nM) using 1 nM of human Arg8-Vasopressin as agonist, using a fluorescence-based assay. [0231] Day 1. The Nomad AVPR2 U2OS cell line was thawed (2×106 cells per T25). [0232] Day 2. The cells were maintained in DMEM-F12 supplemented with 10% FBS at 37° C. in a humidified 5% CO2 atmosphere. [0233] Day 3. The cells were plated at a concentration of 20.000 cells/well (+/−2000 cells) in 96-well plates. Cells were maintained in DMEM-F12 medium supplemented with 10% FBS during 24 h at 37° C. in a humidified 5% CO2 atmosphere. [0234] Day 4. The cells were incubated with different concentration of test compounds (1000, 333.33, 111.11, 37.04, 12.37, 4.12, 1.37 and 0.46 nM) and 1 nM of Arg8-Vasopressin dissolved in Opti-MEM for 24 hours. Opti-MEM with vehicle (water) was added to the unstimulated control cells, 1 nM of Arg8-Vasopressin to positive control cells and 1 nM of Arg8-Vasopressin with 100 nM Conivaptan to antagonism control. The experiments have been performed at least in triplicate. [0235] Day 5. The activation of the Nomad biosensor was quantified after the formaldehyde fixation (3.7 wt. %, 20 minutes) of the cells. The nuclei were stained using DAPI (2 μg/ml) and the fluorescence was measured using a Cell Insight High-Content Bioimager from Thermofisher. To detect the DAPI, the filters used were 380/10 and 460/10 nm for excitation and emission, respectively and to detect the Nomad biosensor, the filters were 548/20 and 645/75 nm, respectively. The images were obtained with an objective of 20×, taking 9 pictures of each well. Cell quantification was performed delimitating the region of interest of the nuclei (stained with DAPI) and after quantification, the average of each triplicate was performed. Granule quantification was also performed using the Thermofisher Cellomics Scan Viewer 6.1.1. Spot detector application from Cell Software delimitated 2 regions of interest, the nuclei and cytosol. This software application quantified the number of granules per nuclei and the average of granule number per cytosol of each well was calculated. After that, the average of the triplicates was performed. Both Excel 2003 and Sigmaplot 9.0 were used for data management

B. Results

[0236] As it is shown in FIG. 5, V2R antagonist peptides of the present disclosures, namely the K39A peptide and the MQ-LEAD peptide, are more potent inhibitors of cAMP production, when compared to the parent MQ1 peptide (MQ-WT peptide). The V2R antagonist peptides inhibit in a dose-dependent manner the cAMP production under conditions of activation with Arg 8 Vasopressin.

[0237] The cAMP production inhibition properties of V2R antagonist peptides of the disclosure are further illustrated in Table 3 below.

TABLE-US-00004 TABLE 3 Inhibition of cAMP production IC50, nM Kinac* nM MQ1 (“MQ-WT”) 192 81 U-Da2a K39A 46.1 23 MQ LEAD 9.27 4.6 *Kinac: Inactivation constant: measure of the ability of the tested peptide to prevent the receptor activation, i.e. to prevent Arg8 Vasopressin to activate cAMP production.

TABLE-US-00005 TABLE 2 Specific specifications for the 65 enzymes Sub in Enzyme Enzyme Co-Factor, RXN Control Protease Class Source Substrate Ex/Em comment etc. (uM) Inhibitor  1 ACE1 peptidyl- Human MCA- 320/405 Buffer A 10 Captopril dipeptidase recombinant RPPGFSAFK(Dnp)- aa30-1261 OH  2 ACE2 peptidyl- Human MCA- 320/405 ACE2 Buffer 10 ACE2 Inhibitor dipeptidase recombinant YVADAPK(Dnp)- aa18-740 OH  3 ADAM-10 metalloproteinase Human MCA-PLAQAV-Dpa- 320/405 Buffer Z 10 GM6001 recombinant RSSSR-NH2 aa18-672  4 BACE 1 Aspartyl Human MCA- 320/405 0.1M Sodium 10 B-Secretase Peptidase recombinant SEVNLDAEFRK(Dnp)- Acetate, pH 4.0 inhibitor IV aa22-460 (pro) RR-NH2 & aa46-460 (mature), both C-terminal 10- His tag  5 Calpain 1 Ca-Cysteine Human N-Succinyl-Leu-Tyr- 355/460 Buffer B+ 0.5 10 E64 Proteinase Erythrocytes AMC mM CaC12  6 Caspase 1 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa120-404  7 Caspase 2 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa150-435  8 Caspase 3 Cysteine Human Ac-DEVD-AMC 355/460 Caspase buffer 1  5 DEVD-CHO Protease recombinant  9 Caspase 4 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa105-377 10 Caspase 5 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa122-418 11 Caspase 6 Cysteine Human Ac-DEVD-AMC 355/460 Caspase buffer 1  5 DEVD-CHO Protease recombinant aa24-293 12 Caspase 7 Cysteine Human Ac-DEVD-AMC 355/460 Caspase buffer 1  5 DEVD-CHO Protease recombinant aa24-303 13 Caspase 8 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa217-479 14 Caspase 9 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa131-416 15 Caspase 10 Cysteine Human Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa220-479 16 Caspase 11 Cysteine Mouse Ac-LEHD-AMC 355/460 Caspase buffer 2  5 IETD-CHO Protease recombinant aa102-373 17 Caspase 14 Cysteine Human Ac-WEHD-AMC 355/460 Caspase Buffer 2  5 WEHD-CHO Protease recombinant 2-242aa 18 Cathepsin B Cysteine Human liver Z-FR-AMC 355/460 Buffer B′ 10 E64 Protease 19 Cathepsin C Cysteine Human H-GR-AMC 355/460 Activate 100 10 E64 Protease recombinant ug/ml with 20 aa25-463 ug/ml Cathepsin L in 25 mM MES pH 6, 5 mM DTT, 1 h at room temp. Buffer B′ 20 Cathepsin D Aspartyl Human MCA-PLGL-Dap 320/405 AutoActivate 30  2 Pepstatin A Protease recombinant (Dnp)-AR-NH2 min at 37oC. aa21-412 CTSD buffer 21 Cathepsin E Aspartyl Human MCA-PLGL-Dap 320/405 AutoActivate 30 1,5 Pepstatin A Protease recombinant (Dnp)-AR-NH2 min at Room aa18-396 temp. CTSE buffer 22 Cathepsin G Serin Protease Human Suc-AAPF-AMC 355/460 Buffer C 10 Chymostatin neutrophil 23 Cathepsin H Cysteine Human liver R-AMC 355/460 Buffer B + EDTA 10 E64 Protease 24 Cathepsin L Cysteine Human liver Z-FR-AMC 355/460 Buffer L 10 E64 Protease 25 Cathepsin S Cysteine Human Z-FR-AMC 355/460 Buffer B + EDTA 10 E64 Protease recombinant FL 26 Cathepsin V Cysteine Protease Human Z-FR-AMC 355/460 Buffer D 10 E64 recombinant aa18-334 27 Chymase Serin Protease Human skin Suc-AAPF-AMC 355/460 Buffer C 10 Chymostatin 28 Chymotrypsin Serin Protease Bovine Suc-AAPF-AMC 355/460 Buffer C 10 Chymostatin pancreas 29 DPP IV peptidyl- Human H-GP-AMC 355/460 MMP Buffer 10 P32/98 dipeptidase recombinant aa29-766 30 DPP-VIII peptidyl- Human H-GP-AMC 355/460 MMP Buffer 10 P32/98 dipeptidase recombinant 31 DPP-IX peptidyl- Human H-GP-AMC 355/460 MMP Buffer 10 P32/98 dipeptidase recombinant 32 Elastase Serin Protease Human MeOSuc-AAPV-AMC 355/460 Elastase Buffer 10 Sivelestat Neutrophil 33 Factor VIIa Serin Protease Human plasma Z-VVR-AMC 355/460 Buffer A 10 PCI 27483 34 Factor Xa Serin Protease Human plasma CH.sub.3SO.sub.2-D-CHA-Gly- 355/460 Buffer A + 10 Gabexate Arg-AMC-AcOH 0.25 mg/ml BSA mesylate (GM) 35 Factor XIa Serin Protease Human plasma (Boc-Glu(OBzl)-Ala- 355/460 Buffer A 10 Gabexate Arg)-MCA mesylate (GM) 36 HIV Aspartyl Recombinant Anaspec SensoLyte 340/490 From kit Pepstatin A Protease (Catalogue: 71127) 37 Kallikrein 1 Serin Protease Human Z-VVR-AMC 355/460 Activated by 10 Leupeptin recombinant Thermolysin, aa25-262 Buffer A 38 Kallikrein 5 Serin Protease Human Z-VVR-AMC 355/460 Buffer A 10 Gabexate recombinant mesylate (GM) aa67-293 39 Kallikrein 7 Serin Protease Human MCA-RPKPVE-Nval- 320/405 Activate 0.1 10 Gabexate recombinant WRK(Dnp)-NH2 mg/ml with 10 mesylate (GM) aa23-252 ug/ml Thermolysin in TCNB for 1 h 37oC, 50 mM EDTA to stop. KLK 7 buffer 40 Kallikrein 12 Serin Protease Human BOC-VPR-AMC 380/460 Auto Activate 100 10 Gabexate recombinant ug/ml in 0.1M mesylate (GM) aa18-248 Tris pH 8, CNB 16 h at 37oC. TCNB 41 Kallikrein 13 Serin Protease Human BOC-VPR-AMC 380/460 Activate 100 10 Gabexate recombinant ug/ml with 0.02 mesylate (GM) aa1-262 ug/ml Lysyl Endopeptidase in 0.1M Tris pH 8, 30 min at 37oC. Buffer A 42 Kallikrein 14 Serin Protease Human BOC-VPR-AMC 380/460 Activate 0.1 10 Gabexate recombinant mg/ml with 10 mesylate (GM) aa19-248 ug/ml Thermolysin in TCNB for 1 h 37oC, 50 mM EDTA to stop. Buffer A 43 Matriptase-2 Serin Protease Human Boc--Gln-Ala-Arg- 355/460 100 mM 10 Gabexate recombinant AMC TRIS, pH mesylate (GM) aa78-811 9.0, 0.5 mg/ml BSA 44 MMP1 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide [QXL520-g-Abu- aa81-249 P-Cha-Abu-Smc-H-A- Dab(5-FAM)-A-K-NH2] 45 MMP2 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa81-423 46 MMP3 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa83-255 47 MMP7 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa78-250 48 MMP8 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa79-249 49 MMP9 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa88-438 50 MMP10 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa82-254 51 MMP12 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa84-255 52 MMP13 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa85-255 53 MMP14 metalloproteinase Human (5-FAM/QXLTM) FRET 485/520 MMP Buffer  5 GM6001 recombinant peptide aa92-278 54 Neprilysin metalloproteinase Human MCA- 340/405 50 mM Tris, pH 10 Phosphoramidon recombinant RPPGFSAFK(Dnp)-OH 9.0 aa53-750 55 Papain Cysteine Protease Papaya Latex Z-FR-AMC 355/460 B + 1 10 E64 mM EDTA, Preincubate 56 Plasma Serin Protease Human Z-FR-AMC 380/460 Activate 0.1 10 Gabexate Kallikrein recombinant mg/ml with 10 mesylate (GM) aa20-638 ug/ml Thermolysin in TCN for 30 min 37oC, 10 mM EDTA to stop. Buffer A 57 Plasmin Serin Protease Human plasma H-D-CHA -Ala-Arg- 355/460 Buffer A 10 Gabexate AMC.2AcOH mesylate (GM) 58 Proteinase A Serin Protease Bacillus Z-GPR-AMC 355/460 Buffer A 10 Leupeptin Iicheniformis 59 Proteinase K Serin Protease Tritirachium H-D-CHA -Ala-Arg- 355/460 Buffer A 10 Proteinase K album limber AMC.2AcOH inhibitor 60 TACE metalloproteinase Human MCA-PLAQAV-Dpa- 320/405 Buffer Z 10 GM6001 recombinant RSSSR-NH2 aa215-671 61 Thrombin Serin Protease Human plasma H-D-CHA -Ala-Arg- 355/460 Buffer A + 2.5 10 Gabexate alpha AMC.2AcOH mM CaCl2 + 1 mesylate (GM) mg/ml BSA 62 Trypsin Serin Protease Bovine H-D-CHA -Ala-Arg- 355/460 Buffer A 10 Gabexate pancreas AMC.2AcOH mesylate (GM) 63 Tryptase Serin Protease Human Z-GPR-AMC 355/460 Unstable w/o 2M 10 Gabexate beta 2 recombinant NaCl, dilute mesylate (GM) immediately before. Buffer A 64 Tryptase Serin Protease Human lung Z-GPR-AMC, 355/460 Buffer A 10 Gabexate gamma 1 mesylate (GM) 65 Urokinase Serin Protease Human urine Bz-b-Ala-Gly-Arg- 355/460 Buffer A 10 Gabexate AMC.AcOH mesylate (GM)

TABLE-US-00006 TABLE 3 Compound IC50 (M) Control Compound Target: U-Da2A IC50 (M) Control compound ID 1 Caspase 1 3.71E−05 8.93E−08 IETD-CHO 2 Caspase 2 4.25E−05 6.46E−07 IETD-CHO 3 Caspase 3 2.35E−09 DEVD-CHO 4 Caspase 4 2.18E−06 IETD-CHO 5 Caspase 5 >5.00E−05  3.83E−08 IETD-CHO 6 Caspase 6 >5.00E−05  2.65E−08 DEVD-CHO 7 Caspase 7 5.11E−09 DEVD-CHO 8 Caspase 8 2.52E−09 IETD-CHO 9 Caspase 9 8.94E−06 5.15E−08 IETD-CHO 10 Caspase 10 9.33E−06 2.83E−08 IETD-CHO 11 Caspase 11 1.40E−05 9.34E−07 IETD-CHO 12 Cathepsin B 5.10E−09 E64 13 Cathepsin C 4.59E−05 5.90E−07 E64 14 Cathepsin G 8.54E−06 2.36E−07 Chymostatin 15 Cathepsin H 6.71E−08 E64 16 Cathepsin L 1.96E−09 E64 17 Cathepsin S 5.43E−09 E64 18 Cathepsin V 1.97E−08 E64 19 Chymase 1.82E−05 1.99E−08 Chymostatin 20 Chymotrypsin 2.74E−06 3.21E−10 Chymostatin 21 Elastase >5.00E−05  2.16E−07 Gabexate mesylate (GM) 22 FVIIa Gabexate mesylate (GM) 23 FXa 4.47E−06 Gabexate mesylate (GM) 24 FXIa 2.34E−07 Gabexate mesylate (GM) 25 Kallikrein 1 2.96E−07 Leupeptin 26 Kallikrein 5 5.77E−06 6.97E−07 Gabexate mesylate (GM) 27 Kallikrein 7 3.65E−06 4.65E−05 Gabexate mesylate (GM) 28 Kallikrein 12 6.54E−08 Gabexate mesylate (GM) 29 Kallikrein 13 1.18E−05 Gabexate mesylate (GM) 30 Kallikrein 14 6.72E−07 Gabexate mesylate (GM) 31 Matriptase 2 1.16E−07 3.15E−07 Gabexate mesylate (GM) 32 Papain 1.76E−05 1.18E−10 E64 33 Plasma Kallikrein 3.89E−06 3.03E−08 Gabexate mesylate (GM) 34 Plasmin 3.44E−07 Gabexate mesylate (GM) 35 Proteinase A 3.15E−05 Leupeptin 36 Proteinase K 2.92E−08 Proteinase K inhibitor 37 Thrombin A 3.16E−06 Gabexate mesylate (GM) 38 Trypsin 3.69E−06 1.12E−08 Gabexate mesylate (GM) 39 Tryptase b2 3.63E−06 1.98E−08 Gabexate mesylate (GM) 40 Tryptase g1 >5.00E−05  1.01E−08 Gabexate mesylate (GM) 41 Urokinase 6.14E−07 Gabexate mesylate (GM)