Synthetic Multiphase Systems
20200207813 ยท 2020-07-02
Inventors
- CAIT MACPHEE (Mayfield, GB)
- Nicola Stanley-Wall (Dundee, GB)
- KEITH BROMLEY (Mayfield, GB)
- RYAN MORRIS (Mayfield, GB)
- Laura Hobley (Dundee, GB)
Cpc classification
A23V2002/00
HUMAN NECESSITIES
A23V2002/00
HUMAN NECESSITIES
A61K47/42
HUMAN NECESSITIES
A61K8/64
HUMAN NECESSITIES
International classification
A61K47/42
HUMAN NECESSITIES
A61K8/64
HUMAN NECESSITIES
Abstract
A synthetic multiphase product including an isolated biofilm surface layer protein A (BsIA), wherein the BsIA has the amino acid sequence set forth in SEQ ID NO: 28 or a variant thereof that is at least 80% identical to SEQ ID NO: 28.
Claims
1. A synthetic multiphase product comprising an isolated biofilm surface layer protein A (BsIA), wherein the BsIA has the amino acid sequence set forth in SEQ ID NO: 28 or a variant thereof that is at least 80% identical to SEQ ID NO: 28.
2. The synthetic multiphase product of claim 1, wherein the synthetic multiphase product is a multiphase food product.
3. The synthetic multiphase product of claim 1, wherein the synthetic multiphase product is a personal care product.
4. The synthetic multiphase product of claim 1, further comprising at least one co-surfactant.
5. The synthetic multiphase product of claim 1, comprising at least three or more intimately mixed phases of matter.
6. The synthetic multiphase product of claim 1, comprising from 0.005 to 0.2 wt % of BsIA.
7. The synthetic multiphase product of claim 1, wherein the synthetic multiphase product comprises a pharmaceutical active agent.
8. The synthetic multiphase product of claim 1, wherein the BsIA has the amino acid sequence set forth in SEQ ID NO: 28 or a variant thereof that is at least 90% identical to SEQ ID NO: 28.
9. The synthetic multiphase product of claim 1, wherein the BsIA has the amino acid sequence set forth in SEQ ID NO: 28 or a variant thereof that is at least 95% identical to SEQ ID NO: 28.
10. The synthetic multiphase product of claim 4, wherein the at least one co-surfactant is a protein surfactant.
11. A frozen synthetic multiphase product comprising an isolated BsIA, wherein the BsiA has the amino acid sequence set for the in SEQ ID NO: 28 or a variant thereof that is at least 80% identical to SEQ ID NO:1, and wherein the frozen synthetic multiphase product further comprises at least one co-surfactant.
12. The frozen synthetic multiphase product of claim 11, comprising one or more additional components, wherein the one or more additional components comprises one or more of milk proteins, sugars, carbohydrates, egg proteins and fats.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
[0215]
[0216]
[0217]
[0218]
[0219]
[0220]
[0221]
[0222]
[0223]
[0224]
[0225]
[0226]
[0227]
[0228]
[0229]
[0230]
[0231]
[0232]
[0233]
[0234]
[0235]
[0236]
[0237]
[0238]
[0239]
[0240]
[0241]
[0242]
[0243]
[0244]
[0245]
[0246]
[0247]
[0248]
[0249]
[0250]
[0251]
[0252]
SPECIFIC DESCRIPTION OF EMBODIMENTS OF THE INVENTION
[0253] While the making and using of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention.
[0254] To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as a, an and the are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.
Expression of WT-BsIA and BsIA-L77K
[0255] The method of expressing a truncated form of WT-BsIA (SEQ ID NO:2) and the BsIA mutant BsIA-L77K is described in Hobley et al..sup.1 which is incorporated herein by reference. References to WT-BsIA in the examples given below refer to the truncated form of the wild type BsIA minus a signal sequence (also known as BsIA.sub.42-181). References to BsIA-L77K in the examples given below refer to the truncated form of the wild-type BsIA minus a signal sequence and comprising a point mutation (at position 77, numbered relative to the full length BsIA sequence).
[0256] The nucleotide sequences used to encode the various BsIA proteins are given below.
BsIA Reduces the Surface Tension of Water
[0257] Pendant drop tensiometry was performed on aqueous droplets of BsIA to observe the change in interfacial tension over time. In this technique, the shape of a drop is fitted to the Young-Laplace equation to measure the interfacial tension (IFT) at the droplet surface.sup.27, 28, which usually decreases as the interface is populated by surface active species..sup.29 An increase in the error of the fit to the Young-Laplace equation indicates that a viscoelastic film has formed at the interface, and since a solid layer now separates the two liquid phases the concept of interfacial tension no longer applies.
[0258] WT-BsIA does not deform sessile drops at 0.01, 0.03 and 0.1 mg.Math.mL.sup.1 after thirty minutes, even though visual inspection confirmed the formation of a viscoelastic film in each case (
[0259] Pendant drop tensiometry with drop shape analysis was performed on BsIA solutions at concentrations between 0.01 and 0.1 mg.Math.mL.sup.1. At low protein concentrations, the IFT initially remains unchanged for a lag time that is designated Regime I.sup.31, 32 (
[0260] The time (t) it takes for a particle to adsorb onto an interface via diffusion can be predicted by Equation 1.sup.33:
where is surface concentration, C.sub.b is bulk concentration and D is the diffusion coefficient of the particle. Equation 1 assumes that C.sub.b is unchanging and that there is no back diffusion from the interface..sup.33 We can estimate .sub.max (for 100% surface coverage) to be 1.57 mg.Math.m.sup.2 from TEM images of the BsIA 2D lattice (
[0262]
BsIA Undergoes Conformational Change at Interface to a Structure Enriched in Beta-Sheet (CD Data) WT+L77K
[0263] To study the conformation of BsIA in aqueous solution and at an oil-water interface, circular dichroism (CD) spectroscopy of WT-BsIA and the L77K mutant was performed in refractive index matched emulsions (RIMEs)..sup.34 Refractive index matching enables the generation of oil-in-water emulsions without the light scattering that interferes with spectroscopic measurements. The folding of WT-BsIA and BsIA-L77K was very similar at pH 7 in phosphate buffer, with both curves exhibiting a maximum at 205 nm, a minimum at 212 nm and a shoulder at 226 nm (
BsIA Forms Uniform Rectangular Lattice (TEM Data) WT Vs L77K
[0264] Transmission electron microscopy (TEM) of WT-BsIA stained with uranyl acetate indicates that the protein forms a highly ordered rectangular lattice (
Crystal Structure Shows Two Distinct Forms
[0265] Although the crystal structure of WT-BsIA features a large hydrophobic cap that allows the molecule to become anchored to a hydrophobic interface, kinetic measurements using the pendant drop method indicated that WT-BsIA must overcome an energy barrier prior to or during adsorption (
Emulsion Formation and Stability
[0266] WT-BsIA stabilised and alternative surfactant (CTAB, SDS, PLURONIC F127, TWEEN-20, sodium caseinate or whey protein isolate) stabilised emulsions were prepared by placing 900 L of 0.1 mg/mL WT-BsIA or 0.1 mg/mL surfactant and 100 L of decane in a vial before mixing the two phases using a rotor-stator at Level 6 (30000 rpm) for 20 seconds. Emulsions prepared by co-emulsifying in the presence of two stabilisers (WT-BsIA and each of the six surfactants, each at a concentration of 0.1 mg/mL) were mixed by vortexing 180 L of aqueous phase and 20 L of decane at top speed for 30 seconds. Re-emulsification of WT-BsIA stabilised emulsions was performed via vortexing in the presence of an excess concentration (2 mg/mL) of each of the six surfactants mentioned above. Re-emulsification of surfactant stabilised emulsions in WT-BsIA was performed via vortexing in the presence of 1 mg/mL WT-BsIA.
[0267] Images and video recordings (not included here) were captured using an Olympus optical microscope and QCapture Pro software.
WT-BsIA
[0268] Creating emulsions using WT-BsIA as a stabiliser results in the formation of a population of aspherical droplets within the emulsion. The emulsification method used changes the proportion of aspherical droplets and also the extent of asphericity. The two methods used were the rotor-stator method and the vortexing method. WT-BsIA stabilised emulsions prepared using a rotor-stator have fewer examples of anisotropic droplets and the extent of anisotropy is less than observed using the vortexing method.
[0269] WT-BsIA stabilised emulsions were assessed by mixing and vortexing with surfactant additives. The surfactants chosen were CTAB (positively charged small molecule surfactant), SDS (negatively charged small molecule surfactant), PLURONIC F-127, TWEEN-20 (both non-ionic, polymeric surfactants), sodium caseinate and whey protein isolate (protein and protein mixture commonly used as surfactants in food). If the anisotropic morphology of the droplets was removed (i.e. the droplets became spherical), then it was concluded that the surfactant had adsorbed onto the droplet interface and potentially displaced the WT-BsIA surface layer, although the experiments performed here do not provide direct evidence of BsIA displacement. Videos of WT-BsIA stabilised emulsion droplets becoming exposed to high concentrations of each of the six surfactants were recorded. Addition of CTAB and SDS caused the emulsion droplets to become spherical, whereas addition of PLURONIC F-127, TWEEN-20, sodium caseinate and whey protein isolate had no effect on droplet morphology.
[0270] When WT-BsIA stabilised emulsions were re-emulsified by vortexing in the presence of an excess concentration of CTAB or SDS, all droplets became isotropic. Although most droplets became isotropic and spherical upon re-emulsification with non-ionic surfactants, examples of anisotropic droplets were still present. Re-emulsification in the presence of the protein samples sodium caseinate and whey protein isolate did not result in the formation of a large proportion of isotropic droplets.
[0271] In addition to assessing the stability of WT-BsIA stabilised emulsions, emulsions were prepared in the presence of both WT-BsIA and a surfactant additive at a 1:1 mass ratio.
[0272] Examples of non-spherical droplets is shown in
[0273] Emulsions stabilised by each of the six surfactants were prepared and re-emulsified in the presence of 1 mg.Math.mL.sup.1 WT-BsIA (
[0274] Creating a WT-BsIA stabilised emulsion with sunflower oil using a rotor-stator creates a multiple (water-in-oil-in-water) emulsion (
BsIA-L77K
[0275] BsIA-L77K is a point mutant of WT-BsIA that exhibits different interfacial properties to the wildtype. Specifically, the BsIA-L77K interfacial film is able relax after compression, unlike WT-BsIA. This is likely due to reduced level of 2D lattice formation observed in BsIA-L77K samples relative to WT-BsIA. Despite the ability of the film to relax, emulsions stabilised by BsIA-L77K have the same properties as emulsions stabilised by WT-BsIAdroplets are aspherical and multiple emulsions can be formed in a single step by emulsification of sunflower oil (
[0276] As an example, of the stability of emulsions formed using WT-BsIA, a mixture of glyceryl trioctanoate and water stabilised by WT-BsIA was observed to be stable for up to 18 months. In comparison, a mixture of glyceryl trioctanoate and water stabilised by BsIA-L77K had fully separated out into the constituent phases after 18 months, thereby showing that WT-BsIA is the superior emulsion stabiliser over the mutant, and is an effective emulsion stabiliser over long time scales.
Foam Formation and Stability
Preparation of Foams
[0277] To form foams, 500 L of foaming solution (0.4 mg/mL total surfactant containing 0-100% WT-BsIA and 0-100% co-surfactant, in water) was placed in 11 cm cuvette. In a separate experiment, discussed below, foams were prepared using solutions of WT-BsIA at concentrations between 0.05 mg/mL and 1 mg/mL.
[0278] A modified 25 gauge needle was connected to a 60 mL syringe and placed through a small hole at the bottom of the cuvette. The syringe was placed in a syringe pump and air was pumped through the foaming solution. The syringe pump was set to pump at a rate of 5 mL/min. Once enough air had been passed through the foaming solution to form a foam, a cap was placed on top of the cuvette and wrapped in Parafilm. The needle was removed from the base of the cuvette and the hole was sealed with hot candle wax.
Imaging of Foams
[0279] The foams were placed in an incubator at 22 C. and imaged at a rate of 12 frames per hour for 25 hours. Foam volume was measured using ImageJ software by measuring foam height, while accounting for any cavities that developed within the foam.
[0280] Foams containing 0, 25, 50 and 75% WT-BsIA and 100, 75, 50 and 25% surfactant respectively were created by injection of air into the foaming solution (500 L) via a fine needle. The total concentration of subphase surfactants (including BsIA) was 0.4 mg.Math.mL.sup.1. The lifetime of the foams was monitored by imaging every five minutes for 10 hours or longer.
[0281]
Mixed Surfactant Foam Data
[0282] Mixed WT-BsIA/sodium caseinate foams are shown in
[0283] As well as enhancing the stability of protein (sodium caseinate) foams, the stability of non-ionic surfactant foams (PLURONIC F127 and TWEEN-20) was also improved by the addition of WT-BsIA (
[0284] Mixed WT-BsIA/TWEEN-20 foams with 50 or 75% WT-BsIA remained stable for far longer than the control TWEEN-20, but the 25/75 WT-BsIA/TWEEN-20 foam had collapsed after 4 hours, earlier than the control TWEEN-20 foam.
[0285] Foams prepared using the positively charged surfactant CTAB were not enhanced by the presence of WT-BsIA. In the experiments shown in
[0286] As SDS crystallises with phosphate buffer, WT-BsIA was dialysed into pure water for foaming experiments with CTAB and SDS. WT-BsIA in pure water does not foam, due to the low ionic strength. Despite this, the 75/25 WT-BsIA/SDS mixture did create a foam that remained stable for 10 hours (
[0287] As BsIA-L77K lacks a barrier to adsorption and reduces surface tension more readily than WT-BsIA, it foams more effectively.
BsIA as Sole Surfactant, Foam Data
[0288] As mentioned above, experiments were undertaken to analyse the effect of concentration of BsIA on foaming and foam stability, where BsIA was the sole surfactant. This complements the data discussed above in which BsIA was assessed in combination with co-surfactants.
[0289] Foams were prepared using 500 L of foaming solution, i.e. a solution of WT-BsIA in water at concentrations from 0.05 mg/mL to 1 mg/mL (0.005 wt % to 0.1 wt %). The same foaming procedure and other experimental protocols as discussed above were used.
[0290]
[0291]
Air Bubbles Stabilised by BsIA
[0292] Air bubbles stabilised by BsIA were formed by vigorously shaking, by hand, a 2 mg/ml solution of wt-BsIA in 25 mM phosphate buffer for 90 seconds. The sample was then placed on a glass cover slip and imaged using an optical microscope. The morphology of the resulting air bubbles is typically non-spherical. The stability of BsIA stabilised air bubbles were mixed in the presence of co-surfactants by applying an excess of six different surfactants: CTAB, SDS, PLURONIC F-127, TWEEN-20, Sodium Caseinate, and Whey Protein Isolate. The stability of the BsIA stabilised air bubbles was determined by observing whether the air bubbles transformed from non-spherical to spherical in the presence of the co-surfactant.
Frozen Multiphase Products
Ice Cream Composition and Preparation
[0293] The composition of the ice creams prepared in each experiment reported here is as follows: [0294] 14 wt % coconut oil (melted) [0295] 12 wt % skimmed milk powder (SMP: 50% lactose, 35% milk proteins) [0296] 14 wt % sucrose [0297] 60 wt % water [0298] Optional additives used: [0299] 0.03 wt % TWEEN 60 (standard) or 0.3 wt % TWEEN 60 [0300] 0.05 wt % WT-BsIA
[0301] As the ice cream composition is identical in all experiments apart from the two additives, the following shorthand was used to describe the samples: [0302] TWEEN-60, BsIA=no additives [0303] +TWEEN-60=only TWEEN-60 added [0304] +BsIA=only BsIA added [0305] +TWEEN-60, +BsIA=both additives present
[0306] To prepare the ice cream, SMP and sucrose were dissolved in water and melted coconut oil was pipetted on top of the solution. The mix was then sheared using a rotor-stator for 30 seconds. At this stage, the mix was split into four parts and any additives required (Tween and/or BsIA) were added. Each aliquot was then re-homogenised three to four times in the rotor-stator for 20 seconds with 20 second pauses in between cycles. This homogenisation process was adjusted for the air stabilisation experiment to reduce the time between homogenising the first and last aliquots. In that experiment, the initial mix was homogenised four times for 30 seconds with a 30 second pause between cycles. The aliquots were then re-homogenised in the presence of additives for 30 seconds.
[0307] After the homogenisation step, the mixture was aged for sixteen hours (unless stated otherwise) at 4 C. in a slowly rotating wheel. After aging, the samples were placed in a Perspex insert in an aluminium bowl at 20 C. and manually stirred for 5 minutes. This simultaneously froze and aerated the mix, creating ice cream. In each experiment, the sample mass, freezing onset time and total churn time were monitored and recorded.
Measurement of Fat Droplet Stability
[0308] To demonstrate that BsIA had successfully adsorbed onto the surface of the fat droplets in an ice cream mix, aged mixes, in which the fat droplets had partially coalesced, were first imaged using an optical microscope. The samples on the slide were then warmed to 38 C. to melt the fat. The samples were imaged again using optical microscopy to identify whether the partially coalesced droplets had retained their morphology. Retention of morphology demonstrated that BsIA was present and stabilising the partially coalesced structure.
Measurement of Air Bubble Stability
[0309] To measure the stability of air bubbles in ice cream, the mixes were studied before the aging and freezing processes. As the mixing process incorporates some air into the ice cream mixture (prior to the simultaneous freezing and aeration step), it is possible to determine the longevity of those air bubbles in the mixture. Simply allowing the mix to cream and monitoring the stability of the resultant foam does not work as the aqueous phase quickly drains away, leaving a solid fat stabilised foam. Instead the mixtures were incubated at 4 C. on a rotating wheel (to prevent creaming). At various time points, the samples were removed from the rotating wheel and allowed to cream. The height of the foam was then imaged and measured to establish the air content of the sample at that moment in time. The samples were then returned to the rotating wheel to continue incubation. This process was repeated to gather data at several time points.
Measurement of Ice Crystal Stability
[0310] CryoSEM was used to study ice crystal stability against long term storage (4 weeks) at 20 C. and against temperature abuse (1 day stored at 5 C.). To ensure that ice cream samples loaded onto the cryoSEM sample stage had not melted, the samples were cut out using a narrow straw to produce a cylindrical core of ice cream. The cylinder of ice cream was placed onto a dab of cooled Tissue-Tek glue on a cooled sample stage. The stage and adhered ice cream were then immediately plunged into nitrogen slush (210 C.) and subsequently placed into a precooled prechamber (170 C.) attached to the SEM instrument. Maintenance of the cylindrical shape indicated the ice cream had not melted. A scalpel built in to the prechamber was used to fracture the ice cream cylinders revealing the structural features of the ice cream interior. At this stage, the prechamber was warmed to 90 C. for 10 minutes to etch the ice crystals embedded into the protein-sugar matrix. After re-cooling to 170 C., the samples were sputter-coated in gold-palladium before the sample was inserted into the cryoSEM chamber, which was also held at 170 C.
Results
Stabilisation of Partially Coalesced Fat Droplets
[0311] To improve the stability of ice cream, milk protein stabilised emulsions are aged for four hours at 4 C. in the presence of an emulsifier such as TWEEN 60. By undergoing this process, the emulsion droplets begin to partially coalesce as a result of fat crystallisation and TWEEN 60 weakening the droplet interface.
[0312] This experiment was repeated with samples that allowed the partial coalescence to proceed further. In certain cases, it was possible to image the same partially coalesced regions before and after heating. Without BsIA present, the large partially coalesced structures melted into large spherical oil droplets (
Stabilisation of Air Phase
[0313] Four ice cream mixes containing either no additives, TWEEN-60, BsIA and TWEEN-60+BsIA were foamed using a rotor-stator. The lifetime of the air bubbles was studied as described in the Experimental. From the data shown in
Stabilisation of Ice Phase
[0314] CryoSEM was utilised to monitor ice crystal coarsening in ice creams with and without BsIA. The ice creams studied in this section all contained TWEEN-60.
[0315] Samples were prepared for cryoSEM by cutting out a cylindrical section of ice cream and placing the cylinder onto cold Tissue-Tek glue on a chilled sample stage. The stage and sample were then immediately plunged into nitrogen slush at 210 C., freezing the sample onto the stage. The stage was then quickly transferred into a cold (180 C.) prechamber under vacuum. At this point, visual inspection of the ice cream shape confirmed that the sample had not melted. The cylinder was then fractured using a scalpel (built into the prechamber) and the sample was etched by heating to 90 C. for 10 minutes. Then, the fractured and etched sample was coated in gold and platinum in preparation for imaging. At this point, the sample was moved into the main SEM chamber and imaging could begin.
CryoSEM Imaging of Ice Cream
[0316] The fractured sample morphologies revealed three primary distinctive structures: Ice crystals, air bubbles and the sugar-protein matrix. Ice crystals were identified by the presence of a flat surface at the bottom of a basin. This pitting is caused by the etching process, which causes sublimation of the ice. Air bubbles were observed as inward or outward facing large spherulites. The matrix was the material in between the ice crystals and air bubbles. Some oversized fat droplets could be seen embedded in the matrix and on the surface of air bubbles.
[0317] Ice crystals were identified by the flat surface at the bottom of the feature. The cross-sectional area was measured using ImageJ software. In instances where it was not clear whether the feature was an air bubble cavity or an ice crystal depression, the feature was ignored. Ice crystals were also ignored if they overlapped with the edge of the image. All of the samples were imaged at 250 magnification. The ice crystal areas were analysed by plotting the data as histograms and also taking the arithmetic and geometric means.
[0318] Two separate types of experiment were performed to study whether BsIA had an effect on ice crystal coarsening during storage. In the first experiment, ice cream samples were studied under cryoSEM when fresh (on the same day as freezing and aeration occurred) and also after 28 days of being stored in a freezer at 20 C. In the second experiment, fresh ice cream samples were stored overnight at either 20 C. or at approximately 5 C. By temperature-abusing the sample, the rate of ice crystal coarsening is increased.
Effect of Storage at 20 C.
[0319] Analysis of cryoSEM images of fractured ice creams (
Data Summary
[0320] The average size and standard deviations of the data sets were:
TABLE-US-00001 TABLE 1 Summary of average crystal sizes in ice creams with and without BsIA stored at 20 C. for 0 and 28 days. Minus BsIA Plus BsIA Arithmetic Arithmetic Age mean Geometric Age mean Geometric (days) (m.sup.2) mean (m.sup.2) (days) (m.sup.2) mean (m.sup.2) 0 1273.62 1010.61 0 1299.14 897.17 28 2380.53 1683.57 28 1838.58 1359.97
Temperature Abused Ice Creams
[0321] In this experiment, two ice cream samples with TWEEN-60 were prepared with and without BsIA. The ice cream samples were split into two parts, with one part being stored at 20 C. overnight and the second part being stored at approximately 5 C. overnight. Analysis of cryoSEM images (
Data Summary
[0322]
TABLE-US-00002 TABLE 2 Summary of average crystal sizes in ice creams with and without BsIA stored for 24 hours at 20 C. and 5 C. Minus BsIA Plus BsIA Temperature Arithmetic Geometric Arithmetic Geometric ( C.) mean (m.sup.2) mean (m.sup.2) mean (m.sup.2) mean (m.sup.2) 20 1156.10 836.45 1206.90 877.38 5 2663.39 1887.02 2268.78 1580.39
AxA Mutant BsIA
[0323] Although BsIA has a hydrophobic cap that is resistant to self-assembly in aqueous media, the C-terminal region contains two cysteine (C) residues at residue positions 178 and 180 that are capable of forming intermolecular disulfide bonds, thus allowing dimers, tetramers, hexamers and potentially higher order oligomers to form. Although dimers can still stabilise an air-water or oil-water interface, tensiometry experiments demonstrated that they bind via only one cap, leaving the second cap pendant in the aqueous phase. Thus, the presence of dimers will alter the surface chemistry of BsIA-stabilised emulsions and foams and also reduce the effective concentration of adsorbable BsIA in solution. By adding a reducing agent (e.g. 2-mercaptoethanol or dithiothreitol), it is possible to reduce WT-BsIA dimers into its constituent monomers, but such reducing agents won't be usable in every application. To avoid the use of reducing agents while maintaining a functional, monomeric BsIA solution, a mutant was developed that replaced the cysteine residues with alanine (A) residues. The mutations were carried out using primers such as SEQ ID NO:12-17. The resultant double mutant is given the shorthand name AxA, as WT-BsIA would be CxC. The x represents any amino acid, although it is an alanine (A) in the experiments performed in this work. The results in this section demonstrate that a solution of unfractionated AxA-BsIA functions in exactly the same way as a solution of monomeric WT-BsIA, except the ability to cross-link into dimers has been removed.
AxA-BsIA Forms a Stable, Monomeric Solution in Aqueous Media
[0324] When WT-BsIA solutions are passed through a size-exclusion column, two peaks can clearly be resolved that multiangle laser light scattering confirms are attributed to a mixed population of monomers and dimers. Applying the same separation technique to the AxA mutant reveals only one peak that corresponds to a pure population of monomers. Performing SDS-PAGE chromatography on WT-BsIA and AxA-BsIA yields the same resultAxA-BsIA exists as a pure population of monomers.
The Conformation of AxA-BsIA is the Same as WT-BsIA in Solution and at an Interface
[0325] Circular dichroism spectroscopy (CD) confirmed that AxA-BsIA is conformationally identical to WT-BsIA in solution (25 mM phosphate buffer, pH 7), exhibiting the same maximum at 205 nm, a minimum at 212 nm and a shoulder at 226 nm (
The Kinetics to AxA-BsIA Binding to an Air-Water Interface is Identical to WT-BsIA Monomers
[0326] Pendant drop tensiometry was used to study how long it takes for WT-BsIA and AxA-BsIA to bind to an air-water interface. In this case, the lag time (Regime I time) before the interfacial tension (IFT) begins to drop was monitored and compared between monomeric WT-BsIA and AxA-BsIA samples at 0.03 mg/mL. The average Regime I time for monomeric WT-BsIA was 97 s, whereas the average Regime I time for AxA-BsIA was 102 s.
Both WT-BsIA and AxA-BsIA Form a Rectangular Lattice Upon Binding to an Interface
[0327] Transmission electron microscopy of monomeric WT-BsIA and AxA-BsIA adsorbed onto a carbon film revealed that there is no difference in the two-dimensional arrangement of BsIA molecules on the substrate (
Wrinkles Formed by Both WT-BsIA and AxA-BsIA Film Compression do not Relax
[0328] Once a film has formed around a pendant drop of BsIA solution submerged in oil, withdrawing a small amount (5 L) of the droplet (total initial volume=40 L) causes the film to compress and wrinkles to form. WT-BsIA is known to form wrinkles that are incapable of relaxing as the WT-BsIA molecules cannot be removed from the interface by such compression. Wrinkles formed in AxA-BsIA films were also found to be incapable of relaxing as the wrinkles did not dissipate after formation due to compression.
Unfractionated AxA-BsIA can Modify the Surface Hydrophilicity of a Hydrophobic Surface More Efficiently than Unfractionated WT-BsIA
[0329] Coating a surface with BsIA can reverse the surface's hydrophobicity. To demonstrate this, Circular glass cover slips (diameter=10 mm) were first cleaned in 2% Hellmanex for 3 hours, before rinsing in Milli-Q water. They were then further cleaned in 1M HCl (in 50% ethanol) for 3 hours and then thoroughly rinsed in Milli-Q water again. The clean cover slips were then incubated in octadecyltrimethoxysilane for 24 hours before being cleaned in acetone, then ethanol and finally Milli-Q water. The hydrophobic cover slips were then dried at 50 C. for 1 hour.
[0330] The hydrophobic cover slips were coated in three different protein samples (unfractionated WT-BsIA, unfractionated AxA-BsIA and sodium caseinate) using the Langmuir-Blodgett technique. Briefly, hydrophobic cover slips were submerged in 0.05 mg/mL adsorbent solutions for five minutes and withdrawn vertically through air-water interface at a withdrawal rate of 5 mm/min. Excess solution was wicked from the edge of the cover slips, which were then left to dry on filter paper. Imaging and contact angle measurements were performed using a Krss EasyDrop tensiometer.
[0331] Contact angle experiments revealed the contact angle of a 5 L droplet of Milli-Q water against the cover slip surface.
TABLE-US-00003 TABLE 3 Contact angles measured on each different surface. Cover slip type Contact angle/ Hydrophobic control 96.6 Unfractionated WT-BsIA 48.6 Unfractionated AxA-BsIA 33.8 Sodium caseinate 86.8
[0332] The contact angle against the hydrophobic control cover slip was 96.6. Functionalising with unfractionated WT-BsIA, a mixture of monomers and dimers, reduced the contact angle to 48.6. A further reduction in contact angle to 33.8 was achieved by using an unfractionated solution of AxA-BsIA, which cannot form disulfide bridged dimers due to a lack of cysteine residues.
AxA-BsIA Emulsions
[0333] Just like observed with WT-BsIA previously, AxA-BsIA will make a single emulsion when prepared with decane and a double emulsion when prepared with a triglyceride oil like glyceryl trioctanoate (
Resistance of Emulsions to Surfactants
[0334] The behaviour of AxA-BsIA stabilised emulsions against the effect of surfactants is very similar to WT-BsIA. The primary difference was the observation that AxA-BsIA (purely monomeric BsIA) is resistant to displacement by sodium dodecyl sulfate (SDS), whereas it was previously observed that WT-BsIA was not. This is likely due to the presence of dimers in the latter sample, as resistance to SDS could be recovered by the addition of dithiothreitol (DTT) to the primarily dimeric WT-BsIA solution, reducing the dimers to monomers.
[0335] Another difference between AxA-BsIA and dimeric WT-BsIA was the observation that emulsions stabilised with dimeric WT-BsIA were resistant to displacement by cetyl trimethylammonium bromide (CTAB) during co-emulsification, whereas the purely monomeric AxA-BsIA was not. Previously, it was noted that WT-BsIA was not resistant to CTAB, presumably as it contained a mixture of monomers and dimers. The overall conclusion is that BsIA monomers (either WT or AxA) can maintain a presence at the interface in the presence of SDS, but not CTAB, whereas WT-BsIA dimers can remain at the interface in the presence of CTAB, but not SDS. The observations regarding resistance to SDS and CTAB are summarised in Table 4 and
TABLE-US-00004 TABLE 4 Summary of emulsion drop shapes after co-emulsification between BsIA and CTAB or SDS (all at 0.1 mg/mL). The S denotes that all droplets were spherical, indicating that BsIA had no influence on drop morphology. NS denotes that non-spherical droplets were present, confirming that BsIA was at the interface and causing the trapped anisotropic droplet shapes. WT-BsIA WT-BsIA dimers + (previous) AxA-BsIA WT-BsIA dimers DTT CTAB S S NS S SDS S NS S NS
Co-Emulsification of AxA-BsIA and Surfactants
[0336] Co-emulsified emulsions were prepared by vortexing AxA-BsIA (90 uL, 0.2 mg/mL), surfactant (90 uL, 0.2 mg/mL) and decane (20 uL) in a PCR tube for 1 minute. Non-spherical emulsion droplets were observed in all co-emulsified samples except for the AxA-BsIA/CTAB emulsion (
Addition of Excess Surfactant to BsIA Emulsions
[0337] The stability of preformed AxA-BsIA emulsions to a high concentration of surfactant (5 mg/mL) was monitored by gently mixing the surfactant solution (10 mg/mL) at a 1:1 volume ratio with a vortexed AxA-BsIA emulsion prepared using 0.1 mg/mL AxA-BsIA. The results were similar to WT-BsIA, except SDS (as with co-emulsification) was unable to displace AxA-BsIA from the oil-water interface with gentle mixing (
Stability of AxA-BsIA Foams and AxA-BsIA-Surfactant Composite Foams
[0338] AxA-BsIA foams behaved similarly to the WT-BsIA foams studied previously. The composite foams prepared with BsIAL77K, sodium caseinate, PLURONIC F127 and TWEEN-20 also demonstrated similar stability. The concentration of AxA-BsIA and the surfactants in the composite foams was 0.4 mg/ml. They were mixed at different ratios to provide the different compositions. Foams were created by pushing air from a syringe through a fine hole (<100 m diameter) into 1 mL of BsIA and/or surfactant solution. The time course graphs for each foam are shown in
Hydrophobic Sand
[0339] Hydrophobic sand was produced in house by functionalising sand with dichloro-dimethyl silane. The hydrophobised sand was then incubated in a 0.2 mg/ml WT-BsIA solution overnight. The following day, the sand was placed in a drying oven at 50 C. and allowed to dry for 2 hours. The sand was placed in a thin layer on a cavity slide. A 20 L sessile drop of MilliQ water was placed on the layer of sand and imaged using the Krss Easy Drop.
[0340] The drop of water was observed to sit on top of the layer of hydrophobic sand, but was adsorbed into the layer of hydrophobic sand that had been treated with WT-BsIA. Accordingly, this result showed that the treatment of the hydrophobic sand with BsIA increased the hydrophilicity of the hydrophobic sand such that the water was able to wet the sand and thereby be absorbed by it.
BsIA Orthologues
[0341] We performed pendant drop tensiometry on BsIA orthologues produced by three different organisms: B. amyloliquefaciens, B. licheniformis, and B. pumilis along with the protein YweA (B. subtilis). Samples were prepared by diluting each protein in phosphate buffer to a concentration of 0.03 mg ml.sup.1. Droplets were expelled in air and the interfacial tension was measured using standard techniques. As was the case with BsIA produced by B. subtilis, once an elastic film forms around the droplet the measured interfacial tension becomes a meaningless quantity. A good indication of when the film forms is by monitoring the fit error. Regime I times were then extracted one of two ways: (1) the transition time between regimes I and II when the fit error was still low (<0.4 m); or (2) when the fit error increased to a threshold value (>0.75 m). Each reported Regime I time is the average of 4 experiments. The results can be found in
[0342] We also measured the relaxation of the elastic films formed by the orthologues. Samples were diluted to a concentration of 0.2 mg ml.sup.1 in phosphate buffer. A droplet (40 L) was then expelled into glyceryl trioctanoate and allowed to equilibrate for 30 minutes. After equilibration, the droplet was compressed by retraction of 5 L. A video (2 fps for 10 minutes) was recorded of the wrinkles formed in the elastic film. Film relaxation was measured by loss of wrinkles as measured by the reduction in normalised grey scale values. The results are shown in
[0343] Circular dichroism (CD) spectroscopy was used to study the conformation of the BsIA orthologues in aqueous solution and at an oil-water interface. Solution state CD measurement were performed on samples diluted to a concentration of 0.03 mg ml.sup.1 and measured in a 1 cm path length quartz cuvette. Results are shown in
[0344] In order to investigate the conformation of the proteins at an interface we performed Circular Dichroism (CD) on oil in water emulsions made from the orthologues. Typically, emulsions would be opaque and strongly scatter light in the far UV. To solve this problem we use refractive indexed matched emulsions (RIMEs) to obtain the spectra. We make a standard water in oil emulsion using a protein solution of 0.5 mg ml.sup.1 mixed with a 20% decane (by volume). The emulsions are prepared by rotor stator for 5 minutes. The emulsions are allowed to cream and we introduce a washing step in order to remove any protein still present in solution by removing the supernatant and replacing it with fresh buffer. The sample is then emulsified and allowed to cream again. We remove supernatant and replace it with glycerol to a final amount of 59% by mass. Finally, we emulsify this glycerol solution. The addition of the glycerol index matches the emulsion droplets allowing for light to pass through the sample. We measure CD spectra using a 0.01 cm path length quartz cuvette. The results are shown in
TABLE-US-00005 TABLE 5 BsIA B. licheniformis B. amyloliquifaciens B. pumilus YweA Regime I WT Slow WT WT Fast Film WT WT WT Fast Very Fast Relaxation Solution CD WT WT Weak min. No min. WT RIMES CD -sheet -sheet -helix? -sheet -sheet TEM crystal crystal crystal domains crystal crystal domains
Sequences Relevant to Present Invention
[0345]
TABLE-US-00006 FulllengthWT-BsIA (SEQIDNO:1) MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTES TMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPCGCN WT-BsIAtruncated,BsIA.sub.42-181 (SEQIDNO:2) MRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPCGCN FulllengthBsIA-L77K (SEQIDNO:3) MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTES TMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLKSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPCGCN BsIA-L77Ktruncated (SEQIDNO:4) MRTQSTASLFATITGASKTEWSFSDIELTYRPNTLKSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPCGCN DNAsequenceusedbyBacillussubtilistoencode fulllengthwildtypeBsIAprotein. (SEQIDNO:5) ATGAAACGCAAATTATTATCTTCTTTGGCAATTAGTGCATTAAGTCTCGG GTTACTCGTTTCTGCACCTACAGCTTCTTTCGCGGCTGAATCTACATCAA CTAAAGCTCATACTGAATCCACTATGAGAACACAGTCTACAGCTTCATTG TTCGCAACAATCACTGGCGCCAGCAAAACGGAATGGTCTTTCTCAGATAT CGAATTGACTTACCGTCCAAACACGCTTCTCAGCCTTGGCGTTATGGAGT TTACATTGCCAAGCGGATTTACTGCAAACACGAAAGACACATTGAACGGA AATGCCTTGCGTACAACACAGATCCTCAATAACGGGAAAACAGTAAGAGT TCCTTTGGCACTTGATTTGTTAGGAGCTGGCGAATTCAAATTAAAACTGA ATAACAAAACACTTCCTGCCGCTGGTACATATACTTTCCGTGCGGAGAAT AAATCATTAAGCATCGGAAATAAATTTTACGCAGAAGCCAGCATTGACGT GGCTAAGCGCAGCACTCCTCCGACTCAGCCTTGCGGTTGCAACTAA
GST-TEV-BsIA Construct Sequences
[0346] These are the sequences of constructs used to express and then purify BsIA (BsIA.sub.42-181, truncated form) and the L77K variant from E. coli.
Key:
Precision Recognition Site
TEV Site
[0347] BsIA 42-181
GST Sequence from pGEX 6P-1
Added Stop Site
[0348]
TABLE-US-00007 Nucleotidesequence(SEQIDNO:6): ATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATA TCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGT TTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCT ATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGA GATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAG ACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGT TTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCT TGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAAC GTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAG GGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGG
[0349] The nucleotides encoding the L to K substitution are in underlined
TABLE-US-00008 Proteinsequence-BslA-L77K(42-181truncatedform)linked toGST(SEQIDNO:9): MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLFMFEDR LCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQ
[0350] The L to K substitution is in underlined.
Primers
[0351]
TABLE-US-00009 L77K (SEQIDNO:10) CCGTCCAAACACGCTTAAAAGCCTTGGCGTTATGG L77K (SEQIDNO:11) CCATAACGCCAAGGCTTTTAAGCGTGTTTGGACGG C178ANSW1906 (SEQIDNO:12) TCCTCCGACTCAGCCTgcaGGTTGCAACTAATAAC
[0352] The region for mutation of the DNA is in lower case.
TABLE-US-00010 C178ANSW1907 (SEQIDNO:13) GTTATTAGTTGCAACCtgcAGGCTGAGTCGGAGGA
[0353] The region for mutation of the DNA is in lower case.
TABLE-US-00011 C180ANSW1908 (SEQIDNO:14) GACTCAGCCTTGCGGTgcaAACTAATAACTCGAGC
[0354] The region for mutation of the DNA is in lower case.
TABLE-US-00012 C180ANSW1909 (SEQIDNO:15) GCTCGAGTTATTAGTTtgcACCGCAAGGCTGAGTC
[0355] The region for mutation of the DNA is in lower case.
TABLE-US-00013 C178ANSW1910 (SEQIDNO:16) TCCGACTCAGCCTgcaGGTgcaAACTAATAACTCG
[0356] The region for mutation of the DNA is in lower case.
TABLE-US-00014 C178ANSW1911 (SEQIDNO:17) CGAGTTATTAGTTtgcACCtgcAGGCTGAGTCGGA
[0357] The region for mutation of the DNA is in lower case.
TABLE-US-00015 FulllengthBsIAmutant (SEQIDNO:18) MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTES TMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPXGXN
[0358] X is a non-sulfur containing residue.
TABLE-US-00016 BsIAmutanttruncated (SEQIDNO:19) MRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPXGXN
[0359] X is a non-sulfur containing residue.
TABLE-US-00017 FulllengthAxA-BsIAmutant (SEQIDNO:20) MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTES TMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPAGAN
[0360] C to A substitution is underlined.
TABLE-US-00018 AxA-BsIAtruncated (SEQIDNO:21) MRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLG VMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFY AEASIDVAKRSTPPTQPAGAN
[0361] C to A substitution is underlined.
TABLE-US-00019 Truncated(aminoacids40-179)B.licheniformis BsIA (SEQIDNO:22) YRPAASASLYSVITGASKQEWSFSDIELTYRPNSILALGT VEFTLPSGFSATTKDTVNGRALTTGQILNNGKTVRLPLTI DLLGIAEFKLVLANKTLPAAGKYTFRAENRVLGLGSTFYA ESSIEVQKRATPPTQPCNCK Truncated(aminoacids42-181)B.amylolique- faciensBsIA (SEQIDNO:23) MSTKATATLFAKYTGASQQEWSFSDIELTYRPNTILSLGV MEFTLPSGFAATTKDTVNGHALRERQILNNGKTVRLPLNI DLLGAAEFKLSLNNKTLPAAGTYKFRAENKSLSIGSKFYA EDTIVVQKRSTPPTQPCNCK Truncated(aminoacids37-177)B.pumilusBsIA (SEQIDNO:24) STNARPAELYAKITGTSKQEWSFSDIELTYRPNSVLSLGA IEFTLPAGFQATTKDIFNGKALKDSYILNSGKTVRIPARL DLLGISQFKLQLSHKVLPAAGTYTFRAENRALSIGSKFYA EDTLDIQTRPVVVTPPDPCGC FulllengthB.licheniformisBsIA (SEQIDNO:25) MKMKHKFFSTVMASLFGLVLLLSLPTASFAAESSSTVHEP EMSTKATATLFAKYTGASQQEWSFSDIELTYRPNTILSLG VMEFTLPSGFTATTKDTVNGHALRERQILNNGKTVRLPLN IDLIGAAEFKLSLNNKTLPAAGTYKFRAENKSLSIGSKFY AEDTIVVQKRSTPPTQPCNCK FulllengthB.amyloliquefaciensBsIA (SEQIDNO:26) MLKRMYRSKLSILAVSLVMMVSIFLPSFQASAQTTKTESV YRPAANASLYATITGASKQEWSFSDIELTYRPNSILALGT VEFTLPSGFSATTKDTVNGRALTTGQILNNGKTVRLPLTI DLLGIAEFKLVLANKTLPAAGKYTFRAENRVLGLGSTFYA ESSIEVQKRATPPTQPCNCK FulllengthB.pumilusBsIA (SEQIDNO:27) MKKTWTMIMMGMLTLVMALSVPIAASAEGATQEGKASTNA RPAELYAKITGTSKQEWSFSDIELTYRPNSVLSLGAIEFT LPAGFQATTKDIFNGKALKDSYILNSGKTVRIPARLDLLG ISQFKLQLSHKVLPAAGTYTFRAENRALSIGSKFYAEDTL DIQTRPVVVTPPDPCGC FulllengthB.subtilisYweA (SEQIDNO:28) MLKRTSFVSSLFISSAVLLSILLPSGQAHAQSASIEAKTV NSTKEWTISDIEVTYKPNAVLSLGAVEFQFPDGFHATTRD SVNGRTLKETQILNDGKTVRLPLTLDLLGASEFDLVMVRK TLPRAGTYTIKGDVVNGLGIGSFYAETQLVIDPR TruncatedB.subtilisYweA (SEQIDNO:29) QSASIEAKTVNSTKEWTISDIEVTYKPNAVLSLGAVEFQF PDGFHATTRDSVNGRTLKETQILNDGKTVRLPLTLDLLGA SEFDLVMVRKTLPRAGTYTIKGDVVNGLGIGSFYAETQLVIDPR
REFERENCES
[0362] 1. Hobley L et al. (2013) BsIA is a self-assembling bacterial hydrophobin that coats the Bacillus subtilis biofilm. Proceedings of the National Academy of Sciences of the United States of America 110:13600-13605. [0363] 2. Smith & Waterman, Adv. Appl. Math. 2:482, 1981. [0364] 3. Needleman & Wunsch, J. Mol. Biol. 48:443, 1970. [0365] 4. Pearson & Lipman, Proc. Nat. Acad. Sci. USA 85:2444, 1988. [0366] 5. Higgins & Sharp, Gene, 73:23744, 1988. [0367] 6. Higgins & Sharp, CABIOS 5:151-3, 1989. [0368] 7. Corpet et al., Nuc. Acids Res. 16:10881-90, 1988. [0369] 8. Huang et al., Computer Appls. in the Biosciences 8, 155-65, 1992. [0370] 9. Pearson et al., Meth Mol. Bio. 24:307-31, 1994. [0371] 10. Altschul et al., J. Mol. Biol. 215:403-10, 1990. [0372] 11. Hancock and Armstrong, Comput. Appl. Biosci. 10:67-70, 1994. [0373] 12. Current Protocols in Molecular Biology (Ausubel, 2000, Wiley and son Inc, Library of Congress, USA); [0374] 13. Molecular Cloning: A Laboratory Manual, Third Edition, (Sambrook et al, 2001, Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press); [0375] 14. Oligonucleotide Synthesis (M. J. Gait ed., 1984); [0376] 15. U.S. Pat. No. 4,683,195; [0377] 16. Nucleic Acid Hybridization (Harries and Higgins eds. 1984); [0378] 17. Transcription and Translation (Hames and Higgins eds. 1984); [0379] 18. Culture of Animal Cells (Freshney, Alan R. Liss, Inc., 1987); [0380] 19. Immobilized Cells and Enzymes (IRL Press, 1986); [0381] 20. Perbal, A Practical Guide to Molecular Cloning (1984); [0382] 21. the series, Methods in Enzymology (Abelson and Simon, eds. -in-chief, Academic Press, Inc., New York), specifically, Vols. 154 and 155 (Wu et al. eds.) and Vol. 185, Gene Expression Technology (Goeddel, ed.); [0383] 22. Gene Transfer Vectors For Mammalian Cells (Miller and Calos eds., 1987, Cold Spring
[0384] Harbor Laboratory); [0385] 23. Immunochemical Methods in Cell and Molecular Biology (Mayer and Walker, eds., Academic Press, London, 1987); [0386] 24. Handbook of Experimental Immunology, Vols. I-IV (Weir and Blackwell, eds., 1986); [0387] 25. Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986). [0388] 26. Humphrey W, Dalke A, Schulten K (1996) VMD: visual molecular dynamics. Journal of Molecular Graphics 14:33-38. [0389] 27. Andreas J M, Hauser E A, Tucker W B (1938) Boundary Tension by Pendant Drops. Journal of Physical Chemistry 42:1001-1019. [0390] 28. Stauffer C E (1965) The Measurement of Surface Tension by the Pendant Drop Technique. Journal of Physical Chem 69:1933-1938. [0391] 29. Rosen M J (2004) Surfactants and interfacial phenomena (J. Wiley & Sons, Hoboken, N.J.). 3rd Ed. [0392] 30. Alexandrov N A et al. (2012) Interfacial layers from the protein HFBII hydrophobin: dynamic surface tension, dilatational elasticity and relaxation times. Journal of Multiphase system and Interface Science 376:296-306. [0393] 31. Tripp B C, Magda J J, Andrade J D (1995) Adsorption of globular protein at air/water interface as measured by dynamic surface tension: Concentration dependence, mass-transfer considerations, and adsorption kinetics. Journal of Multiphase system and Interface Science 173:16-27. [0394] 32. Beverung C J, Radke C J, Blanch H W (1999) Protein adsorption at the oil/water interface: characterization of adsorption kinetics by dynamic interfacial tension measurements. Biophysical Chemistry 81:59-80. [0395] 33. Ward A F H, Tordai L (1946) Time-Dependence of Boundary Tensions of Solutions I. The Role of Diffusion in Time-Effects. The Journal of Chemical Physics 14:453. [0396] 34. Husband F A, Garrood M J, Mackie A R, Burnett G R, Wilde P J (2001) Adsorbed Protein Secondary and Tertiary Structures by Circular Dichroism and Infrared Spectroscopy with Refractive Index Matched Emulsions.pdf. 859-866. [0397] 35. Towell III J F, Manning M C (1994) in Analytical Applications of Circular Dichroism, eds Purdie N, Brittain H G (Elsevier, New York), pp 175-205. [0398] 36. Jarzynski C (1997) Nonequilibrium Equality for Free Energy Differences. Physical Review Letters 78:2690-2693.