IN VIVO IMMUNOIMAGING OF INTERFERON-GAMMA
20200206371 ยท 2020-07-02
Inventors
Cpc classification
Y02A90/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
G16H20/40
PHYSICS
A61K51/1021
HUMAN NECESSITIES
G16H20/10
PHYSICS
International classification
A61K51/10
HUMAN NECESSITIES
Abstract
Methods for in vivo immunoimaging including: (a) administering a labeled-antibody conjugate to a subject, wherein the labeled-antibody conjugate includes: an antibody that specifically recognizes and binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and (b) detecting the presence of the radiolabeled-antibody conjugate in the subject in vivo by imaging. Embodiments of the present disclosure are directed to labeled-antibody conjugates and therapeutic radionuclide-antibody conjugates.
Claims
1. A method for in vivo immunoimaging IFN- as a marker of active T cells in a subject, comprising: administering a labeled-antibody conjugate according to claim 19 to a subject, wherein the labeled-antibody conjugate comprises: an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging.
2. The method of claim 1, wherein the subject has cancer.
3. The method of claim 2, wherein the subject received an immunotherapy prior to administering and detecting the presence of the labeled-antibody conjugate, and wherein the mechanism of action of the immunotherapy results in an increased number of tumor-infiltrating lymphocytes in the subject and/or an increased activation state of a tumor-infiltrating lymphocyte population in the subject; or wherein administering and detecting the presence of the labeled-antibody conjugate is performed prior to administration of a therapy to determine the state of active immunity in the subject.
4. The method of claim 3, wherein the immunotherapy is an immune checkpoint inhibitor, a cytokine, a vaccine, or an adoptive cell transfer therapy.
5. The method of claim 1, wherein the subject is human and the antibody specifically binds to human IFN-.
6. The method of claim 1, wherein the antibody is selected from a monoclonal antibody, an antibody fragment, or combination thereof.
7. The method of claim 6, wherein the antibody fragment is a Fab fragment or a diabody.
8.-13. (canceled)
14. The method of claim 1, wherein the imaging comprises positron emission tomography (PET) imaging, single photon emission computed tomography (SPECT) imaging, or a both PET and SPECT.
15. (canceled)
16. The method of claim 1, wherein the labeled-antibody conjugate further comprises a fluorophore.
17. The method of claim 1, wherein specific binding of the labeled-antibody conjugate to IFN- indicates the presence of activated T cells and/or human cancer cells.
18. The method of claim 1, wherein the presence of the labeled-antibody conjugate is detected in real time.
19. A labeled-antibody conjugate comprising: an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer.
20. (canceled)
21. The labeled-antibody conjugate of claim 19, wherein the antibody is selected from a monoclonal antibody, an antibody fragment, or combination thereof.
22. The labeled-antibody conjugate of claim 21, wherein the antibody fragment is a Fab fragment or a diabody.
23. (canceled)
24. The labeled-antibody conjugate of claim 19, wherein the radionuclide tracer is conjugated to the antibody with a bifunctional chelator or linker.
25. The labeled-antibody conjugate of claim 24, wherein the bifunctional chelator comprises a chelator selected from N-{5-[Acetyl(hydroxy)amino]pentyl}-N-[5-({4-[(5-aminopentyl)(hydroxy)amino]-4-oxobutanoyl}amino)pentyl]-N-hydroxysuccinamide (DFO), 1,4,7-triazacyclononane-N,N,N-triacetic acid (NOTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (i.e., DOPA), diethylenetriaminepentaacetic acid (DTPA), 2,2-(7-(1-carboxy-4-((2,5-dioxopyrrolidin-1-yl)oxy)-4-oxobutyl)-1,4,7-triazonane-1,4-diyl)diacetic acid (NODA), or a combination of any two or more thereof.
26. The labeled-antibody conjugate of claim 24, wherein the bifunctional chelator is p-SCN-Bn-DFO or NOTA.
27. The labeled-antibody conjugate of claim 19, wherein the radionuclide tracer is selected from 11C, .sup.13N, .sup.15O, .sup.18F, .sup.64Cu, .sup.68.sub.Ga, .sup.76Br, .sup.82Rb, .sup.86Y, .sup.89Zr, .sup.99mTc, .sup.111In, .sup.124I, .sup.131I, .sup.186Re, .sup.43K, .sup.52Fe, .sup.57Co, .sup.67Su, .sup.67Ga, .sup.77Br, .sup.81Rb, .sup.81mKr, .sup.87mSr, .sup.113mIn, .sup.123I, .sup.125I, .sup.127Cs, .sup.129Cs, .sup.132I, .sup.197Hg, .sup.203Pb, .sup.206Bi, or a combination of any two or more thereof.
28. (canceled)
29. The labeled-antibody conjugate of claim 19, wherein the antibody specifically binds to human IFN-.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
DETAILED DESCRIPTION OF THE INVENTION
[0062] While the following terms are believed to be well understood by one of ordinary skill in the art, definitions are set forth to facilitate explanation of the presently-disclosed subject matter.
[0063] The term label refers to a chemical moiety that can be covalently attached to an antibody and that functions to provide a detectable signal, such as, e.g., radionuclide tracers.
[0064] The term antibody is used herein in its broadest sense and specifically refers to monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity (see e.g., Miller et al. (2003) J Immunology 170:4854-4861). Antibodies may be murine, human, humanized, chimeric, or derived from other species. An antibody is a protein that is capable of recognizing and binding to a specific antigen, such as, e.g., IFN-. (See e.g., Janeway, C., Travers, P., Walport, M., Shlomchik (2001) Immuno Biology, 5th Ed., Garland Publishing, New York). A target antigen may have numerous binding sites, also called epitopes, recognized by complementarity determining regions of antibodies. In embodiments, each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody. An antibody includes a full-length immunoglobulin molecule or an immunologically-active portion of a full-length immunoglobulin molecule, such as, e.g., a molecule that contains an antigen binding site that immunospecifically recognizes and binds to an antigen of a target of interest or part thereof, such as, e.g., IFN-. The immunoglobulin disclosed herein can be of any type (e.g., IgG, IgE, IgM, IgD, and IgA), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. The immunoglobulins can be derived from any species. In some embodiments, however, the immunoglobulin is of rodent or human origin. According to embodiments, the antibody is an antibody fragment and in specific embodiments, the antibody fragment is a diabody.
[0065] The term specifically recognizes and binds to refers to antibodies that are capable of binding to an antigen of interest, such as, e.g., IFN-, with sufficient binding affinity such that the antibody is useful in targeting the antigen of interest. As an example, the antibodies may have a binding affinity K.sub.D of from about 10.sup.4 to about 10.sup.15, or from about 10.sup.6 to about 10.sup.13, or from about 10.sup.7 to about 10.sup.12, or from about 10.sup.9 to about 10.sup.10, for the antigen of interest. As another example, where the antibody is one that binds to IFN-, it will preferentially bind to IFN- as opposed to other antigens and/or extracellular components. As a further example, where the antibody is one that binds to IFN-, it may not significantly cross-react with other extracellular components. In embodiments, the extent of binding of the antibody to non-IFN- antigens and/or other extracellular components is less than about 10% (such as, e.g., 0% to about 9%), as determined by standard techniques known to those of ordinary skill in the art, such as, e.g., by flow cytometric analysis.
[0066] The terms interferon gamma and IFN- are synonyms that refer to a cytokine. IFN- is a member of the interferon family, which exhibits similar antiviral and anti-proliferative properties characteristic of interferons- and - (IFN- and IFN-). IFN- was originally discovered as a product induced upon mitogenic activation of lymphocytes. The recombinant production of human IFN- was first reported by Gray, Goeddel and co-workers (Gray et al., Nature 295:503-508, 1982), and is subject of U.S. Pat. Nos. 4,762,791, 4,929,544, 4,727,138, 4,925,793, 4,855,238, 5,582,824, 5,096,705, 5,574,137, and 5,595,888, each of which is hereby incorporated by reference in its entirety. The recombinant human IFN- of Gray and Goeddel as produced in E. coli consisted of 146 amino acids, the N-terminal position of the molecule commencing with the sequence CysTyrCys. It was later found that the native human IFN- (i.e., that arising from mitogen induction of human peripheral blood lymphocytes and subsequent purification) is a polypeptide that lacks the CysTyrCys N-terminus assigned by Gray et al., supra. The crystal structure of E. coli-derived recombinant human IFN- (rhIFN-) was determined (Ealick et al., Science 252:698-702, 1991), showing that the protein exists as a tightly intertwined non-covalent homodimer, in which the two identical polypeptide chains are oriented in an antiparallel manner. IFN- is known to exhibit a broad range of biological activities, including antitumor, antimicrobial and immunoregulatory activities. A particular form of recombinant human IFN- is commercially available as an immunomodulatory drug for the treatment of chronic granulomatous disease characterized by severe, recurrent infections of the skin, lymph nodes, liver, lungs, and bones due to phagocyte dysfunction (rhIFN--1b, Actimmune, Genentech, Inc. South San Francisco, Calif.). IFN- was subsequently approved for use in patients with severe, malignant osteopetrosis. IFN- may refer to IFN- of any species including both human and mouse IFN-.
[0067] The term bifunctional chelator refers to a chemical moiety that attaches an antibody to a radionuclide. Bifunctional chelators may include a chelator covalently attached to a first linking group. Bifunctional chelators may function by complexing metal ions with the chelator and by covalently attaching the chelator to an antibody with the first linking group, as is known to those of ordinary skill in the art. For example, bifunctional chelators may be covalently attached to a primary amine group, a hydroxyl group, and/or a cysteine amino acid of an antibody. Examples of suitable chelators include: 1,4,7-triazacyclononane-N,N,N-triacetic acid (i.e., NOTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (i.e., DOTA), ethylenediaminetetraacetic acid (i.e., EDTA), diethylenetriaminepentaacetic acid (i.e., DTPA; CAS Reg. No. 67-43-6), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (i.e., DOPA), N-{5-[Acetyl(hydroxy)amino]pentyl}-N-[5-({4-[(5-aminopentyl)(hydroxy)amino]-4-oxobutanoyl}amino)pentyl]-N-hydroxysuccinamide (i.e., deferoxamine or DFO; CAS Reg. No. 70-51-9), 2,2-(7-(1-carboxy-4-((2,5-dioxopyrrolidin-1-yl)oxy)-4-oxobutyl)-1,4,7-triazonane-1,4-diyl)diacetic acid (NODA), or a combination of any two or more thereof. Examples of suitable linking groups capable of attaching a chelator to a primary amine group, a hydroxyl group, and/or a cysteine amino acid of an antibody are known to those of skill in the art (see e.g., Denardo et al., 1998, Clin Cancer Res. 4(10):2483-90; Peterson et al., 1999, Bioconjug. Chem. 10(4):553-7; and Zimmerman et al., 1999, Nucl. Med. Biol. 26(8):943-50). Examples of suitable bifunctional chelators include 4-maleimidobutyramidobenzyl-DOTA (which can be prepared following the procedure of Axworthy et al (2000) Proc. Natl. Acad. Sci. USA 97(4):1802-1807), 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (i.e., MX-DTPA, see e.g., International Pub. No. WO 94/11026), p-SCN-Bn-Deferoxamine p-SCN-Bn-DFO), or a combination of any two or more thereof. (See also, US Patent Application Publication No. 2015/0017094, hereby incorporated by reference in its entirety). p-SCN-Bn-DFO has the following structure:
##STR00001##
[0068] With regard to antibodies, the term isolated refers to an antibody that has been identified and separated and/or recovered from at least one contaminant component of its natural environment. Contaminant components may be materials that would interfere with diagnostic and/or therapeutic uses for the antibody, such as, e.g., enzymes, hormones, and/or other proteinaceous or nonproteinaceous solutes. In embodiments, the isolated antibody will be purified to greater than about 95% (such as, e.g., about 96% to about 100%) by weight of antibody as determined by the Lowry method, or to greater than about 99% by weight of antibody.
[0069] The term monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, wherein the individual antibodies in the population are identical except for naturally occurring post-translational modifications. Monoclonal antibodies may be highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different antigenic determinants (such as, e.g., epitopes), each monoclonal antibody is directed against a single antigenic determinant on the antigen. Monoclonal antibodies may be synthesized. uncontaminated by other antibodies. While monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, it is not intended to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present disclosure may be prepared by the Kohler hybridoma method (see e.g., Kohler et al. (1975) Nature 256:495), or they may be prepared by recombinant DNA methods (see e.g., U.S. Pat. No. 4,816,567 and U.S. Pat. No. 5,807,715, each of which is hereby incorporated by reference in its entirety). Further, monoclonal antibodies may he isolated from phage antibody libraries using standard techniques (see e.g., Clackson et al. (1991) Nature, 352:624-628 and Marks et al, (1991) J. Mol. Biol., 222:581-597),
[0070] The terms antibody fragment and fragment refer to a portion of a full length antibody that includes a region capable of recognizing and binding to a specific antigen, such as, e.g., the antigen binding, variable, or hypervariable (also known as complementarity determining) region thereof. Examples of antibody fragments include Fab, Fab, F(ab).sub.2, F(ab).sub.2, Fv, sFv, and scFv fragments; diabodies; linear antibodies; minibodies (see e.g., Olafsen et al. (2004) Protein Eng. Design & Sel. 17(4):315-323), fragments produced by a Fab expression library, anti-idiotypic (hereinafter, anti-Id) antibodies, complementary determining region (hereinafter, CDR) and epitope-binding fragments of any of the above that immunospecifically recognize and bind to IFN-, single-chain antibody molecules, and multispecific antibodies formed from antibody fragments.
[0071] The term radiolabel refers to a radionuclide moiety that can be attached to an antibody and that functions to provide a detectable signal, such as, e.g., radionuclide tracers. Radionuclide tracers include radioisotopes, which by virtue of radioactive decay, are detectable. Radionuclide tracers may be detected by various imaging techniques, such as, e.g., PET and single-photon emission computed tomography (hereinafter, SPECT) imaging. In embodiments, radionuclide tracers have an energy of from about 20 to about 4,000 kiloelectronvolts (i.e., keV). Suitable radionuclide tracers include radionuclides that emit gamma radiation, positrons, or a combination of gamma radiation and positrons. In illustrative, non-limiting embodiments, radionuclide tracers have appropriate decay characteristics for optimizing image resolution and quantitative accuracy and/or have appropriate residualization. For example, radionuclide tracers may have a physical half-life (i.e., t.sub.1/2) compatible with the time required for the antibody to achieve optimal specie canon-specific binding ratios. Examples of radionuclide tracers suitable for PET imaging include .sup.11C (t.sub.1/220 min), .sup.13N (t.sub.1/210 min), .sup.15O (t.sub.1/22 min), .sup.18F (t.sub.1/21.83 h), .sup.44Sc (t.sub.1/23.97 11), .sup.45Ti (t.sub.1/23 h), .sup.52Mn (t.sub.1/25.6 days), .sup.64Cu (t.sub.1/212.7 h), .sup.68Ga (t.sub.1/21.13 h), .sup.76Br (t.sub.1/216.2 h), .sup.82Rb (t.sub.1/21.27 min), .sup.86Y (t.sub.1/214.7 h), .sup.89Zr (t.sub.1/278.4 h), .sup.124I (t.sub.1/2100.3 h), or a combination of any two or more thereof. Examples of radionuclide tracers suitable for SPECT imaging include .sup.99mTc (t.sub.1/26 h), .sup.11In (t.sub.1/22.80 days), .sup.131I (t.sub.1/28 days), .sup.177Lu (t.sub.1/26.64 days), .sup.186Re (t.sub.1/23.7186 days), or a combination of any two or more thereof.
[0072] The term therapeutic radionuclide refers to a radionuclide moiety that can be attached to an antibody that functions to deliver a cytotoxic dose of radiation, such as, e.g., a radionuclide therapeutic agent, to a target of interest, such as, e.g., a tumor. Suitable radionuclide therapeutic agents include radionuclides that emit beta particle radiation, alpha particle radiation, Auger electron radiation, or a combination of any two or more thereof. Examples of suitable radionuclide therapeutic agents include .sup.125I, .sup.131I, .sup.177Lu, .sup.186Re, .sup.225Ra, or a combination of any two or more thereof.
[0073] The term immunoimaging refers to imaging IFN- in vivo in a subject via detection of a labeled anti-IFN- antibody conjugate to produce an image indicative of the location and/or level of IFN- in the subject, wherein the location and/or level of IFN- in the subject is indicative of activated T cells.
[0074] Embodiments of the present disclosure are directed toward antibody conjugates, including labeled-antibody conjugates and therapeutic radionuclide-antibody conjugates, to methods for imaging, to mouse models, and to methods for assessing the effect of a composition or immune-mediated treatment for cancer, injury or infection, particularly human cancer, human injury or human infection.
[0075] I. Antibody Conjugates
[0076] In one or more embodiments, the disclosure relates to antibody conjugates. In embodiments, antibody conjugates include both labeled-antibody conjugates and therapeutic radionuclide-antibody conjugates. In embodiments, labeled-antibody conjugates include an antibody that specifically recognizes and binds to IFN-, and at least one detection label conjugated to the antibody, wherein the at least one detection label includes a radionuclide tracer.
[0077] Suitable antibodies that specifically recognize and bind to IFN may be prepared by standard techniques known to those of ordinary skill in the art. In embodiments, the antibody is an isolated antibody. In embodiments, the antibody is selected from a monoclonal antibody, an antibody fragment, or combination thereof. In embodiments, the antibody is a monoclonal antibody expressed by a hybridoma cell line or by CHO cells, NS0 cells, Sp2/0 cells, HEK cells, BHK cells, or PER.C6 cells.
[0078] In embodiments, the antibody is an antibody fragment. In further embodiments, the antibody is a Fab fragment. Antibody fragments that recognize specific epitopes can be produced by standard techniques known to those of ordinary skill in the art. For example, F(ab).sub.2 fragments can be produced by pepsin digestion of the antibody molecule. (See e.g., U.S. Pat. Nos. 4,036,945 and 4,331,647 and references contained therein; see also Nisonoff et al,, Arch Biochem. Biophys. 89:230 (1960); Porter, Biochem. J. 73:119 (1959), Edelman et al., in Methods in Enzymology Vol. 1, page 422 (Academic Press 1967), and Coligan et al. Current Protocols in Immunology, Vol. 1, pages 2.8.1-2.8.10 and 2.10.-2.10.4 (John Wiley & Sons 1991)). Alternatively, Fab expression libraries can be constructed (see e.g., Huse et al., 1989, Science, 246:1274-1281) to allow rapid and easy identification of monoclonal Fab fragments with desired specificity.
[0079] In embodiments, a single chain Fv molecule (i.e., scFv) includes a V.sub.L domain and a V.sub.H domain. The V.sub.L and V.sub.H domains may associate to form a target binding site. In embodiments, V.sub.L and V.sub.H domains are covalently linked by a peptide linker (i.e., L). In embodiments, a scFv molecule is denoted as either V.sub.L-L-V.sub.H if the V.sub.L domain is the N-terminal part of the scFv molecule, or as V.sub.H-L-V.sub.L if the V.sub.H domain is the N-terminal part of the scFv molecule. scFv molecules can be produced by standard techniques known to those of ordinary skill in the art. (See U.S. Pat. Nos. 4,704,692, 4,946,778, R. Raag and. M. Whitlow, Single Chain Fvs. FASEB Vol 9:73-80 (1995) and R. E. Bird and B. W. Walker, Single Chain Antibody Variable Regions, TIBTECH, Vol 9:132-137 (1991)).
[0080] Other antibody fragments, such as, e.g., single domain antibody fragments, are also known to those of ordinary skill in the art. Single domain antibodies (i.e., V.sub.HH) may be obtained, for example, from camels, alpacas or llamas by standard immunization techniques known to those of ordinary skill in the art. (See, e.g., Muyldermans et al., TIBS 26:230-235, 2001; Yau et al., J Immunol Methods 281:161-75, 2003; Maass et al., J Immunol Methods 324:13-25, 2007). In embodiments, the V.sub.HH has potent antigen-binding capacity and can interact with novel epitopes that may be inaccessible to conventional V.sub.H-V.sub.L pairs. (See e.g., Muyldermans et al., 2001). In embodiments, alpaca serum IgG contains about 50% camel heavy chain only IgG antibodies (i.e., HCAbs) (see e.g., Maass et al., 2007). In embodiments, alpacas may be immunized with known antigens, such as, e.g., TNF-, and V.sub.HH's can be isolated that bind to and neutralize the target antigen (see e.g., Maass et al., 2007). PCR primers that amplify virtually all alpaca V.sub.HH coding sequences have been identified and may be used to construct alpaca V.sub.HH phage display libraries, which can be used for antibody fragment isolation by standard biopanning techniques well known to those of ordinary skill in the art. (See Maass et al., 2007).
[0081] In embodiments, an antibody fragment is produced by proteolytic hydrolysis of a full-length antibody and/or by expression in E. coli, CHO cells, or another host of DNA coding for the antibody fragment. In embodiments, antibody fragments can be obtained by pepsin or papain digestion of full-length antibodies by standard techniques known to those of ordinary skill in the art. For example, an antibody fragment can be produced by enzymatic cleavage of antibodies with pepsin to provide an 100 kDa fragment denoted F(ab)2. This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce a 50 kDa Fab monovalent fragment. In alternative embodiments, an enzymatic cleavage using papain produces two monovalent Fab fragments and an Fc fragment directly.
[0082] In embodiments, antibody fragments may include peptides coding for a single complementary determining region (i.e., CDR). In embodiments, a CDR is a segment of the variable region of an antibody that is complementary in structure to the epitope to which the antibody binds and is more variable than the rest of the variable region. Accordingly, in embodiments, a CDR is referred to as a hypervariable region. In embodiments, a variable region includes three CDRs. In embodiments, CDR peptides can be produced by constructing genes encoding the CDR of an antibody of interest. Such genes may be prepared, for example, by using the polymerase chain reaction (i.e., PCR) to synthesize the variable region from RNA of antibody-producing cells. (See e.g., Larrick et al., Methods: A Companion to Methods in Enzymology 2:106 (1991); Courtenay-Luck, Genetic Manipulation of Monoclonal Antibodies, in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al. (eds), pages 166-179 (Cambridge University Press 1995); and Ward et al., Genetic Manipulation and Expression of Antibodies, in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), pages 137-185 (Wiley-Liss, Inc. 1995).
[0083] According to embodiments, the antibody conjugate is an anti-IFN- diabody that specifically recognizes and binds to IFN-. A diabody included in a labeled-antibody conjugate is a noncovalent dimer of single-chain Fv (scFv) fragment that has the heavy chain variable (V.sub.H) and light chain variable (V.sub.L) regions connected by a linker, such as a peptide linker. According to embodiments, the diabody includes heavy chain variable region (V.sub.H) having the amino acid sequence disclosed herein as SEQ ID NO:11 and light chain variable region (V.sub.L) having the amino acid sequence disclosed herein as SEQ ID NO:12. The linker used is too short to allow pairing between the two domains on the same chain, such that the linked V.sub.H-V.sub.L domains are forced to pair with complementary domains of another chain, creating two antigen-binding sites. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90: 6444-6448 (1993). An exemplary linker is SGGGGS (SEQ ID NO:13). According to embodiments, an scFv included in an anti-IFN- diabody that specifically recognizes and binds to IFN- has SEQ ID NO:14. According to embodiments, an scFv included in an anti-IFN- diabody that specifically recognizes and binds to IFN- has SEQ ID NO:15.
[0084] Variants of the scFv of SEQ ID NO:14 and/or SEQ ID NO:15 can also be included in an anti-IFN- diabody in labeled-antibody conjugate according to embodiments.
[0085] A functional variant of the scFv of SEQ ID NO:14 has at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity with the amino acid sequence set forth in SEQ ID NO:14 wherein the diabody including the variant or variants specifically recognizes and binds to IFN-.
[0086] A functional variant of the scFv of SEQ ID NO:15 has at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity with the amino acid sequence set forth in SEQ ID NO:15 wherein the diabody including the variant or variants specifically recognizes and binds to IFN-.
[0087] The diabody including say of SEQ NO:14 and/or SEQ ID NO:15 or a variant of either thereof can be isolated or generated recombinantly or synthetically.
[0088] Mutations can be introduced using standard molecular biology techniques such as site-directed mutagenesis and PCR-mediated mutagenesis to produce a diabody including a variant of the scFv SEQ ID NO:14 and/or SEQ ID NO:15. One of skill in the art will recognize that one or more amino acid mutations can be introduced without altering the functional properties of the diabody.
[0089] Variants of the diabody V.sub.H and V.sub.L domains of SEQ ID NO:11 and SEQ ID can also be included in a labeled-antibody conjugate according to embodiments.
[0090] A functional variant of the diabody V.sub.H and V.sub.L domains of SEQ ID NO:11 and SEQ ID NO:12 has at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity with the amino acid sequences set forth in SEQ ID NO:11 and SEQ ID NO:12 wherein the diabody including the variant or variants specifically recognizes and binds to IFN-.
[0091] The diabody including V.sub.H and V.sub.L domains of SEQ ID NO:11 and SEQ ID NO:12 or a variant of either thereof can be isolated or generated recombinantly or synthetically.
[0092] Mutations can be introduced using standard molecular biology techniques such as site-directed mutagenesis and PCR-mediated mutagenesis to produce a diabody including a variant of V.sub.H and V.sub.L domains of SEQ ID NO:11 and SEQ ID NO:12. One of skill in the art will recognize that one or more amino acid mutations can be introduced without altering the functional properties of the diabody.
[0093] Conservative amino acid substitutions can be made in the diabody sequences of SEQ ID NO:11, SEQ ID NO:12, and/or SEQ ID NO:14, to produce functional variants. Conservative amino acid substitutions are art recognized substitutions of one amino acid for another amino acid having similar characteristics. For example, each amino acid can be described as having one or more of the following characteristics: electropositive, electronegative, aliphatic, aromatic, polar, hydrophobic, and hydrophilic. A conservative substitution is a substitution of one amino acid having a specified structural or functional characteristic for another amino acid having the same characteristic. Acidic amino acids include aspartate, glutamate; basic amino acids include histidine, lysine, arginine; aliphatic amino acids include isoleucine, leucine, and valine; aromatic amino acids include phenylalanine, tyrosine, and tryptophan; polar amino acids include aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, serine, threonine, and tyrosine; and hydrophobic amino acids include alanine, cysteine, phenylalanine, glycine, isoleucine, leucine, methionine, proline, valine, and tryptophan; and conservative substitutions include substitutions among amino acids within each group. Amino acids can also be described in terms of steric effects or relative size, e.g., alanine, cysteine, aspartate, glycine, asparagine, proline, threonine, serine, and valine are all typically considered to be small.
[0094] To determine the percent identity of two amino acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in a first amino acid or nucleotide sequence for optimal alignment with a second amino acid or nucleotide sequence using the default parameters of an alignment software program). The amino acids at corresponding amino acid positions are then compared. When a position in the first sequence is occupied by the same amino acid as the corresponding position in the second sequence, then the sequences are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=number of identical aligned positionstotal number of aligned positions.Math.100%). In some embodiments, the two sequences have the same length.
[0095] The determination of percent identity between two sequences can be accomplished using a mathematical algorithm. A non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, PNAS USA 87:2264-68, e.g., as modified as in Karlin and Altschul, 1993, PNAS USA 90:5873-77. In calculating percent identity, only exact matches are typically counted.
[0096] Other methods of cleaving antibodies, such as, e.g., separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical or genetic techniques may also be used, so long as the antibody fragments specifically bind to the antigen that is recognized by the intact antibody.
[0097] The detection label or radionuclide therapeutic agent is conjugated directly, or indirectly, to the antibody to produce an antibody conjugate. Suitable linkers, chelating agents and methods of use for conjugation of a detection label or radionuclide therapeutic agent to an antibody are well-known in the art, see for example, Shan S. Wong et al., Chemistry of Protein and Nucleic Acid Cross-Linking and Conjugation, Second Edition, CRC Press, 2011.
[0098] According to aspects of the present disclosure, an antibody conjugate is an imaging agent which can be used in diagnostic procedures as well as for localization of activated T cells. Imaging can be performed by many procedures well-known to those having ordinary skill in the art, for example, by positron emission tomography (PET), single photon emission computed tomography (SPECT), Cerenkov imaging, photoacoustic imaging, ultrasound imaging, optical coherent tomography, optical imaging, including fluorescence imaging, and/or bioluminescence imaging, or a combination of any two or more thereof.
[0099] In embodiments, the labeled-antibody conjugates include at least one detection label conjugated to the antibody, wherein the at least one detection label includes a radionuclide tracer. In embodiments, the at least one detection label is a combination of a radionuclide tracer and a fluorophore.
[0100] In embodiments, the radionuclide tracer is selected from .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.44Sc, .sup.45Ti, .sup.52Mn, .sup.64Cu, .sup.68Ga, .sup.76Br, .sup.82Rb, .sup.86Y, .sup.89Zr, .sup.99mTc, .sup.11In, .sup.124I, .sup.131I, .sup.186Re, .sup.43K, .sup.52Fe, .sup.57Co, .sup.67Cu, .sup.67Ga, .sup.77Br, .sup.81Rb, .sup.81mKr, .sup.87mSr, .sup.89Zr, .sup.113mIn, .sup.123I, .sup.125I, .sup.127Cs, .sup.129Cs, .sup.132I, .sup.177Lu, .sup.186Re, .sup.197Hg, .sup.203Pb, .sup.206Bi, .sup.225Ac, .sup.225Ra, or combination of any two or more thereof. In illustrative, non-limiting embodiments, the radionuclide tracer is .sup.89Zr.
[0101] In embodiments wherein the detection label is a radionuclide tracer, the radionuclide tracer is optionally conjugated to the antibody with a bifunctional chelator. In embodiments wherein the radionuclide tracer is .sup.11C, .sup.13N, .sup.18F, .sup.76Br, .sup.123I, .sup.124I, or .sup.125I, a bifunctional chelator is not required for conjugation to the antibody wherein .sup.11C, .sup.13N, .sup.18F, .sup.76Br, .sup.123I, .sup.124I, or .sup.125I, or can be directly conjugated to the antibody with standard techniques known to those of ordinary skill in the art. In embodiments, the bifunctional chelator includes a chelator attached to a first linking group. Suitable chelators and first linking groups are known to those of ordinary skill in the art. In embodiments, the bifunctional chelator includes a chelator selected from DFO, NOTA, DOTA, EDTA, DOPA, DTPA, NODA, or a combination of any two or more thereof. In illustrative, non-limiting embodiments, the bifunctional chelator is p-SCN-Bn-DFO.
[0102] In embodiments, the bifunctional chelator is attached to the antibody. In further embodiments, the radionuclide tracer is complexed to the bifunctional chelator, wherein the bifunctional chelator is covalently attached to the antibody. In embodiments, the bifunctional chelator is attached to the antibody by reacting the bifunctional chelator with the antibody by standard techniques known to those of ordinary skill in the art. In embodiments, an ion of the radionuclide tracer is complexed to the bifunctional chelator by standard techniques known to those of ordinary skill in the art. In illustrative, non-limiting embodiments, (1) the bifunctional chelator p-SCN-Bn-DFO is reacted with the anti-IFN- antibody at a ratio of about 5:1 in saline solution at a pH9 for about 1 hour at about 37 C. for covalent attachment thereof; and (2) the radionuclide tracer .sup.89 is reacted with the bifunctional chelator p-SCN-Bn-DFO covalently attached to the antibody at a pH7.0-7.2 for about 1 hour at room temperature to form a radiolabeled-antibody conjugate.
[0103] In embodiments, the labeled-antibody conjugates include at least one detection label conjugated to the antibody, wherein the at least one detection label includes a radionuclide tracer. In embodiments, the at least one detection label also includes a fluorophore. In embodiments, the fluorophore is a fluorescent dye. In embodiments, the fluorophore emits fluorescence in the visible (i.e., 400-700 nm) or near-infrared (i.e., 700-1400 nm) region.
[0104] In embodiments, the antibody conjugates include therapeutic radionuclide-antibody conjugates. In embodiments, therapeutic radionuclide-antibody conjugates include an antibody that specifically recognizes and binds IFN-, a bifunctional chelator conjugated to the antibody, and a radionuclide therapeutic agent complexed to the bifunctional chelator. In embodiments, the antibody is as described herein with regard to labeled-antibody conjugates. Additionally, in embodiments, the bifunctional chelator is as described herein with regard to labeled-antibody conjugates.
[0105] In embodiments, the therapeutic radionuclide-antibody conjugate includes a radionuclide therapeutic agent complexed to the bifunctional chelator. In embodiments, the radionuclide therapeutic agent is selected from .sup.125I, .sup.131I, .sup.177Lu, .sup.186Re, .sup.225Ac, .sup.225Ra, or a combination of any two or more thereof. In embodiments, the bifunctional chelator is attached to the antibody. In further embodiments, the radionuclide therapeutic agent is complexed to the bifunctional chelator, wherein the bifunctional chelator is covalently attached to the antibody. In embodiments, the bifunctional chelator is attached to the antibody by reacting the bifunctional chelator with the antibody. Then, in embodiments, an ion of the radionuclide therapeutic agent is complexed to the bifunctional chelator.
[0106] In embodiments, the therapeutic radionuclide-antibody conjugate includes a labeled-antibody conjugate attached to a therapeutic moiety. The therapeutic moiety can be, without limitation, a small molecule drug, an oligonucleotide or polynucleotide, such as an antisense oligonucleotide or polynucleotide, an siRNA, an mRNA, an miRNA, an shRNA, a peptide or protein. According to embodiments, a therapeutic moiety is attached to, enclosed in or partially enclosed in, a particle.
[0107] An included particle can be selected from among a lipid particle; a polymer particle; an inorganic particle; and an inorganic/organic particle. A mixture of particle types can also be included. The particles can be of any shape, size, composition, or physiochemical characteristics compatible with administration to a subject. The particles can be organic or inorganic particles, such as glass or metal and can be particles of a synthetic or naturally occurring polymer, such as polystyrene, polycarbonate, silicon, nylon, cellulose, agarose, dextran, and polyacrylamide.
[0108] In particular aspects, the particle is a lipid particle including, but not limited to, liposomes, micelles, unilamellar or multilamellar vesicles; polymer particles such as hydrogel particles, polyglycolic acid particles or polylactic acid particles; inorganic particles such as calcium phosphate particles such as described in for example U.S. Pat. No. 5,648,097; and inorganic/organic particulate carriers such as described for example in U.S. Pat. No. 6,630,486. Further description of liposomes and methods relating to their preparation and use may be found in Liposomes: A Practical Approach (The Practical Approach Series, 264), V. P. Torchilin and V. Weissig (Eds.), Oxford University Press; 2nd ed., 2003.
[0109] An included particle is typically formulated such that the particle has a diameter, or longest dimension, in the range of about 1 nm-10 microns. In particular aspects, an included particle is a nanoparticle, formulated such that the nanoparticle has a diameter, or longest dimension, in the range of about 1 nm-about 1000 nm. Further aspects of nanoparticles are described in S. M. Moghimi et al., FASEB J. 2005, 19, 311-30; Choi, et al., Mol Imaging. 2010 December; 9(6): 291-310; and Bogart et al., ACS Nano, 2014, 8 (4), pp 3107-3122.
[0110] II. Methods for Imaging
[0111] In one or more embodiments, the disclosure discloses methods for imaging. In embodiments, methods for imaging include: (a) administering a labeled-antibody conjugate to a subject, wherein the labeled-antibody conjugate includes: an antibody that specifically recognizes and binds to IFN-, and at least one detection label conjugated to the antibody, wherein the at least one detection label includes a radionuclide tracer; and (b) detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging. In embodiments, the labeled-antibody conjugate is as described herein with regard to antibody conjugates. In further embodiments, the antibody and the at least one detection label are as described herein with regard to antibody conjugates.
[0112] In embodiments, the methods include administering a labeled-antibody conjugate to a subject. In embodiments, the methods include administering an effective amount of a labeled-antibody conjugate to a subject. The labeled-antibody conjugate may be administered by any suitable route known to those of ordinary skill in the art. In embodiments, administration of the labeled-antibody conjugate is by intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intrapleural, intrathecal, intratumoral, perfusion through a regional catheter, and/or direct intralesional injection. In embodiments wherein the labeled-antibody conjugate is administered by injection, the administration may be by continuous infusion, by single bolus, and/or by multiple boluses. In some embodiments, administering the radiolabeled-antibody conjugate is non-immunogenic to the subject. In embodiments, the subject is a mammal. In some embodiments, the subject is a mammal selected from humans, non-human primates, canines, felines, murines, bovines, equines, ovines, porcines, and lagomorphs. In illustrative, non-limiting embodiments, the subject is a mouse or a human.
[0113] In embodiments, the labeled-antibody conjugate administered to a subject includes a radionuclide tracer. In some embodiments, the labeled-antibody conjugate administered to a subject includes a radionuclide tracer only, i.e. without a fluorophore.
[0114] In embodiments, the radionuclide tracer is selected from .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.44Sc, .sup.45Ti, .sup.52Mn, .sup.64Cu, .sup.68Ga, .sup.76Br, .sup.82Rb, .sup.86Y, .sup.89Zr, .sup.99mTc, .sup.111In, .sup.124I, .sup.131I, .sup.186Re, .sup.43K, .sup.52Fe, .sup.57Co, .sup.67Cu, .sup.77Br, .sup.81Rb, .sup.81mKr, .sup.87mSr, .sup.89Zr, .sup.113mIn, .sup.123I, .sup.125I, .sup.127Cs, .sup.129Cs, .sup.132I, .sup.177Lu, .sup.186Re, .sup.197Hg, .sup.203Pb, .sup.206Bi, .sup.225Ac, .sup.225Ra, or combination of any two or more thereof.
[0115] In illustrative, non-limiting embodiments, the radionuclide tracer is .sup.89Zr.
[0116] In alternative embodiments, the labeled-antibody conjugate administered to a subject includes a fluorophore. In embodiments, the fluorophore is a fluorescent dye.
[0117] In embodiments, the methods for imaging include detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging. In embodiments, the presence of the labeled-antibody conjugate is detected in real time. In embodiments, the presence of the labeled-antibody conjugate is detected non-invasively and/or minimally-invasively.
[0118] In embodiments wherein the labeled-antibody conjugate includes a radionuclide tracer, the presence of the labeled-antibody conjugate may be detected in vivo by PET imaging, SPECT imaging, or combination thereof. In embodiments wherein the radionuclide tracer is selected from .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.64Cu, .sup.68Ga, .sup.76Br, .sup.82Rb, .sup.86Y, .sup.89Zr, .sup.124I, or a combination of any two or more thereof, the presence of the labeled-antibody conjugate may be detected in vivo by PET imaging. In embodiments wherein the radionuclide tracer is selected from .sup.99mTc, .sup.111In, .sup.131I, .sup.186Re, or a combination of any two or more thereof, the presence of the labeled-antibody conjugate may be detected in vivo by SPECT imaging.
[0119] In embodiments wherein the labeled antibody conjugate includes a fluorophore, the presence of the labeled-antibody conjugate may be detected in vivo by optical imaging. Various in vivo optical imaging techniques are known to those of ordinary skill in the art. (See e.g., Ntziachristos, Annu. Rev. Biomed. Eng. 2006, 8:1-33; Troyan, S. L. et al., Ann. Surg. Oncol. 16, 2943-2952 (2009); Luker, G. D. & Luker, K. E., J. Nucl. Med. 49, 1-4 (2008); Tromberg, B. J. et al. Med. Phys. 35, 2443-2451 (2008), and their potential applicability to imaging-guided diagnostic and surgical methods has been proposed in several preclinical studies; Kirsch, D. G. et al., Nat. Med. 13, 992-997 (2007); von Burstin, J. et al., Int. J. Cancer 123, 2138-2147 (2008); and U.S. Pat. No. 9,409,923). In embodiments, in vivo optical imaging is selected from confocal microscopy, planar imaging, fluorescence molecular tomography, complete projection tomography, fluorescence tomography direct imaging, two-photon in vivo imaging or a combination of any two or more thereof. In further embodiments, planar imaging is selected from epi-illumination (i.e., photographic) imaging, trans-illumination imaging, tomographic imaging, or a combination of any two or more thereof.
[0120] In embodiments wherein the presence of the labeled-antibody conjugate is detected by in vivo optical imaging, the fluorophore may be selected such that it emits fluorescence in the visible or near-infrared region. In illustrative, non-limiting embodiments, fluorophores emitting fluorescence in the visible or near-infrared region may be selected from fluorescein, Cy2, Cy3, Cy3B, Cy3.5, Cy5, Cy5.5, Cy7, Texas Red (Molecular Probes, Inc., Eugene, Oreg.), AlexaFluor (Molecular Probes, Inc., Eugene), AlexaFluor 350, AlexaFluor 405, AlexaFluor 430, AlexaFluor 488, AlexaFluor 500, AlexaFluor 532, AlexaFluor 546, AlexaFluor 568, AlexaFluor 594, AlexaFluor 610, AlexaFluor 633, AlexaFluor 647, AlexaFluor 660, AlexaFluor 680, AlexaFluor 700, AlexaFluor 750, BODIPY FL, BODIPY R6G, BODIPY TMR, BODIPY 530/550, BODIPY 558/568, BODIPY 564/570, BODIPY 576/589, BODIPY 581/591, BODIPY 630/650, BODIPY 650/665, Rhodamine Green-X (Molecular Probes, Inc.), Rhodamine Red-X (Molecular Probes, Inc.), Rhodamine 6G, TMR, TAMRA (Applied Biosystems), or a combination of any two or more thereof.
[0121] In embodiments the presence of the labeled-antibody conjugate is detected by in vivo photoacoustic imaging. In illustrative, non-limiting embodiments, photoacoustic dyes included in the conjugate may be selected from Methylene blue, Evan's blue, Trypan blue, Patent blue, Indocyanine Green, IRDye800CW, DiR, Cy7, Cy7.5, and porphyrins or a combination of any two or more thereof.
[0122] In embodiments wherein the labeled antibody conjugate includes a combination of a radionuclide tracer and a fluorophore, the presence of the labeled-antibody conjugate may be detected in vivo by a combination of PET or SPECT and optical imaging.
[0123] In embodiments wherein the labeled antibody conjugate includes a combination of a radionuclide tracer and a fluorophore, the presence of the labeled-antibody conjugate may be detected in vivo by a combination of PET or SPECT and photoacoustic imaging.
[0124] In embodiments the presence of the labeled-antibody conjugate may be detected in vivo by a combination of any two or more of: PET, SPECT, Cerenkov imaging, photoacoustic imaging, ultrasound imaging, optical coherent tomography, optical imaging, including fluorescence imaging, and/or bioluminescence imaging.
[0125] According to embodiments, a method for imaging a subject includes 1) administering a labeled-antibody conjugate to a subject, wherein the labeled-antibody conjugate includes: an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and 2) detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging. According to particular embodiments, the subject has cancer. According to particular embodiments, the cancer is bladder cancer, brain tumors, breast cancer, cervical cancer, colorectal cancer, kidney cancer, leukemia, lung cancer, melanoma, myeloma, pancreatic cancer, gastric cancer, intestinal cancer, esophageal cancer, mesothelioma cancer, endometrial cancer, ovarian cancer, head and neck cancer, bone cancer, sarcoma, cholangiocarcinoma, gall bladder cancer, testicular cancer, thyroid cancer, or prostate cancer.
[0126] According to particular embodiments, the subject has an inflammatory condition or a disease associated with inflammation, such as, but not limited to, infection, tissue injury, Alzheimer's disease, obesity, stroke, heart attack, Hepatitis C, and Crohn's disease.
[0127] Combination Treatments
[0128] Combinations of a labeled-antibody conjugate and at least one therapeutic agent are administered according to aspects of the present invention. In some embodiments, a labeled-antibody conjugate and at least one additional active agent are administered to a subject to treat cancer in a subject in need thereof. In still further aspects, a labeled-antibody conjugate and at least two additional active agents are administered to a subject to treat cancer in a subject in need thereof.
[0129] The term additional active agent is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule (such as a nucleic acid, an antibody, a protein or portion thereof, e.g., a peptide). The additional active agent can be, without limitation, a small molecule drug, an oligonucleotide or polynucleotide, such as an antisense oligonucleotide or polynucleotide, an siRNA, an mRNA, an miRNA, an shRNA, a peptide or protein. An additional active agent can be a therapeutic agent or a diagnostic agent according to embodiments.
[0130] Additional active agents which are therapeutic agents included in aspects of methods and compositions of the present invention include, but are not limited to, antibiotics, antivirals, antineoplastic agents, analgesics, antipyretics, antidepressants, antipsychotics, anti-cancer agents, antihistamines, anti-osteoporosis agents, anti-osteonecrosis agents, antiinflammatory agents, anxiolytics, chemotherapeutic agents, diuretics, growth factors, hormones, non-steroidal anti-inflammatory agents, steroids and vasoactive agents.
[0131] According to embodiments, combination treatments include: (1) administration of pharmaceutical compositions that include a labeled antibody conjugate in combination with one or more additional active agents; (2) co-administration of a labeled antibody conjugate with one or more additional active agents wherein the labeled antibody conjugate and the one or more additional active agents are formulated in the same composition and (3) co-administration of a labeled antibody conjugate with one or more additional active agents wherein the labeled antibody conjugate and the one or more additional therapeutic agents have not been formulated in the same composition. When using separate formulations, the labeled antibody conjugate and the one or more additional active agents may be administered at the same time or at different times.
[0132] An adjunct anti-cancer treatment can be administered in combination with a labeled antibody conjugate, such as prior to, simultaneous with or after administration of the labeled antibody conjugate, such as an anti-cancer radiation treatment of a subject or an affected area of a subject's body.
[0133] An additional active agent can be an anti-cancer agent according to embodiments, such as a targeted therapy agent or chemotherapeutic.
[0134] Anti-cancer agents are described, for example, in Goodman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 8th Ed., Macmillan Publishing Co., 1990.
[0135] Anti-cancer agents illustratively include acivicin, aclarubicin, acodazole, acronine, adozelesin, aldesleukin, alitretinoin, allopurinol, altretamine, ambomycin, ametantrone, amifostine, aminoglutethimide, amsacrine, anastrozole, anthramycin, arsenic trioxide, asparaginase, asperlin, azacitidine, azetepa, azotomycin, batimastat, benzodepa, bicalutamide, bisantrene, bisnafide dimesylate, bizelesin, bleomycin, brequinar, bropirimine, busulfan, cactinomycin, calusterone, capecitabine, caracemide, carbetimer, carboplatin, carmustine, carubicin, carzelesin, cedefingol, celecoxib, chlorambucil, cirolemycin, cisplatin, cladribine, crisnatol mesylate, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, daunorubicin, decitabine, dexormaplatin, dezaguanine, dezaguanine mesylate, diaziquone, docetaxel, doxorubicin, droloxifene, dromostanolone, duazomycin, edatrexate, eflornithine, elsamitrucin, enloplatin, enpromate, epipropidine, epirubicin, erbulozole, esorubicin, estramustine, etanidazole, etoposide, etoprine, fadrozole, fazarabine, fenretinide, floxuridine, fludarabine, fluorouracil, flurocitabine, fosquidone, fostriecin, fulvestrant, gemcitabine, hydroxyurea, idarubicin, ifosfamide, ilmofosine, interleukin II (IL-2, including recombinant interleukin II or rIL2), interferon alfa-2a, interferon alfa-2b, interferon alfa-n1, interferon alfa-n3, interferon beta-interferon gamma-Ib, iproplatin, irinotecan, lanreotide, letrozole, leuprolide, liarozole, lometrexol, lomustine, losoxantrone, masoprocol, maytansine, mechlorethamine hydrochloride, megestrol, melengestrol acetate, melphalan, menogaril, mercaptopurine, methotrexate, metoprine, meturedepa, mitindomide, mitocarcin, mitocromin, mitogillin, mitomalcin, mitomycin, mitosper, mitotane, mitoxantrone, mycophenolic acid, nelarabine, nocodazole, nogalamycin, ormnaplatin, oxisuran, paclitaxel, pegaspargase, peliomycin, pentamustine, peplomycin, perfosfamide, pipobroman, piposulfan, piroxantrone hydrochloride, plicamycin, plomestane, porfimer, porfiromycin, prednimustine, procarbazine, puromycin, pyrazofurin, ribopiine, rogletimide, safingol, semustine, simtrazene sparfosate, sparsomycin, spirogermanium, spiromustine, spiroplatin, streptonigrin, streptozocin, sulofenur, talisomycin, tamoxifen, tecogalan, tegafur, teloxantrone, temoporfin, teniposide, teroxirone, testolactone, thiamiprine, thioguanine, thiotepa, tiazofurin, tirapazamine, topotecan, toremifene, trestolone, triciribine, trimetrexate, triptorelin, tubulozole, uracil mustard, uredepa, vapreotide, verteporfin, vinblastine, vincristine sulfate, vindesine, vinepidine, vinglycinate, vinleurosine, vinorelbine, vinrosidine, vinzolidine, vorozole, zeniplatin, zinostatin, zoledronate, and zorubicin.
[0136] According to embodiments, the additional active agent is an anti-cancer immunotherapy agent. According to embodiments, the anti-cancer immunotherapy agent is an immune checkpoint inhibitor, a cytokine, a vaccine, an adoptive cell transfer therapy, or any therapeutic wherein the mechanism of action of the therapeutic is an increased number of tumor-infiltrating lymphocytes in the subject and/or an increased activation state of a tumor-infiltrating lymphocyte population in the subject. According to embodiments, the immune checkpoint inhibitor is a PD-1 inhibitor, PD-L1 inhibitor, or CTLA-4 inhibitor. According to embodiments, the immune checkpoint inhibitor selected from atezolizumab, avelumab, durvalumab, ipilimumab, nivolumab, pembrolizumab, and an antigen-binding fragment of any one of the foregoing. According to embodiments, the subject is human and the antibody specifically binds to human IFN-.
[0137] According to embodiments, an anti-cancer immunotherapy agent is administered to a subject and a labeled antibody conjugate is administered simultaneously or subsequently followed by detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging to image IFN- and thereby monitor the effectiveness of the treatment with the anti-cancer immunotherapy agent. According to embodiments, the subject received an anti-cancer immunotherapy prior to administering and detecting the presence of the labeled-antibody conjugate, and wherein the mechanism of action of the immunotherapy results in an increased number of tumor-infiltrating lymphocytes in the subject and/or an increased activation state of a tumor-infiltrating lymphocyte population in the subject; or wherein administering and detecting the presence of the labeled-antibody conjugate is performed prior to administration of a therapy to determine the state of active immunity in the subject. Thus, efficacy of the anti-cancer immunotherapy is monitored non-invasively and in real-time in the subject.
[0138] In embodiments, significant binding of the labeled-antibody conjugate to the IFN- antigen indicates the presence of activated lymphocytes and/or human cancer cells. In embodiments, significant binding of the labeled-antibody conjugate to the antigen indicates the presence of a localized immune response in the subject. In embodiments, PET imaging is quantitative wherein a correlation is determined between uptake of the radionuclide tracer quantified by radioactivity measurements of excised tissues and uptake estimated noninvasively by PET. Thus, efficacy of the anti-cancer immunotherapy is monitored non-invasively and in real-time in the subject.
[0139] According to embodiments, an anti-inflammation immunotherapy agent is administered to a subject and a labeled antibody conjugate is administered simultaneously or subsequently followed by detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging to image IFN- and thereby monitor the effectiveness of the treatment with the anti-inflammation immunotherapy agent. According to embodiments, the subject received an anti-inflammation immunotherapy prior to administering and detecting the presence of the labeled-antibody conjugate, and wherein the mechanism of action of the immunotherapy results in an increased number of activated lymphocytes in the subject and/or an increased activation state of an activated lymphocyte population in the subject; or wherein administering and detecting the presence of the labeled-antibody conjugate is performed prior to administration of a therapy to determine the state of active immunity in the subject. Thus, efficacy of the anti-inflammation immunotherapy is monitored non-invasively and in real-time in the subject.
[0140] In embodiments, significant binding of the labeled-antibody conjugate to the IFN- antigen indicates the presence of activated lymphocytes. In embodiments, significant binding of the labeled-antibody conjugate to the IFN- antigen indicates the presence of a localized immune response in the subject. In embodiments, PET imaging is quantitative wherein a correlation is determined between uptake of the radionuclide tracer quantified by radioactivity measurements of excised tissues and uptake estimated noninvasively by PET. In embodiments, PET imaging is quantitative wherein uptake of the radionuclide tracer is quantified by analysis of acquired images. Thus, efficacy of the anti-inflammation immunotherapy is monitored non-invasively and in real-time in the subject.
[0141] According to embodiments, methods for imaging a subject include administering a labeled-antibody conjugate to a subject, wherein the labeled-antibody conjugate comprises: an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging.
[0142] According to embodiments, a labeled-antibody conjugate is administered to a subject prior to immunotherapy treatment, wherein the labeled-antibody conjugate includes an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and the presence of the labeled-antibody conjugate in the subject is detected in vivo by imaging to establish a baseline reading indicative of a baseline level of IFN- to determine the state of active immunity in the subject. An immunotherapy is then administered wherein the mechanism of action of the immunotherapy results in an increased number of activated lymphocytes in the subject and/or an increased activation state of an activated lymphocyte population in the subject. The labeled-antibody conjugate is then administered to a subject again after the administration of the immunotherapy to establish a post-treatment reading indicative of a subsequent level of IFN- to determine the state of active immunity in the subject. The steps of administration of the immunotherapy and administration/detection of the labeled-antibody conjugate may be performed 2, 3, 4, 5, 6, 7, 8, 9, 10, or more times, over a period of treatment time in the range of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or more hours, 1, 2, 3, 4, 5, 6, 7, or more days, 1, 2, 3, 4, 5, 6, 7, 8, or more weeks, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or more months, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more years, depending on the course of the disease and the course of treatment.
[0143] According to embodiments, a labeled-antibody conjugate is administered to a subject prior to immunotherapy treatment of cancer in a subject having or suspected of having cancer, wherein the labeled-antibody conjugate includes an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and the presence of the labeled-antibody conjugate in the subject is detected in vivo by imaging to establish a baseline reading indicative of a baseline level of IFN- to determine the state of active immunity in the subject. An anti-cancer immunotherapy is then administered wherein the mechanism of action of the anti-cancer immunotherapy results in an increased number of tumor-infiltrating lymphocytes in the subject and/or an increased activation state of a tumor-infiltrating lymphocyte population in the subject. The labeled-antibody conjugate is then administered to a subject again after the administration of the anti-cancer immunotherapy to establish a post-treatment reading indicative of a subsequent level of IFN- to determine the state of active immunity in the subject. The steps of administration of the anti-cancer immunotherapy and administration/detection of the labeled-antibody conjugate may be performed 2, 3, 4, 5, 6, 7, 8, 9, 10, or more times, over a period of treatment time in the range of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or more hours, 1, 2, 3, 4, 5, 6, 7, or more days, 1, 2, 3, 4, 5, 6, 7, or more weeks, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or more months, 2, 3, 4, 5, 6, 7, 9, 10, 15, 20 or more years, depending on the course of the disease and the course of treatment.
[0144] III: Mouse Models
[0145] In one or more embodiments, the disclosure discloses mouse models.
[0146] In embodiments, the mouse models include: a mouse having a human cancer xenograft and a labeled-antibody conjugate, wherein the labeled-antibody conjugate includes: an antibody that specifically recognizes and binds to IFN-, and at least one detection label conjugated to the antibody, wherein the at least one detection label is selected from a radionuclide tracer or a fluorophore. In embodiments, the labeled-antibody conjugate is as described herein with regard to antibody conjugates and methods of imaging.
[0147] In embodiments, the mouse model has a human cancer xenograft. In embodiments, the human cancer xenograft is transplanted into the mouse. In embodiments, the human cancer xenograft is established from human cancer cells, human cancer tissues, or combination thereof. In embodiments, the human cancer xenograft includes human cancer cells and/or human cancer tissues of primary cancer and/or metastatic cancer. In embodiments, the human cancer xenograft includes human cancer cells and/or human cancer tissues of primary cancer and/or metastatic cancer selected from brain cancer, melanoma, colon cancer, kidney cancer, prostate cancer, breast cancer, gastric cancer, pancreatic cancer, ovarian cancer and testicular cancer.
[0148] In embodiments, the mouse model having a human cancer xenograft is immunodeficient and further includes engrafted human hematopoetic stem cells such that the mouse has a humanized immune system which produces human IFN-.
[0149] In embodiments, the methods include determining the effect of the composition or treatment on the growth of a human cancer xenograft in the mouse. In embodiments, the effect of the composition or treatment on the growth of the human cancer xenograft is determined by imaging. In embodiments, suitable imaging techniques include those described herein with regard to imaging methods. In embodiments, the effect of the composition or treatment is determined by comparing the growth of the human cancer xenograft in the mouse administered. the composition or treatment to growth of a human cancer xenograft in a mouse not administered the composition or treatment.
[0150] In embodiments, the mouse models include: a mouse having an injury or infection and a labeled-antibody conjugate, wherein the labeled-antibody conjugate includes: an antibody that specifically recognizes and binds to IFN-, and at least one detection label conjugated to the antibody, wherein the at least one detection label is selected from a radionuclide tracer or a fluorophore. In embodiments, the labeled-antibody conjugate is as described herein with regard to antibody conjugates and methods of imaging immune-mediated treatment for injury or infection.
[0151] In embodiments, the mouse models include: an immune competent mouse having a murine cancer, such as an allograft or induced murine tumor, and a labeled-antibody conjugate, wherein the labeled-antibody conjugate includes: an antibody that specifically recognizes and binds to murine IFN-, and at least one detection label conjugated to the antibody, wherein the at least one detection label is selected from a radionuclide tracer or a fluorophore. In embodiments, the labeled-antibody conjugate is as described herein with regard to antibody conjugates and methods of imaging.
EXAMPLES
[0152] The following non-limiting examples illustrate the methods and compositions of the present disclosure.
[0153] Mice
[0154] Female BALB/c mice (6-8 week old) were purchased from Charles River Laboratories (Wilmington, Mass.), Heterozygous BALB/NeuT (NeuT) mice were in-house bred. NeuT male mice, which express a transforming rat neu, develop atypical ductal hyperplasia in 1-2 parotid glands by 6 weeks of age which progresses to multifocal acinic cell adenocarcinoma in situ at about 19 weeks of age.
[0155] Radiochemistry
[0156] All antibodies were obtained from eBioscience (San Diego, Calif.) whereas the non-specific IgG isotype controls were purchased from Jackson ImmunoResearch (Westgrove, Pa.) and Thermo Fisher (Waltham, Mass.) unless otherwise stated. Chelators were obtained from Macrocyclics (Plano, Tex.). Radioisotopes were obtained from 3D Imaging, LLC (Little Rock, Ark.). Synthesis of .sup.89Zr-anti-CD3, .sup.89Zr-anti-IFN-, and non-specific .sup.89Zr-anti-IgG was achieved as described herein. For this synthesis, p-SCN-Bn-Desferrioxamine (DFO, Macrocyclics, Plano, Tex.) was incubated with 145-2C11 (anti-CD3, Armenian hamster, IgG, eBioscience, San Diego, Calif.), or AN-18 (anti-IFN, rat IgG1, kappa, eBioscience, San Diego, Calif.) at a ratio of 1:5(Ab:DFO) in phosphate buffered saline at pH 9 for 1 h at 37 C. and purified via centrifugation with molecular weight column filter (MWCO: 30 kDa, GE Vivaspin 500). Facile .sup.89Zr-radiolabeling (3D Imaging, Little Rock, Ark.) of the 145-2C11- or AN-18-conjugates proceeded in a neutral pH environment in saline at room temperature after 1 h of incubation. Unbound .sup.89Zr (t.sub.1/2=3.27 d) was removed via centrifugation with molecular weight column filters (MWCO: 30 kDa, GE Vivaspin 500). Labeling yields of >85% were achieved as monitored through radio-instant thin layer chromatography (iTLC, MiniScan, Eckert and Ziegler, Berlin, Germany) within 1 h. A radiochemical purity of >98% was obtained after filtration based on iTLC. Specific activities of 4.200.12 mCi/mg for .sup.89Zr-anti-IFN- and 3.980.08 mCi/mg for .sup.89Zr-anti-CD3 were achieved.
[0157] PET Imaging
[0158] Tumor-bearing animals were injected intravenously (i.v.). with the radiolabeled antibody (180-240 Ci/mouse, 42.8-57.1 g in 150 L sterile saline) in the lateral tail vein. Imaging was acquired from 4-120 h post-injection (p.i.). The animals were anesthetized with 3-5% isoflurane (Baxter Healthcare, Deerfield, Ill.) in air for induction, then lowered to 1.5-2% for maintenance. Images were acquired with a microPET R4 camera (Siemens Medical Solutions, USA formerly Concorde Microsystems). Manually drawn 3-dimensional volumes-of-interest (VOI) were selected to determine maximum and mean percent injected dose per gram (% ID/g) in various tissues. Images were decay-corrected to the time of injection and analyzed for labeled-antibody conjugate uptake using ASIpro VM software v. 6.3.3.0.
[0159] Detecting Elevated IFN- in Mice Treated with the TLR9 Agonist CpG-ODN
[0160] IFN- was systemically induced in nave BALB/c mice by intramuscular (i.m.) injection of 100 g CpG-ODN (CpG-oligodeoxynucleotides, integrated DNA Technologies, Coralville, Iowa). Within an hour of treatment, the mice were injected with .sup.89Zr-anti-IFN- in the lateral tail vein for imaging (180-240 Ci/mouse, 49.97.2 g). PET imaging was conducted at 72 h p.i. Labeled-antibody conjugate uptake within the spleen and peripheral immune tissues were analyzed and compared against a control, untreated group.
[0161] Biodistribution and Competitive Inhibition Blocking Assay
[0162] Mice were injected i.v. in the lateral tail vein with .sup.89Zr-anti-IFN- (20-30 Ci, 4.7-7.1 g) in 100-150 saline followed by euthanasia via CO.sub.2 asphyxiation after 72 h p.i., the time point identified at which tumor-to-background is sufficient. For blocking studies, 80 g of cold AN-18 was co-injected with the probe in a separate cohort of mice. Select organs were harvested post-sacrifice, weighed and measured for bound radioactivity with a gamma counter (Perkin Elmer 2480 Wizard 2). The % ID/g was calculated as the % of activity bound to the tissue normalized against total administered activity per gram of tissue weight.
[0163] In Vitro .sup.89Zr-Anti-IFN- Internalization Assay
[0164] TUBO cells (4.510.sup.5) were plated into 6 well plates in triplicate and allowed to adhere overnight. In separate wells, cells were either left untreated or incubated with recombinant IFN- (10 ng/mL) for 15 minutes before being washed 3 times with PBS. .sup.89Zr-anti-IFN- (150 ng, 0.63 nCi) was added and cells were incubated for 1 h at 37 C. Following the incubation period, the media was collected and the cells were rinsed with 1 phosphate buffered saline (PBS) twice. Surface-bound activity was removed by washing the cells in 100 mM acetic acid+100 mM glycine (1:1, 3.5) at 4 C. The cells were then lysed with 1 M NaOH. All washes (media plus PBS, acid and alkaline) were collected in separate tubes and measured for bound activity using a gamma counter (Perkin Elmer). The %-internalized activity was calculated as the ratio of the activity of the lysate and the total activity collected from the media, PBS, acid and base washes, normalized to 450,000 cells counted using a Countess II Automated Cell Counter (Thermo Fisher).
[0165] Tumor Inoculation
[0166] The neu.sup.+ TUBO line cloned from a spontaneous mammary tumor in a female NeuT mouse was obtained through Dr. Guido Forni (U. Torino, Torino, Italy). Mice were inoculated in the 44 mammary fat pad with 2.510.sup.5 tumor cells. Tumor growth was monitored by palpation and caliper measurement. Tumor volume was calculated as v=(lw.sup.2)/2.
[0167] DNA Vaccination
[0168] The HER2/neu DNA vaccine consists of 20 g of pGM-CSF (encoding murine GM-CSF) and 50 g pE2TM (encoding the extracellular and transmembrane regions of human HER2) in 50 L PBS, which is injected i.m. into each gastrocnemius followed immediately by application of electrode gel and square wave electroporation using a BTX830 (BTX Harvard Apparatus, Holliston, Mass.). For NeuT vaccination, mice were depleted of Tregs by intraperitoneal (i.p.) injection of 500 g anti-CD25 mAb PC61 10 days prior to the first vaccination.
[0169] Quantitative Real-Time PCR
[0170] Tumor tissue was snap frozen in liquid nitrogen. Total tumor RNA was collected by Trizol preparation (Thermo Fisher, Waltham, Mass.) after homogenization. cDNA was synthesized with ProtoScript II reverse transcriptase (New England Biolabs, Mass.). Real-time qPCR was conducted with iTaq Universal SYBR Green Supermix (Bio-Rad Laboratories, Hercules, Calif.) using 10 ng cDNA/well and 500 nM primers specific to the indicated gene (Life Tech, Carlsbad, Calif.). Primer sequences used are: CD3 forward primer: CACTCTGGGCEIGCTGATGG, SEQ ID NO:1; CD3 reverse primer: TCATAGTCTGGGTTGGAACAGG, SEQ ID NO:2; CD8 forward primer: GCTGGTAGTCTGCATCCTGCTTC, SEQ ID NO:3; CD8 reverse primer: TTGCTAGCAGGCTATCAGTGTTGTG, SEQ ID NO:4; IFN- forward primer: GAGCTCATTGAATGCTTGGC, SEQ ID NO:5; IFN- reverse primer: GCGTCATTGAATCACACCTG, SEQ ID NO:6; PD-1 forward primer: CGTCCCTCAGTCAAGAGGAG, SEQ ID NO:7; PD-1 reverse primer: GTCCCTAGAAGTGCCCAACA, SEQ ID NO:8; GAPDH forward primer: AAGCTCACTGGCATGGCCTTC, SEQ ID NO:9; and GAPDH reverse primer: TGCTTCACCACCTTCTTGATGTC, SEQ ID NO:10.
[0171] Relative mRNA quantities are calculated by 2.sup.CT compared to GAPDH.
[0172] ELISA
[0173] Tumor tissue was homogenized in standard RIPA buffer with protease inhibitor cocktail (Sigma-Aldrich). Protein concentration was measured by BCA assay (ThermoFisher). High protein binding plates (ThermoFisher) were coated with 3 g/mL anti-mouse-IFN- mAb clone AN-18 (eBioscience) in coating buffer (0.1 M Na.sub.2HPO.sub.4, pH to 9.0) and washed prior to addition of samples or standard curve using recombinant mouse IFN- (Peprotech, Rocky Hill, N.J.) in duplicate, IFN- was detected with biotin-conjugated anti-mouse IFN- clone R4-6A2 (eBioscience), avidin-HRP (ThermoFisher), and TMB substrate (ThermoFisher).
[0174] Serum IgG Measurement
[0175] Serum HER2- and neu-specific IgG were quantified by flow cytometry with a BD FACSCanto II flow cytometer (Becton Dickinson, Franklin Lakes, N.J.), using HER2 over-expressing SKOV3 cells or neu transfected 3T3/NKB cells. Serum was incubated with the appropriate cell line at a 1:100 dilution, followed by washes and detection with PE-conjugated anti-mouse IgG secondary antibody and additional washes prior to detection by flow cytometry. Standard curves for HER2 and neu were run using antibody clones TA-1 and 7.16.4, respectively. Regression analysis was conducted using standard curves of anti-HER2 mAb TA-1 (Calbiochem, Burlington, Mass.) or anti-neu mAb 7.16.4 (Calbiochem, Burlington, Mass.),
[0176] IFN- ELISPOT
[0177] HER2- and neu-specific IFN- production was measured by ELISPOT assay. For this, recombinant HER2 or neu (10 g/mL, Sino Biologicals, Beijing, China) were incubated with splenocytes for 48 h in round-bottom wells, followed by transfer to anti-IFN- coated (clone AN-18, eBioscience) ELISPOT plates (Millipore Sigma, Burlington, Mass.) for an additional 48 h. Spots were detected by biotinylated anti-IFN- (clone R4-6A2, eBioscience) and avidin-HRP (Becton Dickinson, Franklin Lakes, N.J.), followed by enumeration with an ImmunoSpot analyzer (Cellular Technology Limited, Cleveland, Ohio). Results are expressed as spot forming units (SFU) per 10.sup.6 cells.
[0178] Treatment with Anti-neu mAb 7.16.1
[0179] Mice bearing TUBO tumors were injected i.p. 5 times every 3-4 days with sterile-filtered ascites containing 1 mg anti-neu mAb 7.16.4 diluted in PBS to a final volume of 300 L.
[0180] Immunohistochemistry (IHC) and H&E Staining
[0181] IHC was performed using anti-CD8 (clone D4W2Z, Cell Signaling) antibody. After euthanasia, tumors were harvested and fixed in formalin before being embedded in paraffin.
[0182] Blocks were sectioned into 4 m sections using a Sakura Accu-Cut SRM microtome (Catalog#: SRM-200 CV) and adhered onto positively charged slides (Histomax Plus, VWR). Slides were then incubated for 12 minutes at 65 C. and deparrafinized in washes of xylene and graded alcohols. Antigen retrieval was performed in PT module buffer (TA-250-PM4X, Fisher) for CD8 (1:200). Primary antibody incubations were performed for 1 h at room temperature in a humidified chamber. Secondary antibody incubations and DAB were performed following manufacturers protocols. CD8 T cell enumeration was conducted by a blinded board certified pathologist. Each tumor sample was screened for hotspots of CD8 lymphocytes using a Nikon Eclipse Ci microscope at 100 magnification. The number of CD8.sup.+ T lymphocytes were counted in the three regions of highest infiltration at 400 magnification with a 0.55 mm field diameter, and an average was calculated. For H&E staining, tissue sections were subjected to xylenes, graduated alcohol and distilled water washes. They were then stained with hematoxylin (TA-125-MH, Fisher) for 5 minutes, rinsed with an acid wash for 1 minute and a bluing agent for 15 seconds. Eosin staining was applied to slides for 1 minute and slides were rinsed in 95% ethanol three times. Lastly, sections went through a series of graded alcohol and xylenes steps to dehydrate sections in preparation for mounting with Permount (UN1294, Fisher). Pictures were taken with a Spot Idea camera using Spot 5.2 software (Spot, Sterling Heights, Mich.).
[0183] Tumor Dissociation and Flow Cytometry
[0184] TUBO tumors from untreated BALB/c mice were dissociated using the GentleMACs Dissociator and mouse tumor dissociation kit (Miltenyi, Germany) following the manufacturer protocol. Cells were stained with a combination of either: FITC-conjugated CD45 mAb (clone 30-F11), APC-conjugated TCR mAb (clone H57-597), and eFluor780-conjugated viability dye or FITC-conjugated CD45 mAb (clone 30-F11), PE-Cy7-conjugated CD8 mAb (clone 53-6.7), APC-conjugated PD-1 mAb (J43), and eFluor780-conjugated viability dye. All antibodies/dyes were purchased from eBioscience (San Diego, Calif.). Samples were analyzed on a BD FACSCantoII flow cytometer (Becton Dickinson, Franklin Lakes, N.J.) and samples were gated on the viable fraction.
[0185] Statistical Analyses
[0186] Statistical analyses were conducted using GraphPad Prism 7. Data shown are presented as meanstandard deviation. All tests use one-way ANOVA (estimating a different variance for each group) with Tukey's post-test unless otherwise noted. Weekly tumor growth rate for each mouse was calculated by regression analysis of log tumor growth from day 14, when T cells become active after the initial vaccination, until the final measurement on day 38, versus time in weeks. The relationship between the estimated growth rate per week (slope from the regression analysis) for each mouse and the .sup.89Zr-anti-IFN- labeled-antibody conjugate uptake measured at day 28 is assessed using Pearson's correlation. *p<0.05, **p<0.01, ***p<0.001.
[0187] Results
[0188] .sup.89Zr-Anti-IFN- PET Labeled-Antibody Conjugate Identifies Localized IFN- Production
[0189] The rat mAb AN-18 to murine IFN- was labeled with .sup.9Zr using desferrioxamine as the chelate to produce .sup.89Zr-anti-IFN- in good yields and purities. In mice treated with CpG-ODN to stimulate IFN-, whole-body PET images were acquired 72 h p.i., a time point identified to exhibit reliable labeled-antibody conjugate uptake in the tumor, with low liver and blood pool background (
[0190] Tissue distribution of .sup.89Zr-anti-IFN- at 72 h p.i. demonstrated 20.0412.2% ID/g uptake in the spleen (
TABLE-US-00001 TABLE 1 Control 10x mAb block Mean S.D. Mean S.D. p-value Spleen 20.04 12.20 1.88 2.74 0.0061 Blood 0.67 0.69 19.46 12.69 0.0043 Heart 0.30 0.04 10.57 8.91 0.2956 Liver 9.77 9.12 11.69 9.82 0.9999 Kidneys 3.93 0.60 10.64 7.18 0.7755 Bone 4.19 1.18 1.01 0.94 0.9951 Muscle 0.73 0.65 1.08 1.23 >0.9999
[0191] Uptake within the blood circulation (0.670.69 % ID/g), as well as tissues responsible for excretion, liver (9.779.12% ID/g), and kidneys (3.930.6% ID/g) were low. There was also low uptake in the bone and muscle. Specificity was further confirmed through competitive binding experiment where a decrease in spleen uptake was observed (20.0412.20 vs. 1.882.74% ID/g, n=4, p=0.0061) with 10 cold mAb blockade, consequently increasing non-specific tissue accumulation in the blood (19.4612.69% ID/g, p=0.0043), heart (10.578.91, p=0.30), and liver (11.699.82% ID/g, p=0.99). Notable differences in splenic uptake in the imaging and tissue distribution (10-fold lower mass) are due to mass effects, wherein a greater mass of protein administered potentially saturated receptor binding sites and rendered slower pharmacokinetics.
[0192] Since IFN- is a soluble protein, the mechanism of localized IFN- imaging was investigated. Plated TUBO tumor cells were exposed to IFN- and/or .sup.89Zr-anti-IFN- labeled-antibody conjugate in quintuplicate followed by analysis of membrane binding and internalization (
[0193] As further verification of labeled-antibody conjugate uptake, the spleen, liver, heart and spleen tissues were removed and scanned ex vivo (
[0194] IFN- PET Detects Active Anti-Tumor Immunity in Situ in a Syngeneic Tumor Model
[0195] To test the capacity of .sup.89Zr-anti-IFN- as a non-invasive measure of anti-tumor immune response, neu+ TUBO tumor bearing BALB/c mice were imaged after receiving two rounds of HER2/neu DNA vaccination as detailed in
[0196] Detection of Tumor Infiltrating Lymphocytes Via CD3 ImmunoPET
[0197] Total T cell presence in the tumor microenvironment was assessed in separate groups of mice via immunoPET imaging of CD3+ tumor infiltrating lymphocytes using .sup.89Zr-anti-CD3 (
[0198] Ex Vivo Validation Via IHC, qPCR, and ELISA
[0199] Upon completion of imaging, tissues were collected for ex vivo validation. Tumor tissue was assessed to verify CD3.sup.+ and CD8.sup.+ T cell presence, as well as expression of IFN-. Transcripts levels of CD3, CD8 and IFN- were increased in tumor tissue after vaccination (
[0200] Peripheral vaccine-induced immunity was measured by HER2/neu-specific serum IgG (
[0201] Detection of ITx Response in a Spontaneous Tumor Model
[0202] In this example, the capacity of IFN- PET imaging to detect anti-tumor immune activity in a spontaneous tumor setting was tested. Neu transgenic (NeuT) mice are engineered to express a transforming rat neu under direction of the mouse mammary tumor virus promoter, allowing immune system recognition of neu as a self-antigen. Male NeuT mice, which develop 1-2 spontaneous neu+ salivary tumors between 30-40 weeks of age, were used. Once tumors were palpable, Tregs were depleted using anti-CD25 mAb clone PC61 to enhance ITx response given NeuT mice are immune tolerant to rat neu, followed by two HER2/neu DNA vaccinations as detailed in
[0203] Validation of T cell infiltration and IFN- production was conducted by qPCR in tumor tissue samples (
[0204] IFN- PET Imaging Is an Indicator of Immune Activation Status in Situ
[0205] To test the capacity of .sup.89Zr-anti-IFN- to predict treatment outcomes, BALB/c mice (n=11) bearing variably-sized TUBO tumors were treated with REM vaccine, resulting in a range of growth slopes (
[0206] IFN- PET was then evaluated in a setting where tumor-infiltrating T cells are present but have become exhausted. TUBO-bearing mice were treated with passive ITx, mAb 7.16.4 to rat neu. This mAb has been shown to inhibit neu signaling in addition to initiating host anti-tumor immunity. Once tumors were established at 50 mm.sup.3, 1 mg doses of 7.16.4 were given i.p. at 3-4 day intervals for a total of 5 treatments, which reduced and stabilized tumor growth (
TABLE-US-00002 TABLE 2 Treatment Avg # CD8 Std. Dev. Ctrl 3 1 mAb 7.16.4 36 19 Vx 74 25
[0207] Blinded pathologist enumeration of the three regions with highest infiltration were calculated, showing a 12-fold increase in CD8 T cells after 7.16.4 treatment versus control (Ctrl: 31, 7.16.4: 3619). Vaccinated TUBO tumor had the largest detected CD8 infiltration (7425). Overall, CD8.sup.+ tumor infiltration was intermittent, with high-density regions scattered among areas with no detectable CD8.sup.+ TILs.
[0208] CD8 T cell infiltration after 7.16.4 therapy was validated by flow cytometry in a parallel cohort of treated and control mice (
[0209] To date, a variety of monoclonal antibodies have been commercially developed against mouse and human IFN-. For the studies presented here, anti-mouse IFN- clone AN-18 was utilized, and clone XMG1.2 was also tested in a biodistribution study. BALB/c mice were treated with a single intramuscular injection of 100 g, CpG-ODN and tissue biodistribution was measured after 72 h. From these results, it is not anticipated that the clone of IFN- antibody would significantly impact its efficacy as a PET labeled-antibody conjugate.
[0210] IFN- Diabody Production
[0211] From the derived sequence of the anti-IFN (clone: AN18), homodimers of the single chain Fv were produced using CHO cells as expression system (Neoclone, LLC). Octet analysis of the binding affinity (Kd) for the diabody was 37.95.5 nM vs. 28.20.66 nM for the full-length AN18.
[0212] Synthesis and Quality Control of ImmunoPET Probes
[0213] NOTA-PEG.sub.4-Tz was made (5712% yield) by attaching NOTA-Bz-NCS to tetrazine (Tz)-PEG.sub.4-NH.sub.2 using equimolar ratios in DMSO/TEA solvent for 1 h at room temperature (RT). Purification was done through C.sub.18 RP-HPLC. .sup.18F-labeling proceeded using .sup.18F-AlF-NOTA method. Briefly, non-carrier added .sup.18F[F.sup.] will be incubated with 40 nmol AlCl.sub.3 in 0.4 M KHCO.sub.3 at pH4 for 10 min. Equimolar NOTA-PEG.sub.4-Tz in 3:1 acetonitrile:H.sub.2O was added and the solution was incubated for 15 minutes at 90 C. Analytical radio-C18 HPLC monitored the reaction. Purification of .sup.18F-AlF-NOTA-Tz was made by eluting the product through a C.sub.18-Solid Phase Extraction cartridge with ethanol. Radiochemical Yield: 14-16% decay-corrected.
[0214] Diabody (Db) Conjugation to .sup.18F-AlF-NOTA-Tz
[0215] Labeling of Dbs (MW: 50 kDa, NeoClone, WI) is accomplished via inverse electron demand Diels-Alder bioorthogonal click reaction using Tz and transcyclooctene (TCO), which affords a rapid, mild method of labeling a protein, conserving its configuration. The Db fragment of anti-IFN clone AN18 was attached to TCO-NHS, which was then conjugated to .sup.18F-AlF-NOTA-Tz at RT in PBS, pH 7 for 15 min. The labeled product was purified through a spin column (MWCO: 10 kDa). Radio-instant thin layer chromatography and size exclusion chromatography (SEC) indicated >95% purities with an overall decay-corrected radiochemical yield of 6-10%. The specific activity was 3.8-4 mCi/mg. 100-150 Ci Db tracer was injected into a TUBO-bearing BALB/c mouse after Vx (
[0216] IFN- PET methods of the present invention measure active anti-tumor immunity, providing a predictive tool for non-invasive in situ tumor evaluation. This approach is highly specific to the tumor compared to total T cell imaging due to the fact that IFN- is secreted by CTLs within the tumor. Imaging CD3, on the other hand, targets the general T cell population that are not only localized in the tumor but also in other lymphoid tissues.
[0217] These results show that .sup.89Zr-anti-IFN- labeled-antibody conjugate uptake can be indicative of response to therapy in both cancer vaccination and TAA-specific mAb models. These results further demonstrate that IFN- PET may be more sensitive for determining response to ITx when compared to peripheral immune evaluation. IFN- PET has the potential to serve as a universal non-invasive measurement of immune activity in situ for a variety of cancers with virtually any ITx modality with no need for knowledge of specific antigens or cumbersome ex vivo antigen recall assays. Additionally, the utility of IFN- PET allows for cancer immune monitoring, and examination of localized inflammatory conditions such as injury, infection, or autoimmune disease.
[0218] Collectively, these results suggest it may be optimal to detect activity of immune cell populations instead of mere presence. PET imaging of released, soluble IFN displayed higher sensitivity of active anti-tumor immunity detection versus total CD3 imaging. A major drawback to the use of general T cell surface markers for PET imaging is labeled-antibody conjugate uptake in normal secondary lymphoid tissues with dense T cell content, such as the spleen, thymus and lymph nodes, which may limit tumor detection. Importantly, these results indicate non-invasive in situ tumor evaluation by PET more clearly depicts responses to immunotherapy when compared to peripheral immune evaluation by ELISPOT. Unlike peripheral cell assays, IFN- PET also does not require knowledge of specific tumor antigens or cumbersome ex vivo antigen recall assays to determine the extent of immunotherapy response. In addition, a mAb-based labeled-antibody conjugate may locally neutralize IFN- activity, which could benefit an anti-tumor response by reducing PD-L1 upregulation. Taken together, these results support the development of IFN- PET labeled-antibody conjugates for clinical evaluation of tumor immunotherapy.
[0219] Items
[0220] Item 1. A method for in vivo immunoimaging IFN- as a marker of active T cells in a subject, comprising: administering a labeled-antibody conjugate to a subject, wherein the labeled-antibody conjugate comprises: an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer or fluorophore; and detecting the presence of the labeled-antibody conjugate in the subject in vivo by imaging.
[0221] Item 2. The method of item 1, wherein the subject has cancer.
[0222] Item 3. The method of item 2, wherein the subject received an immunotherapy prior to administering and detecting the presence of the labeled-antibody conjugate, and wherein the mechanism of action of the immunotherapy results in an increased number of tumor-infiltrating lymphocytes in the subject and/or an increased activation state of a tumor-infiltrating lymphocyte population in the subject; or wherein administering and detecting the presence of the labeled-antibody conjugate is performed prior to administration of a therapy to determine the state of active immunity in the subject.
[0223] Item 4. The method of item 3, wherein the immunotherapy is an immune checkpoint inhibitor, a cytokine, a vaccine, or an adoptive cell transfer therapy.
[0224] Item 5. The method of any one of the preceding items, wherein the subject is human and the antibody specifically binds to human IFN-.
[0225] Item 6, The method of any one of the preceding items, wherein the antibody is selected from a monoclonal antibody, an antibody fragment, or combination thereof.
[0226] Item 7. The method of item 6, wherein the antibody fragment is a Fab fragment.
[0227] Item 8. The method of item 6, wherein the antibody fragment is a diabody.
[0228] Item 9. The method of any one of the preceding items, wherein the radionuclide tracer is conjugated to the antibody or antibody fragment with a bifunctional chelator or linker.
[0229] Item 10. The method of item 9, wherein the bifunctional chelator comprises a chelator selected from N-{5-[Acetyl(hydroxy)amino]pentyl}-N-[5-({4-[(5-aminopentyl)(hydroxy)amino]-4-oxobutanoyl}amino)pentyl]-N-hydroxysuccinamide (DFO), 1,4,7-triazacyclononane-N N,N -triacetic acid (NOTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (ROTA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (i.e., DOPA), diethylenetriaminepentaacetic acid (DTPA), 2,2-(7-(1-carboxy-4-((2,5-dioxopyrrolidin-1-yl)oxy)-4-oxobutyl)-1,4,7-triazonane-1,4-diyl)diacetic acid (NODA), or a combination of any two or more thereof.
[0230] Item 11. The method of item 9 or item 10, wherein the bifunctional chelator is p-SCN-Bn-DFO.
[0231] Item 12. The method of any one of the preceding items, wherein the radionuclide tracer is selected from the group consisting of: .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.64Cu, .sup.68Ga, .sup.76Br, .sup.82Rb, .sup.86Y, .sup.89Zr, .sup.99mTc, .sup.111In, .sup.124I, .sup.131I, .sup.186Re, .sup.43K, .sup.52Fe, .sup.57Co, .sup.67Cu, .sup.67Ga, .sup.77Br, .sup.81Rb, .sup.81mKr, .sup.87mSr, .sup.113mIn, .sup.123I, .sup.125I, .sup.127Cs, .sup.129Cs, .sup.132I, .sup.197Hg, .sup.203P, .sup.206Bi, and combination of any two or more thereof.
[0232] Item 13. The method of item 12, wherein the radionuclide tracer is .sup.89Zr or .sup.18F.
[0233] Item 14. The method of any one of the preceding items, wherein the imaging comprises positron emission tomography (PET) imaging, single photon emission computed tomography (SPECT) imaging, or a both PET and SPECT.
[0234] Item 15. The method of item 14, wherein the imaging comprises PET.
[0235] Item 16. The method of any one of the preceding items, wherein the labeled-antibody conjugate further comprises a fluorophore.
[0236] Item 17. The method of any one of the preceding items, wherein specific binding of the labeled-antibody conjugate to IFN- indicates the presence of activated T cells and/or human cancer cells.
[0237] Item 18. The method of any one of the preceding items, wherein the presence of the labeled-antibody conjugate is detected in real time.
[0238] Item 19. A labeled-antibody conjugate comprising: an antibody that specifically binds to IFN-, and a detection label conjugated to the antibody, wherein the detection label is a radionuclide tracer.
[0239] Item 20. The labeled-antibody conjugate of item 19, wherein the antibody is isolated.
[0240] Item 21. The labeled-antibody conjugate of item 19 or item 20, wherein the antibody is selected from a monoclonal antibody, an antibody fragment, or combination thereof.
[0241] Item 22. The labeled-antibody conjugate of item 21, wherein the antibody fragment is a Fab fragment.
[0242] Item 23. The labeled-antibody conjugate of item 21, wherein the antibody fragment is a diabody.
[0243] Item 24. The labeled-antibody conjugate of any one of items 19 to 23, wherein the radionuclide tracer is conjugated to the antibody with a bifunctional chelator or linker.
[0244] Item 25. The labeled-antibody conjugate of item 24, wherein the bifunctional chelator comprises a chelator selected from N-{5-[Acetyl(hydroxy)amino]pentyl}-N-[5-({4-[(5-aminopentyl)(hydroxy)amino]-4-oxobutanoyl}amino)pentyl]-N-hydroxysuccinamide (DFO), 1,4,7-triazacyclononane-N,N,N-triacetic acid (NOTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid DOPA), diethylenetriaminepentaacetic acid (DTPA), 2,2-(7-(1-carboxy-4-((2,5-dioxopyrrolidin-1-yl)oxy)-4-oxobutyl)-1,4,7-triazonane-1,4-diyl)diacetic acid (NODA), or a combination of any two or more thereof.
[0245] Item 26. The labeled-antibody conjugate of item 24 or item 25, wherein the bifunctional chelator is p-SCN-Bn-DFO or NOTA.
[0246] Item 27. The labeled-antibody conjugate of any one of items 19 to 26, wherein the .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.64Cu, .sup.68Ga, .sup.76Br, .sup.82Rb, .sup.86Y, .sup.89Zr, .sup.99mTc, .sup.111In, .sup.124I, .sup.131I, .sup.186Re, .sup.43K, .sup.52Fe, .sup.57Co, .sup.67Cu, .sup.67Ga, .sup.77Br, .sup.81Rb, .sup.81mKr, .sup.87mSr, .sup.113mIn, .sup.123I, .sup.125I, .sup.127Cs, .sup.129Cs, .sup.132I, .sup.197Hg, .sup.203Pb, .sup.206Bi, or a combination of any two or more thereof.
[0247] Item 28. The labeled-antibody conjugate of any one of items 19 to 27, wherein the radionuclide tracer is .sup.89Zr or .sup.18F.
[0248] Item 29. The labeled-antibody conjugate of any one of items 19 to 28, wherein the antibody specifically binds to human IFN-.
SEQUENCES
[0249]
TABLE-US-00003 Diabodyheavychainvariableregion(V.sub.H) SEQ.IDNO:11 LSQVQLKESGPGLVQPSQTLSLTCTVSGFSLDSYNVHWVRQPPGKGLEWMG RMKYNGDTSYNSALKSRIRISRDTSKNQVFLKMNSLQTDDIGTYYCIRDWH YGYPSPYFEFWGQGVIVIVTVSSAETTAPSVYPLAPGTALKSNSMVULGCL VKGYFPEPVINTWNSGALSSGVHTFPAVLQSGINTLTSSVTVPSSTWPSQT VICNVAIIPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDV LTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRITEEQFNSTFR SVSELPILHQDWLNGRTFRCKVTSAAFPSIRIEKTISKPEGRTQVPHVYTM SPTKEEMLQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDG SYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK Diabodylightchainvariableregion(V.sub.L) SEQIDNO:12 DVQMTQSPSYLAASPGESVSISCKASKNINTYLAWYOEKPGKTNKLLIYSG STLQSGTPSRFSGSGSGTDFTLTIRSLEPEDFAVYYCQQHNEYPLTFGSGT KLEVKRADAAPTVSITPPSTEQLATGGASVVCLMNINFYPRDISVQWKIDG TERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSS PVVKSPNWNEC Exemplarylinker (SEQIDNO:13) SGGGGS. scFvSEQIDNO:14whichcanbeincludedinan anti-11-7N-gdiabody LSQVQLKESGPGLVQPSQTLSLTCTVSGFSLDSYNVHWVRQPPGKGLEWMG RMKYNGDTSYNSALKSRLRISRDTSKNQVFLKMNSLQTDDTGTYYCTRDWH YGYPSPYFEFWGQGVNIVTVSSAETTAPSVYPLAPGTALKSNSMVTLGGIN KGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTV TCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLT ITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSV SELPILBQDWLNGRTFRCKVTSAAFPSPIEKTIISKPEGRTQVPHVYTMSP TKEEMLQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSY FLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKSGGGGSDV QMTQSPSYLAASPGESVSISCKASKNINTYLAWYQEKPGKTNKLLIYSGST LQSGTPSRFSGSGSGTDFTLTIRSLEPEDFAVYYCQQHNEYPLTFGSGTKI EVKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVQWKIDGTER RDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVV KSENRNEC scfvSEQ:IDNO:15whichcanbeincludedinan anti-IFN-gdiabody DVQMTQSPSYLAASPGESVSISCKASKNINTYLAWYQEKPGKTNKLUYSGS TLQSGTPSRFSGSGSGTDFILTIRSLEPEDFAVYYCQQHNEYPLITGSGIK LEVKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVQWKIDGIE RRIXWLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPV VKSFNRINECSGGGGSLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLDSYN VHWVRQPPGKGLEWMGRMKYNGDTSYNSMKSRLRISRDTSKNQWLKNINSL QTDDTGTYYCTRDWHYGYPSPYFEFWGQGVMVTVSSAETTAPSVYPLAPGT ALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTS SVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVS SVFIFPPKPKDVLTITLTPKVICVVVDISQDDPEWIFSWFVDDVEVHTAQT RPPEEQFNSTFRSVSELPTILHQDWLNGRTFRCKVTSAAFPSPIEKTISKP EGRTQVPHVYTMSPTKEENILQNEVSITCMVKGFITPDIYVEWQMNGQPQE NYKNTPPTNIDTDGSNTLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEK SLSHSPGK
[0250] All documents cited are incorporated herein by reference; the citation of any document is not to be construed as an admission that it is prior art with respect to the present disclosure.
[0251] It is to be further understood that where descriptions of various embodiments use the term comprising, and/or including those skilled in the art would understand that in some specific instances, an embodiment can be alternatively described using language consisting essentially of or consisting of.
[0252] While particular embodiments of the present disclosure have been illustrated and described, it would be obvious to one skilled in the art that various other changes and modifications can be made without departing from the spirit and scope of the disclosure. It is therefore intended to cover in the appended claims all such changes and modifications that are within the scope of this disclosure.
[0253] It should be understood that every maximum numerical limitation given throughout this specification includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.
[0254] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the claimed subject matter belongs. The terminology used in the description herein is for describing particular embodiments only and is not intended to be limiting. As used in the specification and appended claims, the singular forms a, an, and the are intended to include the plural forms as well, unless the context clearly indicates otherwise.