Polypeptides Comprising Modified IL-2 Polypeptides and Uses Thereof
20230235005 · 2023-07-27
Assignee
Inventors
- John C. Timmer (San Diego, CA, US)
- Florian Sulzmaier (San Diego, CA, US)
- Katelyn M. Willis (San Diego, CA, US)
- Bryan R. Becklund (San Diego, CA, US)
- Brendan P. Eckelman (Encinitas, CA, US)
Cpc classification
A61K45/06
HUMAN NECESSITIES
International classification
Abstract
Provided herein are polypeptide comprising a modified IL-2, wherein the modified IL-2 has reduced affinity for the IL-2 receptor relative to wild type IL-2. In some embodiments, polypeptides comprising a modified IL-2 that bind and agonize activated T cells are provided. Uses of the polypeptides comprising a modified IL-2 are also provided.
Claims
1. A polypeptide comprising a modified IL-2, wherein the modified IL-2 comprises a D84Y substitution.
2. The polypeptide of claim 1, wherein the modified IL-2 has reduced affinity for CD122 compared to wild-type IL-2.
3. The polypeptide of any one of claims 1-2, wherein the modified IL-2 comprises at least one substitution at at least one amino acid position selected from H16, L19, M23, N88, and E95.
4. The polypeptide of claim 3, wherein the modified IL-2 comprises a substitution at amino acid position H16.
5. The polypeptide of claim 4, wherein the substitution is selected from H16A H16N, H16V, and H16T.
6. The polypeptide of any one of claims 1-5, wherein the modified IL-2 comprises a substitution at amino acid position L19.
7. The polypeptide of claim 6, wherein the substitution is selected from L19A, L19P, L19Q, L19Y, L19N, L19S, L19T, L19V.
8. The polypeptide of any one of claims 1-7, wherein the modified IL-2 comprises a substitution at amino acid position M23.
9. The polypeptide of claim 8, wherein the substitution is selected from M23A, M23G, M23S, M23T, M23V, M23D, M23E, M23I, M23K, M23L, M23N, M23Q, M23R, and M23Y.
10. The polypeptide of any one of claims 1-9, wherein the modified IL-2 comprises a substitution at amino acid position N88.
11. The polypeptide of claim 10, wherein the substitution is selected from N88T, N88A, and N88S.
12. The polypeptide of any one of claims 1-11, wherein the modified IL-2 comprises a substitution at amino acid position E95.
13. The polypeptide of claim 12, wherein the substitution is selected from E95Q, E95G, E95T, E95V, E95P, E95H, E95N, and E95Y.
14. The polypeptide of any one of claims 1-13, wherein the modified IL-2 comprises at least one substitution that reduces affinity for CD132 compared to wild-type IL-2.
15. The polypeptide of any one of claims 1-14, wherein the modified IL-2 comprises at least one substitution at at least one amino acid position selected from Q22, R120, T123, Q126, S127, I129, and S130.
16. The polypeptide of claim 15, wherein the modified IL-2 comprises a substitution at amino acid position Q22.
17. The polypeptide of claim 16, wherein the substitution is selected from Q22A, Q22D, Q22G, Q22H, Q22K, Q22N, Q22R, Q22S, Q22T, Q22V, and Q22Y.
18. The polypeptide of any one of claims 15-17, wherein the modified IL-2 comprises a substitution at amino acid position R120.
19. The polypeptide of claim 18, wherein the substitution is selected from R120A, R120D, R120E, R120F, R120G, R120H, R120K, R120N, R120Q, R120S, R120V, and R120Y.
20. The polypeptide of any one of claims 15-19, wherein the modified IL-2 comprises a substitution at amino acid position T123.
21. The polypeptide of claim 20, wherein the substitution is selected from T123D, T123E, T123H, T123K, T123N, T123Q, and T123R.
22. The polypeptide of any one of claims 15-21, wherein the modified IL-2 comprises a substitution at amino acid position Q126.
23. The polypeptide of claim 22, wherein the substitution is selected from Q126N, Q126A, and Q126Y.
24. The polypeptide of any one of claims 15-23, wherein the modified IL-2 comprises a substitution at amino acid position 5127.
25. The polypeptide of claim 24, wherein the substitution is selected from S127D, S127E, S127H, S127K, S127N, S127P, and S127R.
26. The polypeptide of any one of claims 15-25, wherein the modified IL-2 comprises a substitution at amino acid position I129.
27. The polypeptide of claim 26, wherein the substitution is selected from I129A, I129H, I129R, and I129S.
28. The polypeptide of any one of claims 15-27, wherein the modified IL-2 comprises a substitution at amino acid position S130.
29. The polypeptide of claim 28, wherein the substitution is selected from S130E, S130K, S130N, S130P, S130Q, and S130R.
30. A polypeptide comprising a modified IL-2, wherein the modified IL-2 comprises at least one substitution at at least one amino acid position selected from Q22, R120, T123, S127, and S130.
31. The polypeptide of claim 30, wherein the modified IL-2 has reduced affinity for CD132 compared to wild-type IL-2.
32. The polypeptide of any one of claims 30-31, wherein the modified IL-2 comprises a substitution at amino acid position Q22.
33. The polypeptide of claim 32, wherein the substitution is selected from Q22A, Q22D, Q22E, Q22G, Q22H, Q22K, Q22N, Q22P, Q22R, Q22S, Q22T, Q22V, and Q22Y.
34. The polypeptide of any one of claims 30-33, wherein the modified IL-2 comprises a substitution at amino acid position R120.
35. The polypeptide of claim 34, wherein the substitution is selected from R120A, R120D, R120E, R120F, R120G, R120H, R120K, R120N, R120P, R120Q, R120S, R120V, and R120Y.
36. The polypeptide of claim 30-35, wherein the modified IL-2 comprises a substitution at amino acid position T123.
37. The polypeptide of claim 36, wherein the substitution is selected from T123D, T123E, T123H, T123K, T123N, T123Q, and T123R.
38. The polypeptide of any one of claims 30-37, wherein the modified IL-2 comprises a substitution at amino acid position 5127.
39. The polypeptide of claim 38, wherein the substitution is selected from S127D, S127E, S127H, S127K, S127N, S127P, S127Q, and S127R.
40. The polypeptide of any one of claims 30-39, wherein the modified IL-2 comprises a substitution at amino acid position S130.
41. The polypeptide of claim 40, wherein the substitution is selected from S130D, S130E, S130H, S130K, S130N, S130P, S130Q, and S130R.
42. The polypeptide of any one of claims 30-41, wherein the modified IL-2 comprises at least one substitution that reduces affinity for CD122 compared to wild-type IL-2.
43. The polypeptide of claim 42, wherein the modified IL-2 comprises at least one substitution at at least one amino acid position selected from H16, L19, M23, D84, N88, and E95.
44. The polypeptide of claim 43, wherein the modified IL-2 comprises a substitution at amino acid position H16.
45. The polypeptide of claim 44, wherein the substitution is selected from H16A, H16T, H16V, and H16N.
46. The polypeptide of any one of claims 43-45, wherein the modified IL-2 comprises a substitution at amino acid position L19.
47. The polypeptide of claim 46, wherein the substitution is selected from L19A, L19P, L19Q, L19Y, L19N, L19S, L19T, L19V.
48. The polypeptide of any one of claims 43-47, wherein the modified IL-2 comprises a substitution at amino acid position M23.
49. The polypeptide of claim 48, wherein the substitution is selected from M23A, M23G, M23S, M23T, M23V, M23D, M23E, M23I, M23K, M23L, M23N, M23Q, M23R, and M23Y.
50. The polypeptide of any one of claims 43-49, wherein the modified IL-2 comprises a substitution at amino acid position D84.
51. The polypeptide of claim 50, wherein the substitution is selected from D84S, D84G, D84A, D84T, D84V, D84Y, and D84N
52. The polypeptide of any one of claims 43-51, wherein the modified IL-2 comprises a substitution at amino acid position N88.
53. The polypeptide of claim 52, wherein the substitution is selected from N88T, N88A, and N88S.
54. The polypeptide of any one of claims 43-53, wherein the modified IL-2 comprises a substitution at amino acid position E95.
55. The polypeptide of claim 54, wherein the substitution is selected from E95Q, E95G, E95T, E95V, E95P, E95H, E95N, and E95Y.
56. The polypeptide of any one of claims 1-55, wherein the modified IL-2 comprises at least one substitution that reduces affinity for CD25 compared to wild-type IL-2.
57. The polypeptide of any one of claims 1-56, wherein the modified IL-2 comprises at least one substitution at at least one amino acid position selected from K43, Y45, E61, I114, P65, F42, R38, and L72, and/or wherein the modified IL-2 comprises a deletion of amino acid F42.
58. The polypeptide of claim 57, wherein the modified IL-2 comprises a substitution at amino acid F42 or comprises a deletion of amino acid F42.
59. The polypeptide of claim 58, wherein the modified IL-2 comprise a substitution at amino acid position F42 selected from F42K, F42A, F42R, F42G, F42S, and F42T.
60. The polypeptide of claim 58, wherein the modified IL-2 comprise a deletion of amino acid F42.
61. The polypeptide of any one of claims 57-60, wherein the modified IL-2 comprises a substitution at amino acid position K43.
62. The polypeptide of claim 61, wherein the substitution is selected from K43E and K43D.
63. The polypeptide of any one of claims 57-62, wherein the modified IL-2 comprises a substitution at amino acid position Y45.
64. The polypeptide of claim 63, wherein the substitution is selected from Y45R and Y45K.
65. The polypeptide of any one of claims 57-64, wherein the modified IL-2 comprises a substitution at amino acid position E61.
66. The polypeptide of claim 65, wherein the substitution is selected from E61R, E61G, E61H, E61N, E61P, E61S, E61T, E61Y, E61A, E61Q, and E61K.
67. The polypeptide of any one of claims 57-66, wherein the modified IL-2 comprises a substitution at amino acid position I114.
68. The polypeptide of claim 67, wherein the substitution is I114F, I114Y, or I114W.
69. The polypeptide of any one of claims 57-68, wherein the modified IL-2 comprises a substitution at amino acid position P65.
70. The polypeptide of claim 69, wherein the substitution is selected from P65R, P65E, P65K, P65H, P65Y, P65Q, P65D, and P65N.
71. The polypeptide of any one of claims 57-70, wherein the modified IL-2 comprises a substitution at amino acid position R38.
72. The polypeptide of claim 71, wherein the substitution at R38 is selected from R38A and R38G.
73. The polypeptide of any one of claims 57-72, wherein the modified IL-2 comprises a substitution at amino acid position L72.
74. The polypeptide of claim 73, wherein the substitution at L72 is and L72G.
75. The polypeptide of any one of claims 1-74, wherein the modified IL-2 comprises substitution Q22A, or substitution R120A, or substitutions Q22A and R120A.
76. The polypeptide of any one of claims 1-75, wherein the modified IL-2 comprises substitutions P65R and R38A or substitution P65R and E61R.
77. The polypeptide of any one of claims 1-76, wherein the modified IL-2 comprises at least one substitution selected from H16A, L19A, L19N, M23A, D84S or D84Y, N88S, and E95Q.
78. The polypeptide of any one of claims 1-77, wherein the modified IL-2 comprises substitutions at amino acid positions P65, H16, and D84.
79. The polypeptide of claim 78, wherein the modified IL-2 comprises substitutions P65R, H16A, and D84S; or substitutions P65R, H16A, and D84Y.
80. The polypeptide of any one of claims 1-79, wherein the modified IL-2 comprises at least one substitution at at least one amino acid position selected from T3 and C125, and/or comprises a deletion of the first five amino acids of IL-2.
81. The polypeptide of claim 80, wherein the modified IL-2 comprises at least one substitution selected from T3A, C125A, C125V, and C125S.
82. The polypeptide of claim 81, wherein the modified IL-2 comprises T3A and C125S substitutions, or T3A and C125V substitutions.
83. The polypeptide of claim 81, wherein the modified IL-2 comprises a deletion of the first five amino acids of IL-2 and a C125S substitution or C125V substitution.
84. The polypeptide of any one of the preceding claims, wherein the modified IL-2 comprises a set of substitutions selected from [T3A, H16A, E61R, P65R, D84Y, C125S], [T3A, H16A, M23T, E61R, P65R, D84Y, E95Q, C125S], [T3A, H16A, L19N, E61R, P65R, D84Y, C125S], [T3A, H16A, L19N, M23T, E61R, P65R, D84Y, E95Q, C125S], [T3A, H16A, E61R, P65R, D84Y, C125S, S127D], [T3A, H16A, M23T, E61R, P65R, D84Y, E95Q, C125S, S127D], [T3A, H16A, L19N, E61R, P65R, D84Y, C125S, S127D], and [T3A, H16A, L19N, M23T, E61R, P65R, D84Y, E95Q, C125S, S127D].
85. A modified polypeptide comprising a modified IL-2, wherein the modified IL-2 comprises a set of substitutions selected from [T3A, H16A, E61R, P65R, D84Y, C125S], [T3A, H16A, M23T, E61R, P65R, D84Y, E95Q, C125S], [T3A, H16A, L19N, E61R, P65R, D84Y, C125S], [T3A, H16A, L19N, M23T, E61R, P65R, D84Y, E95Q, C125S], [T3A, H16A, E61R, P65R, D84Y, C125S, S127D], [T3A, H16A, M23T, E61R, P65R, D84Y, E95Q, C125S, S127D], [T3A, H16A, L19N, E61R, P65R, D84Y, C125S, S127D], and [T3A, H16A, L19N, M23T, E61R, P65R, D84Y, E95Q, C125S, S127D].
86. The polypeptide of any one of the preceding claims, wherein the modified IL-2 comprises the indicated substitutions, and does not comprise any additional substitutions.
87. The polypeptide of any one of the preceding claims, wherein the modified IL-2 is a modified human IL-2.
88. The polypeptide of any one of the preceding claims, wherein the amino acid positions correspond to the amino acid positions in SEQ ID NO: 1.
89. The polypeptide of any one of the preceding claims, wherein the modified IL-2 comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 84 and comprising corresponding substitutions of an amino acid sequence selected from SEQ ID NOs: 105-290.
90. The polypeptide of any one of the preceding claims, wherein the modified IL-2 comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 270-277 and comprises substitution D84Y.
91. The polypeptide of any one of the preceding claims, wherein the modified IL-2 comprises an amino acid sequence selected from SEQ ID NOs: 105-290.
92. The polypeptide of any one of the preceding claims, wherein the modified IL-2 comprises an amino acid sequence selected from SEQ ID NOs: 270-277.
93. The polypeptide of any one of the preceding claims, wherein the polypeptide comprises an Fc region.
94. The polypeptide of claim 93, wherein the modified IL-2 is fused to the N-terminus or the C-terminus of the Fc region.
95. The polypeptide of claim 93 or claim 94, wherein the Fc region comprises a substitution at Kabat amino acid position T366.
96. The polypeptide of claim 95, wherein the Fc region comprises a T366W substitution.
97. The polypeptide of claim 93 or claim 94, wherein the Fc region comprises at least one substitution at at least one Kabat amino acid position selected from T366, L368, and Y407.
98. The polypeptide of claim 108, wherein the Fc region comprises T366S, L368A, and Y407V mutations.
99. The polypeptide of any one of claims 93-98, wherein the Fc region comprises a substitution at a Kabat position selected from S354 and Y349.
100. The polypeptide of claim 99, wherein the Fc region comprises a S354C or a Y349C substitution.
101. The polypeptide of any one of claims 93-100, wherein the Fc region comprises a substitution at Kabat amino acid position H435.
102. The polypeptide of claim 101, wherein the Fc region comprises a substitution selected from H435R and H435K.
103. The polypeptide of any one of claims 93-102, wherein the Fc region comprises at least one substitution at at least one Kabat amino acid position selected from M252 and M428.
104. The polypeptide of claim 103, wherein the Fc region comprises M252Y and M428V substitutions.
105. The polypeptide of any one of claims 93-104, wherein the Fc region comprises a deletion of Kabat amino acids E233, L234, and L235.
106. The polypeptide of any one of claims 93-104, wherein the Fc region comprises at least one substitution at at least one amino acid position selected from L234, L235, and P329.
107. The polypeptide of claim 106, wherein the Fc region comprises L234A, L235A, and P329G substitutions.
108. The polypeptide of any one of claims 93-107, wherein the Fc region comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 47-83, 292, and 293.
109. The polypeptide of any one of claims 93-108, wherein the Fc region is part of a heavy chain constant region.
110. The polypeptide of claim 109, wherein the heavy chain constant region is an IgG constant region.
111. The polypeptide of claim 110, wherein the heavy chain constant region is an IgG1, IgG2, IgG3, or IgG4 constant region.
112. The polypeptide of any one of claims 93-111, wherein the modified IL-2 is fused to the C-terminus of the Fc region or heavy chain constant region.
113. The polypeptide of claim 112, wherein the modified IL-2 is fused to the C-terminus of the Fc region or heavy chain constant region via a linker comprising 1-20 amino acids.
114. The polypeptide of claim 113, wherein the linker comprises glycine amino acids.
115. The polypeptide of claim 114, wherein the linker comprises glycine and serine amino acids.
116. The polypeptide of any one of claims 113-115, wherein a majority, or all, of the amino acids in the linker are glycine and serine.
117. The polypeptide of any one of claims 93-116, wherein the polypeptide comprises an amino acid sequence selected from SEQ ID NOs: 105-290 and an amino acid sequence selected from SEQ ID NOs: 48, 64, 292, and 293.
118. The polypeptide of any one of the preceding claims, wherein the polypeptide comprises at least one antigen binding domain.
119. The polypeptide of claim 118, wherein the polypeptide comprises two, three, or four antigen binding domains.
120. The polypeptide of claim 118 or claim 119, wherein at least one antigen binding domain specifically binds to a T-cell antigen or a natural killer cell antigen.
121. The polypeptide of any one of claims 118-120, wherein at least one antigen binding domain specifically binds to a CD4.sup.+ T-cell antigen or a CD8.sup.+ T-cell antigen.
122. The polypeptide of claim 121, wherein the at least one antigen binding domain specifically binds to an antigen on an activated CD4.sup.+ T-cell or an activated CD8.sup.+ T-cell.
123. The polypeptide of any one of claims 118-122, wherein at least one antigen binding domain is an agonist.
124. The polypeptide of any one of claims 118-122, wherein the antigen binding domain is an antagonist.
125. The polypeptide of any one of claims 118-124, wherein at least one antigen binding domain specifically binds to PD-1, CTLA-4, LAG3, TIM3, 4-1BB, OX40, GITR, CD8a, CD8b, CD4, NKp30, NKG2A, TIGIT, TGFβR1, TGFβR2, Fas, NKG2D, NKp46, PD-L1, CD107a, ICOS, TNFR2, CD16a, or γδTCR.
126. The polypeptide of any one of claims 118-124, wherein at least one antigen binding domain specifically binds to PD-1.
127. The polypeptide of any one of claims 118-126, wherein at least one antigen binding domain is a human or humanized antigen binding domain.
128. The polypeptide of claim 127, wherein each antigen binding domain is, independently, a human or humanized antigen binding domain.
129. The polypeptide of any one of claims 118-128, wherein at least one antigen binding domain comprises a VHH domain.
130. The polypeptide of claim 129, wherein each antigen binding domain comprises a VHH domain.
131. The polypeptide of any one of claims 118-128, wherein at least one antigen binding domain comprises a VH domain and a VL domain.
132. The polypeptide of claim 131, wherein at least one antigen binding domain comprises the VH domain and the VL domain of an antibody selected from pembrolizumab, nivolumab, AMP-514, TSR-042, STI-A1110, ipilimumab, tremelimumab, urelumab, utomilumab, atezolizumab, and durvalumab.
133. The polypeptide of claim 131 or 132, wherein the at least one antigen binding domain comprises a single chain Fv (scFv).
134. The polypeptide of claim 131 or 132, wherein the polypeptide comprises a heavy chain constant region, wherein the VH domain is fused to the heavy chain constant region, and wherein the VL domain is associated with the VH domain.
135. The polypeptide of claim 134, wherein the VL domain is fused to a light chain constant region.
136. The polypeptide of claim 135, wherein the light chain constant region is selected from kappa and lambda.
137. The polypeptide of any one of claims 118-136, wherein each of the antigen binding domains are the same.
138. The polypeptide of any one of claims 118-137, wherein each of the antigen binding domains specifically bind to the same antigen.
139. The polypeptide of any one of claims 118-136, wherein at least one of the antigen binding domains specifically binds to a different antigen than at least one of the other antigen binding domains.
140. The polypeptide of claim 139, wherein at least one antigen binding domain specifically binds to PD-1 and at least one other antigen binding domain specifically binds to a T-cell antigen or natural killer cell antigen other than PD-1.
141. The polypeptide of any one of claims 118-140, wherein at least one antigen binding domain binds to PD-1, CTLA-4, LAG3, TIM3, 4-1BB, OX40, GITR, CD8a, CD8b, CD4, NKp30, NKG2A, TIGIT, TGFβR1, TGFβR2, Fas, NKG2D, NKp46, PD-L1, CD107a, ICOS, TNFR2, CD16a, DNAM1, or γδTCR (Vγ9, Vγ2, Vδ1).
142. The polypeptide of any one of claims 93-141, wherein the polypeptide forms a homodimer under physiological conditions.
143. The polypeptide of any one of the preceding claims, wherein the modified IL-2 binds a human IL-2R with an affinity at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 50-fold, or at least 100-fold lower than the affinity of human wild type IL-2 for the IL-2R.
144. A complex comprising a first polypeptide and a second polypeptide, wherein the first polypeptide is the polypeptide of any one of the preceding claims.
145. The complex of claim 144, wherein the first polypeptide comprises a first Fc region and the second polypeptide comprises a second Fc region.
146. The complex of claim 144 or claim 145, wherein each Fc region is an isotype selected from human IgG1, IgG2, IgG3, an IgG4.
147. The complex of claim 146, wherein each Fc region is a human IgG1.
148. The complex of any one of claims 144-147, wherein each Fc region comprises a deletion of amino acids E233, L234, and L235.
149. The complex of any one of claims 144-148, wherein each Fc region comprises a H435R or H435K mutation.
150. The complex of any one of claims 155-160, wherein the Fc region comprises a mutations M252Y and M428L or mutations M252Y and M428V.
151. The complex of any one of claims 144-150, wherein the first Fc region or the second Fc region comprises a T366W mutation, and the other Fc region comprises mutations T366S, L368A, and Y407V.
152. The complex of claim 151, wherein the first Fc region or the second Fc region comprises a S354C mutation.
153. The complex of any one of claims 144-152, wherein each Fc region independently comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 47-83, 292, and 293.
154. The complex of any one of claims 144-153, wherein the second polypeptide does not comprise a modified IL-2.
155. The complex of any one of claims 144-154, wherein the first polypeptide comprises at least one antigen binding domain.
156. The complex of any one of claims 144-155, wherein the second polypeptide comprises at least one antigen binding domain.
157. The complex of any one of claims 144-156, wherein the first polypeptide comprises a first antigen binding domain, an Fc region, and a modified IL-2.
158. The complex of claim 157, wherein the first antigen binding domain is fused to the N-terminus of the Fc region and the modified IL-2 is fused to the C-terminus of the Fc region.
159. The complex of claim 157 or claim 158, wherein the second polypeptide comprises a second antigen binding domain and an Fc region.
160. The complex of claim 159, wherein the first antigen binding domain and the second antigen binding domain are the same or different.
161. The complex of claim 160, wherein: a) the first antigen binding domain and the second antigen binding domain both bind PD-1; b) the first antigen binding domain binds PD-1, and the second antigen binding domain binds LAG3; c) the first antigen binding domain binds PD-1, and the second antigen binding domain binds CTLA-4; d) the first antigen binding domain binds PD-1, and the second antigen binding domain binds 4-1BB; e) the first antigen binding domain binds PD-1, and the second antigen binding domain binds OX40; f) the first antigen binding domain binds PD-1, and the second antigen binding domain binds GITR; g) the first antigen binding domain binds PD-1, and the second antigen binding domain binds CD8a; h) the first antigen binding domain binds PD-1, and the second antigen binding domain binds CD8b; i) the first antigen binding domain binds PD-1, and the second antigen binding domain binds CD4; j) the first antigen binding domain binds PD-1, and the second antigen binding domain binds NKp30; k) the first antigen binding domain binds PD-1, and the second antigen binding domain binds NKG2A; l. the first antigen binding domain binds PD-1, and the second antigen binding domain binds TIGIT; m) the first antigen binding domain binds PD-1, and the second antigen binding domain binds NKG2D; n) the first antigen binding domain binds PD-1, and the second antigen binding domain binds TGFBR2; o) the first antigen binding domain binds PD-1, and the second antigen binding domain binds Fas; p) the first antigen binding domain binds PD-1, and the second antigen binding domain binds CD107a; q) the first antigen binding domain binds PD-1, and the second antigen binding domain binds NKp46; r) the first antigen binding domain binds CD8a, and the second antigen binding domain binds TGFRβR2; s) the first antigen binding domain binds CD8a, and the second antigen binding domain binds Fas; t) the first antigen binding domain binds NKG2D, and the second antigen binding domain binds TGFRβR2; u) the first antigen binding domain binds NKG2D, and the second antigen binding domain binds Fas; v) the first antigen binding domain binds NKG2A, and the second antigen binding domain binds TGFRβR2; w) the first antigen binding domain binds NKG2A, and the second antigen binding domain binds Fas; x) the first antigen binding domain binds NKp46, and the second antigen binding domain binds TGFRβR2; y) the first antigen binding domain binds NKp46, and the second antigen binding domain binds Fas; z) the first antigen binding domain binds CTLA-4, and the second antigen binding domain binds LAGS; aa) the first antigen binding domain binds CTLA-4, and the second antigen binding domain binds Tim3; bb) the first antigen binding domain binds CTLA-4, and the second antigen binding domain binds OX40; cc) the first antigen binding domain binds CTLA-4, and the second antigen binding domain binds GITR; dd) the first antigen binding domain binds CTLA-4, and the second antigen binding domain binds CD107a; ee) the first antigen binding domain binds CTLA-4, and the second antigen binding domain binds NKp46 ff) the first antigen binding domain binds ICOS, and the second antigen binding domain binds TNFR2; gg) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds NKG2D; hh) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds DNAM1; ii) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds TIGIT; jj) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds 4-1BB; kk) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds Fas; ll) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds NKG2A; or mm) the first antigen binding domain binds γδTCR, and the second antigen binding domain binds CD16a.
162. The complex of any one of claims 144-161, wherein the modified IL-2 binds a human IL-2R with an affinity at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 50-fold, or at least 100-fold lower than the affinity of human wild type IL-2 for the IL-2R.
163. A pharmaceutical composition comprising a polypeptide of any one of claims 1-154 or the complex of any one of claims 144-162 and a pharmaceutically acceptable carrier.
164. An isolated nucleic acid the encodes a polypeptide of any one of claims 1-143 or the complex of any one of claims 144-162.
165. An expression vector comprising the nucleic acid of claim 164.
166. An isolated host cell comprising the nucleic acid of claim 164 or the expression vector of claim 165.
167. An isolated host cell that expresses the polypeptide of any one of claims 1-143 or the complex of any one of claims 144-162.
168. A method of producing the polypeptide of any one of claims 1-143 or the complex of any one of claims 144-162 comprising incubating the host cell of claim 166 or claim 167 under conditions suitable to express the polypeptide or complex.
169. The method of claim 168, further comprising isolating the polypeptide or complex.
170. A method of increasing CD4+ and/or CD8+ T cell proliferation comprising contacting T cells with the polypeptide of any one of claims 1-154 or the complex of any one of claims 144-162.
171. The method of claim 170, wherein the CD4+ and/or CD8+ T cells are in vitro.
172. The method of claim 170, wherein the CD4+ and/or CD8+ T cells are in vivo.
173. The method of any one of claims 170-172, wherein the increase is at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold.
174. A method of increasing NK cell proliferation comprising contacting NK cells with the polypeptide of any one of claims 1-143 or the complex of any one of claims 144-162.
175. The method of claim 174, wherein the increase is at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold.
176. A method of treating cancer comprising administering to a subject with cancer a pharmaceutically effective amount of the polypeptide of any one of claims 1-143 or the complex of any one of claims 144-162, or the pharmaceutical composition of claim 163.
177. The method of claim 176, wherein the cancer is selected from basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer; gastrointestinal cancer; glioblastoma; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; liver cancer; lung cancer; small-cell lung cancer; non-small cell lung cancer; adenocarcinoma of the lung; squamous carcinoma of the lung; melanoma; myeloma; neuroblastoma; oral cavity cancer; ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; cancer of the respiratory system; salivary gland carcinoma; sarcoma; skin cancer; squamous cell cancer; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulval cancer; lymphoma; Hodgkin's lymphoma; non-Hodgkin's lymphoma; B-cell lymphoma; low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; Waldenstrom's macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); Hairy cell leukemia; and chronic myeloblastic leukemia.
178. The method of claim 176 or 177, further comprising administering an additional therapeutic agent.
179. The method of claim 178, wherein the additional therapeutic agent is an anti-cancer agent.
180. The method of claim 179, wherein the anti-cancer agent is selected from a chemotherapeutic agent, an anti-cancer biologic, radiation therapy, CAR-T therapy, and an oncolytic virus.
181. The method of claim 179 or claim 180, wherein the additional therapeutic agent is an anti-cancer biologic.
182. The method of claim 181, wherein the anti-cancer biologic is an agent that inhibits PD-1 and/or PD-L1.
183. The method of claim 181, wherein the anti-cancer biologic is an agent that inhibits VISTA, gpNMB, B7H3, B7H4, HHLA2, CTLA4, or TIGIT.
184. The method of any one of claims 179-183, wherein the anti-cancer agent is an antibody.
185. The method of claim 181, wherein the anti-cancer biologic is a cytokine.
186. The method of claim 179, wherein the anti-cancer agent is CAR-T therapy.
187. The method of claim 179, wherein the anti-cancer agent is an oncolytic virus.
188. The method of any one of claims 176-187, further comprising tumor resection and/or radiation therapy.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0235]
[0236]
[0237]
[0238]
[0239]
[0240]
[0241]
[0242]
[0243]
[0244]
[0245]
[0246]
[0247]
[0248]
[0249]
[0250]
[0251]
[0252]
[0253]
[0254]
[0255]
[0256]
[0257]
[0258]
[0259]
[0260]
[0261]
[0262]
[0263]
DETAILED DESCRIPTION
[0264] Embodiments provided herein relate to polypeptides comprising a modified IL-2 that modulates the activity of T cells and their use in various methods of treating cancer.
Definitions and Various Embodiments
[0265] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.
[0266] All references cited herein, including patent applications, patent publications, and Genbank Accession numbers are herein incorporated by reference, as if each individual reference were specifically and individually indicated to be incorporated by reference in its entirety.
[0267] The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodology by those skilled in the art, such as, for example, the widely utilized methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 3rd. edition (2001) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F. M. Ausubel, et al. eds., (2003)); the series METHODS IN ENZYMOLOGY (Academic Press, Inc.): PCR 2: A PRACTICAL APPROACH (M. J. MacPherson, B. D. Hames and G. R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY MANUAL, and ANIMAL CELL CULTURE (R. I. Freshney, ed. (1987)); Oligonucleotide Synthesis (M. J. Gait, ed., 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1998) Academic Press; Animal Cell Culture (R. I. Freshney), ed., 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture Laboratory Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds., 1993-8) J. Wiley and Sons; Handbook of Experimental Immunology (D. M. Weir and C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller and M. P. Calos, eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis et al., eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: A Practical Approach (D. Catty., ed., IRL Press, 1988-1989); Monoclonal Antibodies: A Practical Approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using Antibodies: A Laboratory Manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J. D. Capra, eds., Harwood Academic Publishers, 1995); and Cancer: Principles and Practice of Oncology (V. T. DeVita et al., eds., J.B. Lippincott Company, 1993); and updated versions thereof.
[0268] Unless otherwise defined, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context or expressly indicated, singular terms shall include pluralities and plural terms shall include the singular. For any conflict in definitions between various sources or references, the definition provided herein will control.
[0269] In general, the numbering of the residues in an immunoglobulin heavy chain is that of the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). The “EU index as in Kabat” refers to the residue numbering of the human IgG1 EU antibody.
[0270] It is understood that embodiments of the invention described herein include “consisting” and/or “consisting essentially of” embodiments. As used herein, the singular form “a”, “an”, and “the” includes plural references unless indicated otherwise. Use of the term “or” herein is not meant to imply that alternatives are mutually exclusive.
[0271] In this application, the use of “or” means “and/or” unless expressly stated or understood by one skilled in the art. In the context of a multiple dependent claim, the use of “or” refers back to more than one preceding independent or dependent claim.
[0272] The phrase “reference sample”, “reference cell”, or “reference tissue”, denote a sample with at least one known characteristic that can be used as a comparison to a sample with at least one unknown characteristic. In some embodiments, a reference sample can be used as a positive or negative indicator. A reference sample can be used to establish a level of protein and/or mRNA that is present in, for example, healthy tissue, in contrast to a level of protein and/or mRNA present in the sample with unknown characteristics. In some embodiments, the reference sample comes from the same subject, but is from a different part of the subject than that being tested. In some embodiments, the reference sample is from a tissue area surrounding or adjacent to the cancer. In some embodiments, the reference sample is not from the subject being tested, but is a sample from a subject known to have, or not to have, a disorder in question (for example, a particular cancer or T cell related disorder). In some embodiments, the reference sample is from the same subject, but from a point in time before the subject developed cancer. In some embodiments, the reference sample is from a benign cancer sample, from the same or a different subject. When a negative reference sample is used for comparison, the level of expression or amount of the molecule in question in the negative reference sample will indicate a level at which one of skill in the art will appreciate, given the present disclosure, that there is no and/or a low level of the molecule. When a positive reference sample is used for comparison, the level of expression or amount of the molecule in question in the positive reference sample will indicate a level at which one of skill in the art will appreciate, given the present disclosure, that there is a level of the molecule.
[0273] The terms “benefit”, “clinical benefit”, “responsiveness”, and “therapeutic responsiveness” as used herein in the context of benefiting from or responding to administration of a therapeutic agent, can be measured by assessing various endpoints, e.g., inhibition, to some extent, of disease progression, including slowing down and complete arrest; reduction in the number of disease episodes and/or symptoms; reduction in lesion size; inhibition (that is, reduction, slowing down or complete stopping) of disease cell infiltration into adjacent peripheral organs and/or tissues; inhibition (that is, reduction, slowing down or complete stopping) of disease spread; relief, to some extent, of one or more symptoms associated with the disorder; increase in the length of disease-free presentation following treatment, for example, progression-free survival; increased overall survival; higher response rate; and/or decreased mortality at a given point of time following treatment. A subject or cancer that is “non-responsive” or “fails to respond” is one that has failed to meet the above noted qualifications to be “responsive”.
[0274] The terms “nucleic acid molecule”, “nucleic acid” and “polynucleotide” may be used interchangeably, and refer to a polymer of nucleotides. Such polymers of nucleotides may contain natural and/or non-natural nucleotides, and include, but are not limited to, DNA, RNA, and PNA. “Nucleic acid sequence” refers to the linear sequence of nucleotides comprised in the nucleic acid molecule or polynucleotide.
[0275] The terms “polypeptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. Furthermore, for purposes of the present disclosure, a “polypeptide” refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification. “Amino acid sequence” refers to the linear sequence of amino acids comprised in a polypeptide or protein.
[0276] “IL-2” or “Interleukin-2” as used herein refers to any native, mature IL-2 that results from processing of an IL-2 precursor in a cell. The term includes IL-2 from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus or rhesus monkeys) and rodents (e.g., mice and rats), unless otherwise indicated. The term also includes naturally-occurring variants of IL-2, such as splice variants or allelic variants. A nonlimiting exemplary human IL-2 amino acid sequence is shown, e.g., in GenBank Accession No. NP 000577.2. See SEQ ID NO. 1 (mature form).
[0277] “Modified IL-2” as used herein refers to a polypeptide that differs from a wild type IL-2 amino acid sequence by a substitution at at least one amino acid position.
[0278] The term “specifically binds” to an antigen or epitope is a term that is well understood in the art, and methods to determine such specific binding are also well known in the art. A molecule is said to exhibit “specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antigen binding domain “specifically binds” or “preferentially binds” to an antigen if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. For example, a sdAb or VHH-containing polypeptide that specifically or preferentially binds to an epitope is a sdAb or VHH-containing polypeptide that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other epitopes on the same target antigen or epitopes on other target antigens. It is also understood by reading this definition that; for example, an antigen binding domain that specifically or preferentially binds to a first antigen may or may not specifically or preferentially bind to a second antigen. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding. “Specificity” refers to the ability of a binding protein to selectively bind an antigen.
[0279] As used herein, the term “modulate” with regard to the activity of IL-2 refers to a change in the activity of IL-2. In some embodiments, “modulate” refers to an increase in IL-2 activity.
[0280] As used herein, the term “epitope” refers to a site on a target molecule (for example, an antigen, such as a protein, nucleic acid, carbohydrate or lipid) to which an antigen binding molecule (for example, an antigen binding domain-containing polypeptide) binds. Epitopes often include a chemically active surface grouping of molecules such as amino acids, polypeptides or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics. Epitopes can be formed both from contiguous and/or juxtaposed noncontiguous residues (for example, amino acids, nucleotides, sugars, lipid moiety) of the target molecule. Epitopes formed from contiguous residues (for example, amino acids, nucleotides, sugars, lipid moiety) typically are retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding typically are lost on treatment with denaturing solvents. An epitope may include but is not limited to at least 3, at least 5 or 8-10 residues (for example, amino acids or nucleotides). In some embodiments, an epitope is less than 20 residues (for example, amino acids or nucleotides) in length, less than 15 residues or less than 12 residues. Two antibodies may bind the same epitope within an antigen if they exhibit competitive binding for the antigen. In some embodiments, an epitope can be identified by a certain minimal distance to a CDR residue on the antigen binding molecule. In some embodiments, an epitope can be identified by the above distance, and further limited to those residues involved in a bond (for example, a hydrogen bond) between a residue of the antigen binding molecule and an antigen residue. An epitope can be identified by various scans as well, for example an alanine or arginine scan can indicate one or more residues that the antigen binding molecule can interact with. Unless explicitly denoted, a set of residues as an epitope does not exclude other residues from being part of the epitope for a particular antigen binding domain or molecule. Rather, the presence of such a set designates a minimal series (or set of species) of epitopes. Thus, in some embodiments, a set of residues identified as an epitope designates a minimal epitope of relevance for the antigen, rather than an exclusive list of residues for an epitope on an antigen.
[0281] A “nonlinear epitope” or “conformational epitope” comprises noncontiguous polypeptides, amino acids and/or sugars within the antigenic protein to which an antigen binding molecule (for example, an antigen binding domain-containing polypeptide) specific to the epitope binds. In some embodiments, at least one of the residues will be noncontiguous with the other noted residues of the epitope; however, one or more of the residues can also be contiguous with the other residues.
[0282] A “linear epitope” comprises contiguous polypeptides, amino acids and/or sugars within the antigenic protein to which an antigen-binding molecule (for example, an antigen binding domain-containing polypeptide) specific to the epitope binds. It is noted that, in some embodiments, not every one of the residues within the linear epitope need be directly bound (or involved in a bond) by the antigen binding molecule. In some embodiments, linear epitopes can be from immunizations with a peptide that effectively consisted of the sequence of the linear epitope, or from structural sections of a protein that are relatively isolated from the remainder of the protein (such that the antigen binding molecule can interact, at least primarily), just with that sequence section.
[0283] The terms “antibody” and “antigen binding molecule” are used interchangeably in the broadest sense and encompass various polypeptides that comprise antigen binding domains, including but not limited to conventional antibodies (typically comprising at least one heavy chain and at least one light chain), single-domain antibodies (sdAbs, comprising just one chain, which is typically similar to a heavy chain), VHH-containing polypeptides (polypeptides comprising at least one heavy chain only antibody variable domain, or VHH), and fragments of any of the foregoing so long as they exhibit the desired antigen binding activity. In some embodiments, an antibody comprises a dimerization domain. Such dimerization domains include, but are not limited to, heavy chain constant domains (comprising CH1, hinge, CH2, and CH3, where CH1 typically pairs with a light chain constant domain, CL, while the hinge mediates dimerization) and Fc regions (comprising hinge, CH2, and CH3, where the hinge mediates dimerization). The term antibody also includes, but is not limited to, chimeric antibodies, humanized antibodies, and antibodies of various species such as camelid (including llama), shark, mouse, human, cynomolgus monkey, etc.
[0284] The terms “single domain antibody” and “sdAb” are used interchangeably herein to refer to an antibody having a single, monomeric domain, typically a heavy chain (or VHH), without a light chain.
[0285] The term “VHH” or “VHH domain” or “VHH antigen binding domain” as used herein refers to the antigen binding portion of a single-domain antibody, such as a camelid antibody or shark antibody. In some embodiments, a VHH comprises three CDRs and four framework regions, designated FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. In some embodiments, a VHH may be truncated at the N-terminus or C-terminus such that it comprises only a partial FR1 and/or FR4, or lacks one or both of those framework regions, so long as the VHH substantially maintains antigen binding and specificity.
[0286] The term “VHH-containing polypeptide” refers to a polypeptide that comprises at least one VHH domain. In some embodiments, a VHH polypeptide comprises two, three, or four or more VHH domains, wherein each VHH domain may be the same or different. In some embodiments, a VHH-containing polypeptide comprises an Fc region. In some such embodiments, the VHH polypeptide may form a dimer. Nonlimiting structures of VHH-containing polypeptides include VHH.sub.1-Fc, VHH.sub.1-VHH.sub.2-Fc, and VHH.sub.1-VHH.sub.2-VHH.sub.3-Fc, wherein VHH.sub.1, VHH.sub.2, and VHH.sub.3 may be the same or different. In some embodiments of such structures, one VHH may be connected to another VHH by a linker, or one VHH may be connected to the Fc by a linker. In some such embodiments, the linker comprises 1-20 amino acids, preferably 1-20 amino acids predominantly composed of glycine and, optionally, serine. In some embodiments, when a VHH-containing polypeptide comprises an Fc, it forms a dimer. Thus, the structure VHH.sub.1-VHH.sub.2-Fc, if it forms a dimer, is considered to be tetravalent (i.e., the dimer has four VHH domains). Similarly, the structure VHH.sub.1-VHH.sub.2-VHH.sub.3-Fc, if it forms a dimer, is considered to be hexavalent (i.e., the dimer has six VHH domains).
[0287] The term “monoclonal antibody” refers to an antibody (including an sdAb or VHH-containing polypeptide) of a substantially homogeneous population of antibodies, that is, the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. Thus, a sample of monoclonal antibodies can bind to the same epitope on the antigen. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies may be made by the hybridoma method first described by Kohler and Milstein, 1975, Nature 256:495, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567. The monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., 1990, Nature 348:552-554, for example.
[0288] The term “CDR” denotes a complementarity determining region as defined by at least one manner of identification to one of skill in the art. In some embodiments, CDRs can be defined in accordance with any of the Chothia numbering schemes, the Kabat numbering scheme, a combination of Kabat and Chothia, the AbM definition, and/or the contact definition. A VHH comprises three CDRs, designated CDR1, CDR2, and CDR3.
[0289] The term “heavy chain constant region” as used herein refers to a region comprising at least three heavy chain constant domains, C.sub.H1, hinge, C.sub.H2, and C.sub.H3. Of course, non-function-altering deletions and alterations within the domains are encompassed within the scope of the term “heavy chain constant region,” unless designated otherwise. Nonlimiting exemplary heavy chain constant regions include γ, δ, and α. Nonlimiting exemplary heavy chain constant regions also include ε and μ. Each heavy constant region corresponds to an antibody isotype. For example, an antibody comprising a γ constant region is an IgG antibody, an antibody comprising a δ constant region is an IgD antibody, and an antibody comprising an a constant region is an IgA antibody. Further, an antibody comprising a μ constant region is an IgM antibody, and an antibody comprising an c constant region is an IgE antibody. Certain isotypes can be further subdivided into subclasses. For example, IgG antibodies include, but are not limited to, IgG1 (comprising a γ.sub.1 constant region), IgG2 (comprising a γ.sub.2 constant region), IgG3 (comprising a γ.sub.3 constant region), and IgG4 (comprising a γ.sub.4 constant region) antibodies; IgA antibodies include, but are not limited to, IgA1 (comprising an α.sub.1 constant region) and IgA2 (comprising an α.sub.2 constant region) antibodies; and IgM antibodies include, but are not limited to, IgM1 and IgM2.
[0290] A “Fc region” as used herein refers to a portion of a heavy chain constant region comprising CH2 and CH3. In some embodiments, an Fc region comprises a hinge, CH2, and CH3. In various embodiments, when an Fc region comprises a hinge, the hinge mediates dimerization between two Fc-containing polypeptides. An Fc region may be of any antibody heavy chain constant region isotype discussed herein. In some embodiments, an Fc region is an IgG1, IgG2, IgG3, or IgG4.
[0291] An “acceptor human framework” as used herein is a framework comprising the amino acid sequence of a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as discussed herein. An acceptor human framework derived from a human immunoglobulin framework or a human consensus framework can comprise the same amino acid sequence thereof, or it can contain amino acid sequence changes. In some embodiments, the number of amino acid changes are fewer than 10, or fewer than 9, or fewer than 8, or fewer than 7, or fewer than 6, or fewer than 5, or fewer than 4, or fewer than 3, across all of the human frameworks in a single antigen binding domain, such as a VHH.
[0292] “Affinity” refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (for example, an antibody or VHH-containing polypeptide) and its binding partner (for example, an antigen). The affinity or the apparent affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D) or the K.sub.D-apparent, respectively. Affinity can be measured by common methods known in the art (such as, for example, ELISA K.sub.D, KinExA, flow cytometry, and/or surface plasmon resonance devices), including those described herein. Such methods include, but are not limited to, methods involving BIAcore®, Octet®, or flow cytometry.
[0293] The term “K.sub.D”, as used herein, refers to the equilibrium dissociation constant of an antigen binding molecule/antigen interaction. When the term “K.sub.D” is used herein, it includes K.sub.D and K.sub.D-apparent.
[0294] In some embodiments, the K.sub.D of the antigen binding molecule is measured by flow cytometry using an antigen-expressing cell line and fitting the mean fluorescence measured at each antibody concentration to a non-linear one-site binding equation (Prism Software graphpad). In some such embodiments, the K.sub.D is K.sub.D-apparent.
[0295] The term “biological activity” refers to any one or more biological properties of a molecule (whether present naturally as found in vivo, or provided or enabled by recombinant means). Biological properties include, but are not limited to, binding a ligand, inducing or increasing cell proliferation (such as T cell proliferation), and inducing or increasing expression of cytokines.
[0296] The term “IL-2 activity” or “biological activity” of IL-2, as used herein, includes any biological effect or at least one of the biologically relevant functions of IL-2. In some embodiments, IL-2 activity includes the ability of IL-2 to induce T cell proliferation and/or activate natural killer (NK) cells. Nonlimiting exemplary IL-2 activities include increasing pSTAT5 expression, increasing proliferation of CD4.sup.+ and/or CD8.sup.+ T cells, increasing CD71 expression on T cells, and reducing the suppressive activity of Treg cells on CD4.sup.+ and CD8.sup.+ T cell activation and proliferation.
[0297] An “agonist” or “activating” antibody (such as a sdAb or VHH-containing polypeptide) is one that increases and/or activates a biological activity of the target antigen. In some embodiments, the agonist antibody binds to an antigen and increases its biologically activity by at least about 20%, 40%, 60%, 80%, 85% or more.
[0298] An “antagonist”, a “blocking” or “neutralizing” antibody is one that decreases and/or inactivates a biological activity of the target antigen. In some embodiments, the neutralizing antibody binds to an antigen and reduces its biologically activity by at least about 20%, 40%, 60%, 80%, 85% 90%, 95%, 99% or more.
[0299] An “affinity matured” VHH-containing polypeptide refers to a VHH-containing polypeptide with one or more alterations in one or more CDRs compared to a parent VHH-containing polypeptide that does not possess such alterations, such alterations resulting in an improvement in the affinity of the VHH-containing polypeptide for antigen.
[0300] A “humanized VHH” as used herein refers to a VHH in which one or more framework regions have been substantially replaced with human framework regions. In some instances, certain framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, the humanized VHH can comprise residues that are found neither in the original VHH nor in the human framework sequences, but are included to further refine and optimize VHH or VHH-containing polypeptide performance. In some embodiments, a humanized VHH-containing polypeptide comprises a human Fc region. As will be appreciated, a humanized sequence can be identified by its primary sequence and does not necessarily denote the process by which the antibody was created.
[0301] A “functional Fc region” possesses an “effector function” of a native sequence Fc region. Exemplary “effector functions” include Fc receptor binding; Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (for example B-cell receptor); and B-cell activation, etc. Such effector functions generally require the Fc region to be combined with a binding domain (for example, an antibody variable domain) and can be assessed using various assays.
[0302] A “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature. Native sequence human Fc regions include a native sequence human IgG1 Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
[0303] A “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification. In some embodiments, a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, yet retains at least one effector function of the native sequence Fc region. In some embodiments, the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, for example, from about one to about ten amino acid substitutions, and preferably, from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide. In some embodiments, the variant Fc region herein will possess at least about 80% sequence identity with a native sequence Fc region and/or with an Fc region of a parent polypeptide, at least about 90% sequence identity therewith, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity therewith.
[0304] “Fc receptor” or “FcR” describes a receptor that binds to the Fc region of an antibody. In some embodiments, an FcγR is a native human FcR. In some embodiments, an FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants and alternatively spliced forms of those receptors. FcγRII receptors include FcγRIIA (an “activating receptor”) and FcγRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcγRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain Inhibiting receptor FcγRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain. (See, for example, Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). FcRs are reviewed, for example, in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term “FcR” herein. For example, the term “Fc receptor” or “FcR” also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)) and regulation of homeostasis of immunoglobulins. Methods of measuring binding to FcRn are known (see, for example, Ghetie and Ward, Immunol. Today 18(12):592-598 (1997); Ghetie et al., Nature Biotechnology, 15(7):637-640 (1997); Hinton et al., J. Biol. Chem. 279(8):6213-6216 (2004); WO 2004/92219 (Hinton et al.).
[0305] The term “substantially similar” or “substantially the same,” as used herein, denotes a sufficiently high degree of similarity between two or more numeric values such that one of skill in the art would consider the difference between the two or more values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said value. In some embodiments the two or more substantially similar values differ by no more than about any one of 5%, 10%, 15%, 20%, 25%, or 50%.
[0306] A polypeptide “variant” means a biologically active polypeptide having at least about 80% amino acid sequence identity with the native sequence polypeptide after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Such variants include, for instance, polypeptides wherein one or more amino acid residues are added, or deleted, at the N- or C-terminus of the polypeptide. In some embodiments, a variant will have at least about 80% amino acid sequence identity. In some embodiments, a variant will have at least about 90% amino acid sequence identity. In some embodiments, a variant will have at least about 95% amino acid sequence identity with the native sequence polypeptide.
[0307] As used herein, “percent (%) amino acid sequence identity” and “homology” with respect to a peptide, polypeptide or antibody sequence are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEGALIGN™ (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
[0308] An amino acid substitution may include but are not limited to the replacement of one amino acid in a polypeptide with another amino acid. Exemplary substitutions are shown in Table 1. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, for example, retained/improved antigen or receptor binding, reduced antigen or receptor binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE-US-00001 TABLE 1 Original Residue Exemplary Substitutions Ala (A) Val; Leu; Ile Arg (R) Lys; Gln; Asn Asn (N) Gln; His; Asp, Lys; Arg Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn; Glu Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln; Lys; Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg; Gln; Asn Met (M) Leu; Phe; Ile Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ser (S) Thr Thr (T) Val; Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe; Thr; Ser Val (V) Ile; Leu; Met; Phe; Ala; Norleucine
[0309] Amino acids may be grouped according to common side-chain properties: [0310] (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; [0311] (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; [0312] (3) acidic: Asp, Glu; [0313] (4) basic: His, Lys, Arg; [0314] (5) residues that influence chain orientation: Gly, Pro; [0315] (6) aromatic: Trp, Tyr, Phe.
[0316] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0317] The term “vector” is used to describe a polynucleotide that can be engineered to contain a cloned polynucleotide or polynucleotides that can be propagated in a host cell. A vector can include one or more of the following elements: an origin of replication, one or more regulatory sequences (such as, for example, promoters and/or enhancers) that regulate the expression of the polypeptide of interest, and/or one or more selectable marker genes (such as, for example, antibiotic resistance genes and genes that can be used in colorimetric assays, for example, β-galactosidase). The term “expression vector” refers to a vector that is used to express a polypeptide of interest in a host cell.
[0318] A “host cell” refers to a cell that may be or has been a recipient of a vector or isolated polynucleotide. Host cells may be prokaryotic cells or eukaryotic cells. Exemplary eukaryotic cells include mammalian cells, such as primate or non-primate animal cells; fungal cells, such as yeast; plant cells; and insect cells. Nonlimiting exemplary mammalian cells include, but are not limited to, NSO cells, PER.C6® cells (Crucell), and 293F and CHO cells, and their derivatives, such as 293-6E, CHO-DG44, CHO-K1, CHO-S, and CHO-DS cells. Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation. A host cell includes cells transfected in vivo with a polynucleotide(s) a provided herein.
[0319] The term “isolated” as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature or produced. For example, a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in which it was produced. Where a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide. Similarly, a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, for example, in the case of an RNA polynucleotide. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated”.
[0320] The terms “individual” and “subject” are used interchangeably herein to refer to an animal; for example, a mammal. In some embodiments, methods of treating mammals, including, but not limited to, humans, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are provided. In some examples, an “individual” or “subject” refers to an individual or subject in need of treatment for a disease or disorder. In some embodiments, the subject to receive the treatment can be a patient, designating the fact that the subject has been identified as having a disorder of relevance to the treatment, or being at adequate risk of contracting the disorder.
[0321] A “disease” or “disorder” as used herein refers to a condition where treatment is needed and/or desired.
[0322] The term “tumor cell”, “cancer cell”, “cancer”, “tumor”, and/or “neoplasm”, unless otherwise designated, are used herein interchangeably and refer to a cell (or cells) exhibiting an uncontrolled growth and/or abnormal increased cell survival and/or inhibition of apoptosis which interferes with the normal functioning of bodily organs and systems. Included in this definition are benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases.
[0323] The terms “cancer” and “tumor” encompass solid and hematological/lymphatic cancers and also encompass malignant, pre-malignant, and benign growth, such as dysplasia. Also, included in this definition are cells having abnormal proliferation that is not impeded (e.g. immune evasion and immune escape mechanisms) by the immune system (e.g. virus infected cells). Exemplary cancers include, but are not limited to: basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer (including gastrointestinal cancer); glioblastoma; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; liver cancer; lung cancer (e.g., small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung); melanoma; myeloma; neuroblastoma; oral cavity cancer (lip, tongue, mouth, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; cancer of the respiratory system; salivary gland carcinoma; sarcoma; skin cancer; squamous cell cancer; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulval cancer; lymphoma including Hodgkin's and non-Hodgkin's lymphoma, as well as B-cell lymphoma (including low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's Macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic myeloblastic leukemia; as well as other carcinomas and sarcomas; and post-transplant lymphoproliferative disorder (PTLD), as well as abnormal vascular proliferation associated with phakomatoses, edema (such as that associated with brain tumors), and Meigs' syndrome.
[0324] The term “non-tumor cell” as used herein refers to a normal cells or tissue. Exemplary non-tumor cells include, but are not limited to: T cells, B-cells, natural killer (NK) cells, natural killer T (NKT) cells, dendritic cells, monocytes, macrophages, epithelial cells, fibroblasts, hepatocytes, interstitial kidney cells, fibroblast-like synoviocytes, osteoblasts, and cells located in the breast, skeletal muscle, pancreas, stomach, ovary, small intestines, placenta, uterus, testis, kidney, lung, heart, brain, liver, prostate, colon, lymphoid organs, bone, and bone-derived mesenchymal stem cells. The term “a cell or tissue located in the periphery” as used herein refers to non-tumor cells not located near tumor cells and/or within the tumor microenvironment.
[0325] The term “cells or tissue within the tumor microenvironment” as used herein refers to the cells, molecules, extracellular matrix and/or blood vessels that surround and/or feed a tumor cell. Exemplary cells or tissue within the tumor microenvironment include, but are not limited to: tumor vasculature; tumor-infiltrating lymphocytes; fibroblast reticular cells; endothelial progenitor cells (EPC); cancer-associated fibroblasts; pericytes; other stromal cells; components of the extracellular matrix (ECM); dendritic cells; antigen presenting cells; T cells; regulatory T cells (Treg cells); macrophages; neutrophils; myeloid-derived suppressor cells (MDSCs) and other immune cells located proximal to a tumor. Methods for identifying tumor cells, and/or cells/tissues located within the tumor microenvironment are well known in the art, as described herein, below.
[0326] In some embodiments, an “increase” or “decrease” refers to a statistically significant increase or decrease, respectively. As will be clear to the skilled person, “modulating” can also involve effecting a change (which can either be an increase or a decrease) in affinity, avidity, specificity and/or selectivity of a target or antigen, for one or more of its ligands, binding partners, partners for association into a homomultimeric or heteromultimeric form, or substrates; effecting a change (which can either be an increase or a decrease) in the sensitivity of the target or antigen for one or more conditions in the medium or surroundings in which the target or antigen is present (such as pH, ion strength, the presence of co-factors, etc.); and/or cellular proliferation or cytokine production, compared to the same conditions but without the presence of a test agent. This can be determined in any suitable manner and/or using any suitable assay known per se or described herein, depending on the target involved.
[0327] As used herein, “an immune response” is meant to encompass cellular and/or humoral immune responses that are sufficient to inhibit or prevent onset or ameliorate the symptoms of disease (for example, cancer or cancer metastasis). “An immune response” can encompass aspects of both the innate and adaptive immune systems.
[0328] As used herein, “treatment” is an approach for obtaining beneficial or desired clinical results. “Treatment” as used herein, covers any administration or application of a therapeutic for disease in a mammal, including a human. For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, any one or more of: alleviation of one or more symptoms, diminishment of extent of disease, preventing or delaying spread (for example, metastasis, for example metastasis to the lung or to the lymph node) of disease, preventing or delaying recurrence of disease, delay or slowing of disease progression, amelioration of the disease state, inhibiting the disease or progression of the disease, inhibiting or slowing the disease or its progression, arresting its development, and remission (whether partial or total). Also encompassed by “treatment” is a reduction of pathological consequence of a proliferative disease. The methods provided herein contemplate any one or more of these aspects of treatment. In-line with the above, the term treatment does not require one-hundred percent removal of all aspects of the disorder.
[0329] “Ameliorating” means a lessening or improvement of one or more symptoms as compared to not administering a therapeutic agent. “Ameliorating” also includes shortening or reduction in duration of a symptom.
[0330] The term “anti-cancer agent” is used herein in its broadest sense to refer to agents that are used in the treatment of one or more cancers. Exemplary classes of such agents in include, but are not limited to, chemotherapeutic agents, anti-cancer biologics (such as cytokines, receptor extracellular domain-Fc fusions, and antibodies), radiation therapy, CAR-T therapy, therapeutic oligonucleotides (such as antisense oligonucleotides and siRNAs) and oncolytic viruses.
[0331] The term “biological sample” means a quantity of a substance from a living thing or formerly living thing. Such substances include, but are not limited to, blood, (for example, whole blood), plasma, serum, urine, amniotic fluid, synovial fluid, endothelial cells, leukocytes, monocytes, other cells, organs, tissues, bone marrow, lymph nodes and spleen.
[0332] The term “control” or “reference” refers to a composition known to not contain an analyte (“negative control”) or to contain an analyte (“positive control”). A positive control can comprise a known concentration of analyte.
[0333] The terms “inhibition” or “inhibit” refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To “reduce” or “inhibit” is to decrease, reduce or arrest an activity, function, and/or amount as compared to a reference. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 10% or greater. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 50% or greater. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater. In some embodiments, the amount noted above is inhibited or decreased over a period of time, relative to a control over the same period of time.
[0334] As used herein, “delaying development of a disease” means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
[0335] “Preventing,” as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease. Unless otherwise specified, the terms “reduce”, “inhibit”, or “prevent” do not denote or require complete prevention over all time, but just over the time period being measured.
[0336] A “therapeutically effective amount” of a substance/molecule, agonist or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects. A therapeutically effective amount may be delivered in one or more administrations. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic and/or prophylactic result.
[0337] The terms “pharmaceutical formulation” and “pharmaceutical composition” refer to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulations may be sterile.
[0338] A “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and are compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed.
[0339] Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and sequential administration in any order.
[0340] The term “concurrently” is used herein to refer to administration of two or more therapeutic agents, where at least part of the administration overlaps in time, or where the administration of one therapeutic agent falls within a short period of time relative to administration of the other therapeutic agent, or wherein the therapeutic effects of both agents overlap for at least a period of time.
[0341] The term “sequentially” is used herein to refer to administration of two or more therapeutic agents that does not overlap in time, or wherein the therapeutic effects of the agents do not overlap.
[0342] As used herein, “in conjunction with” refers to administration of one treatment modality in addition to another treatment modality. As such, “in conjunction with” refers to administration of one treatment modality before, during, or after administration of the other treatment modality to the individual.
[0343] The term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
[0344] An “article of manufacture” is any manufacture (for example, a package or container) or kit comprising at least one reagent, for example, a medicament for treatment of a disease or disorder (for example, cancer), or a probe for specifically detecting a biomarker described herein. In some embodiments, the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.
[0345] The terms “label” and “detectable label” mean a moiety attached, for example, to an antibody or antigen to render a reaction (for example, binding) between the members of the specific binding pair, detectable. The labeled member of the specific binding pair is referred to as “detectably labeled.” Thus, the term “labeled binding protein” refers to a protein with a label incorporated that provides for the identification of the binding protein. In some embodiments, the label is a detectable marker that can produce a signal that is detectable by visual or instrumental means, for example, incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (for example, .sup.3H, .sup.14C, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I, .sup.177Lu, .sup.166Ho, or .sup.153Sm); chromogens, fluorescent labels (for example, FITC, rhodamine, lanthanide phosphors), enzymatic labels (for example, horseradish peroxidase, luciferase, alkaline phosphatase); chemiluminescent markers; biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (for example, leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates. Representative examples of labels commonly employed for immunoassays include moieties that produce light, for example, acridinium compounds, and moieties that produce fluorescence, for example, fluorescein. In this regard, the moiety itself may not be detectably labeled but may become detectable upon reaction with yet another moiety.
Exemplary Modified IL-2-Containing Polypeptides
[0346] Polypeptides comprising a modified IL-2 are provided herein. In some embodiments, the modified IL-2 comprises at least one amino acid substitution that reduces the affinity of the modified IL-2 for an IL-2 receptor compared to a wild type IL-2. In various embodiments, the polypeptide comprising a modified IL-2 provided herein is an agonist of an IL-2R. In some embodiments, the modified IL-2 is a modified human IL-2, and the IL-2R is a human IL-2R. In some embodiments, the modified IL-2 binds a human IL-2R with an affinity at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 50-fold, or at least 100-fold lower than the affinity of human wild type IL-2 for the IL-2R.
[0347] In various embodiments, the polypeptides comprising a modified IL-2 comprise at least one antigen binding domain that binds a T cell or natural killer (NK) cell antigen. In some embodiments, a polypeptide comprising a modified IL-2 provided herein comprises one, two, three, four, five, six, seven, or eight antigen binding domains, wherein at least one, or all, bind a T cell or natural killer cell antigen. In some embodiments, a polypeptide comprising a modified IL-2 provided herein comprises one, two, three, or four antigen binding domains, wherein at least one, or all, bind a T cell or natural killer cell antigen. In some embodiments, the modified IL-2 containing polypeptide does not bind or activate IL-2R in the absence of an antigen binding domain. In some embodiments, the modified IL-2 containing polypeptide binds and/or activates IL-2R on a cell only when the polypeptide comprises an antigen binding domain that is bound to an antigen on the same cell as the IL-2R.
[0348] In various embodiments, a modified IL-2 comprises at least one substitution at at least one amino acid position selected from L19, Q22, R38, E61, N88, R120, T123, Q126, 5127, 1129, and S130. In some embodiments, a modified IL-2 comprises at least one substitution at at least one amino acid position selected from T3, P65, H16, D84, M23, E95, and C125. In some embodiments, a modified IL-2 comprises substitutions at at least one amino acid position selected from L19, Q22, R38, E61, N88, R120, T123, Q126, S127, I129, and S130, and at amino acid positions T3, P65, H16, D84, and C125. In some such embodiments, the modified IL-2 further comprises substitutions at amino acid positions M23 and/or E95.
[0349] In some embodiments, the substitution at amino acid position L19 is selected from L19A, L19N, L19P, L19Q, L19Y, L19S, L19T, and L19V. In some embodiments, the substitution at amino acid position Q22 is selected from Q22A, Q22D, Q22G, Q22H, Q22K, Q22N, Q22R, Q22S, Q22T, Q22V, and Q22Y. In some embodiments, the substitution at amino acid position R38 is R38A or R38G. In some embodiments, the substitution at amino acid position E61 is selected from E61A, E61P, E61G, E61H, E61Q, E61N, E61R, E61S, E61T, E61K, and E61Y. In some embodiments, the substitution at amino acid position N88 is selected from N88A, N88S, and N88T. In some embodiments, the substitution at amino acid position R120 is selected from R120A, R120D, R120G, R120H, R120E, R120F, R120K, R120N, R120P, R120Q, R120S, R120V, and R120Y. In some embodiments, the substitution at amino acid position T123 is selected from T123D, T123E, T123H, T123K, T123N, T123R, and T123Q. In some embodiments, the substitution at amino acid position Q126 is selected from Q126A, Q126N, and Q126Y. In some embodiments, the substitution at amino acid position 5127 is selected from S127E, S127D, S127N, S127H, S127P, S127Q, and, S127R. In some embodiments, the substitution at amino acid position I129 is selected from I129A, I129H, I129R, and I129S. In some embodiments, the substitution at amino acid position S130 is selected from S130D, S130P, S130E, S130K, S130N, S130R, S130H, and S130Q.
[0350] In some embodiments, the substitution at amino acid position P65 is selected from P65R, P65E, P65K, P65H, P65Y, P65Q, P65D, and P65N. In some embodiments, the substitution at amino acid position H16 is selected from H16A, H16N, H16T, and H16V. In some embodiments, the substitution at amino acid position D84 is selected from D84S, D84N, D84G, D84A, D84T, D84V, and D84Y. In some embodiments, the substitution at amino acid position M23 is selected from M23A, M23R, M23Q, M23N, M23L, M23K, M23G, M23E, M23D, M23S, M23T, and M23V. In some embodiments, the substitution at amino acid position E95 is selected from E95Q, E95Y, E95G, E95T, E95V, E95P, E95H, and E95N.
[0351] In some embodiments, the substitution at amino acid position T3 is selected from T3A and T3G. In some embodiments, the substitution at amino acid position C125 is selected from C125A and C125S.
[0352] In some embodiments, the modified IL-2 further comprises a substitution at amino acid position F42. In some such embodiments, the substitution at F42 is selected from F42K, F42A, F42R, F42G, F42S, and F42T.
[0353] In some embodiments, the modified IL-2 further comprises at least one substitution at at least one amino acid position selected from Y45 and L72. In some such embodiments, the modified IL-2 comprises at least one substitution selected from Y45R, Y45K, and L72G.
[0354] In some embodiments, the modified IL-2 comprises substitutions T3A, P65R, H16A, D84Y, and C125S. In some embodiments, the modified IL-2 comprises substitutions T3A, P65R, H16A, D84Y, and C125S and comprises one or more substitutions at at least one position selected from L19, Q22, R38, E61, N88, R120, T123, Q126, S127, I129, and S130. In some embodiments, the modified IL-2 comprises substitutions T3A, P65R, H16A, D84S, and C125S and comprises one or more substitutions at at least one position selected from L19, Q22, R38, E61, N88, R120, T123, Q126, S127, I129, and S130. In some embodiments, the modified IL-2 comprises substitutions T3A, P65R, H16A, D84Y, C125S, and E61R. In some embodiments, the modified IL-2 comprises substitutions T3A, P65R, H16A, D84Y, C125S, and E61R and comprises at least one substitution selected from L19N, M23T, E95Q, and S127D. In some embodiments, the modified IL-2 comprises substitutions
[0355] a) T3A, H16A, E61R, P65R, D84Y, and C125S,
[0356] b) T3A, H16A, M23T, E61R, P65R, D84Y, E95Q, and C125S,
[0357] c) T3A, H16A, L19N, E61R, P65R, D84Y, and C125S,
[0358] d) T3A, H16A, L19N, M23T, E61R, P65R, D84Y, E95Q, and C125S,
[0359] e) T3A, H16A, E61R, P65R, D84Y, C125S, and S127D,
[0360] f) T3A, H16A, M23T, E61R, P65R, D84Y, E95Q, C125S, and S127D,
[0361] g) T3A, H16A, L19N, E61R, P65R, D84Y, C125S, and S127D, or
[0362] h) T3A, H16A, L19N, M23T, E61R, P65R, D84Y, E95Q, C125S, and S127D.
[0363] In any of the embodiments described herein, the modified IL-2 may be a modified human IL-2. In various embodiments, the amino acid positions of the substitutions correspond to the amino acid positions in SEQ ID NO: 1.
[0364] In some embodiments, the modified IL-2 comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 84, and including amino acid substitutions corresponding to the substitutions in an amino acid sequence selected from SEQ ID NOs: 105-277 listed in the Description column of the Table of Certain Sequences. A corresponding substitution means the same amino acid when the two sequences are aligned. For example, SEQ ID NO: 106 comprises substitutions T3A, E61R, P65R, and C125S. If SEQ ID NO: 84 and SEQ ID NO: 106 are aligned, position E61 in SEQ ID NO: 106 corresponds to sequential position E51 in SEQ ID NO: 84. T3 of SEQ ID NO: 106 has no corresponding position in SEQ ID NO: 84, because the corresponding amino acid is not present. Therefore, SEQ ID NO: 84 comprising the substitutions of SEQ ID NO: 106 at positions corresponding to those of SEQ ID NO: 106 comprises mutations corresponding to E61R, P65R, and C125S, which in SEQ ID NO: 84 would be E51R, P55R, and C115S, respectively. In some embodiments, the modified IL-2 comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 84, and including a substitution at at least one position corresponding to a position selected from L19, Q22, R38, E61, N88, R120, T123, Q126, S127, I129, and S130 of SEQ ID NO: 1.
[0365] In some embodiments, the modified IL-2 comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 105-290, and including the substitutions indicated in the Description in the Table of Certain Sequences for the respective amino acid sequence. In some embodiments, the modified IL-2 comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 105-290, and including a substitution at at least one position selected from L19, Q22, R38, E61, N88, R120, T123, Q126, S127, I129, and S130. In some embodiments, the modified IL-2 comprises an amino acid sequence selected from SEQ ID NOs: 105-290. In some embodiments, the modified IL-2 comprises an amino acid sequence selected from SEQ ID NOs: 270-277.
[0366] In some embodiments, a modified IL-2 containing polypeptide comprises at least one antigen binding domain that binds a T cell or natural killer cell antigen and an Fc region. In some embodiments, a modified IL-2 containing polypeptide provided herein comprises one, two, three, or four antigen binding domains and an Fc region. In some embodiments, an Fc region mediates dimerization of the modified IL-2 containing polypeptide at physiological conditions such that a dimer is formed that doubles the number of antigen binding sites. For example, a modified IL-2 containing polypeptide comprising three antigen binding domains and an Fc region is trivalent as a monomer, but at physiological conditions, the Fc region may mediate dimerization, such that the modified IL-2 containing polypeptide exists as a hexavalent dimer under such conditions.
[0367] In various embodiments, a polypeptide comprising a modified IL-2 comprises a sequence selected from SEQ ID NOs: 105-290. In various embodiments, a polypeptide comprising a modified IL-2 comprises a sequences selected from SEQ ID NO: 270-277. In some embodiments, the polypeptide further comprises an antigen binding domain. In some embodiments, the antigen binding domain is humanized.
[0368] In some embodiments, the at least one antigen binding domain is a natural or native cognate binding partner, an Anticalin (engineered lipocalin), a Darpin, a Fynomer, a Centyrin (engineered fibroneticin III domain), a cystine-knot domain, an Affilin, an Affibody, or an engineered CH3 domain. In some embodiments, the natural cognate binding partner comprises a ligand or an extracellular domain, or binding fragment thereof, of the native cognate binding partner of the tumor associated antigen (TAA), or a variant thereof that exhibits binding activity to the TAA.
[0369] In some embodiments, the polypeptide comprising the modified IL-2 and at least one antigen binding domain enhances anti-tumor T cell responses or natural killer cell responses while avoiding Tregs, peripheral T cells, and endothelial cells. In some such embodiments, the at least one antigen binding domain targets the modified IL-2 to activated T cells. In some embodiments, the modified IL-2 binds and modulates an IL-2R only when the IL-2R is on the same cell as the antigen bound by the at least one antigen binding domain. In some embodiments, the modified IL-2 does not bind or activate an IL-2R when the IL-2R is on a different cell than the cell expressing the antigen bound by the at least one antigen binding domain.
[0370] In various embodiments, the antigen-binding domain binds to a protein selected from PD-1, CTLA-4, LAG3, TIM3, 4-1BB, OX40, GITR, CD8a, CD8b, CD4, NKp30, NKG2A, TIGIT, TGFβR1, TGFβR2, Fas, NKG2D, NKp46, PD-L1, CD107a, ICOS, TNFR2, CD16a, and γδTCR. In some embodiments, the polypeptide comprising a modified IL-2 comprises an antigen-binding domain of nivolumab (BMS; PD-1); pembrolizumab (Merck; PD-1); AMP-514 (Amplimmune; PD-1); TSR-042 (Tesaro/AnaptysBio, ANB-011; PD-1); STI-A1110 (Sorrento Therapeutics; PD-1), ipilimumab (BMS; CTLA-4); tremelimumab (AstraZeneca, CTLA-4); urelumab (BMS, 4-1BB); utomilumab (Pfizer, 4-1BB); atezolizumab (Roche, PD-L1), durvalumab (AstraZeneca, PD-L1); monalizumab (NKG2A, Innate Pharma and AstraZeneca); BMS-986016 (Bristo-Meyers Squibb, LAG-3).
[0371] In some embodiments, the polypeptide comprises at least one antigen binding domain that specifically binds to PD-1. In some embodiments, the polypeptide comprises at least one antigen binding domain that specifically binds to LAG3. In some embodiments, the polypeptide comprises at least one antigen binding domain that specifically binds to NKp46. In some embodiments, the polypeptide comprises at least one antigen binding domain that specifically binds to NKG2D. In some embodiments, the polypeptide comprises at least one antigen binding domain that specifically binds to CD8a.
[0372] In some embodiments, an antigen binding domain may be humanized. Polypeptides comprising humanized antigen binding domains (such as VHH-containing polypeptides) are useful as therapeutic molecules because humanized antigen binding domains and humanized antibodies reduce or eliminate the human immune response to non-human antibodies, which can result in an immune response to an antibody therapeutic, and decreased effectiveness of the therapeutic. Generally, a humanized antigen binding domain or humanized antibody comprises one or more variable domains in which CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antigen binding domain or humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antigen binding domain or humanized antibody are substituted with corresponding residues from a non-human antibody (for example, the antibody from which the CDR residues are derived), for example, to restore or improve antibody specificity or affinity.
[0373] Humanized antibodies and methods of making them are reviewed, for example, in Almagro and Fransson, (2008)Front. Biosci. 13: 1619-1633, and are further described, for example, in Riechmann et al., (1988) Nature 332:323-329; Queen et al., (1989) Proc. Natl Acad. Sci. USA 86: 10029-10033; U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., (2005) Methods 36:25-34; Padlan, (1991) Mol. Immunol. 28:489-498 (describing “resurfacing”); Dall'Acqua et al., (2005) Methods 36:43-60 (describing “FR shuffling”); and Osbourn et al., (2005) Methods 36:61-68 and Klimka et al., (2000) Br. J. Cancer, 83:252-260 (describing the “guided selection” approach to FR shuffling).
[0374] Human framework regions that can be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, for example, Sims et al. (1993) J. Immunol. 151:2296); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of heavy chain variable regions (see, for example, Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; and Presta et al. (1993) J. Immunol, 151:2623); human mature (somatically mutated) framework regions or human germline framework regions (see, for example, Almagro and Fransson, (2008)Front. Biosci. 13:1619-1633); and framework regions derived from screening FR libraries (see, for example, Baca et al., (1997) J. Biol. Chem. 272: 10678-10684 and Rosok et al., (1996) J. Biol. Chem. 271:22611-22618). Typically, the FR regions of a VHH are replaced with human FR regions to make a humanized VHH. In some embodiments, certain FR residues of the human FR are replaced in order to improve one or more properties of the humanized VHH. VHH domains with such replaced residues are still referred to herein as “humanized.”
[0375] In various embodiments, an Fc region included in a modified IL-2 containing polypeptide is a human Fc region, or is derived from a human Fc region.
[0376] In some embodiments, an Fc region included in a modified IL-2 containing polypeptide is derived from a human Fc region, and comprises a three amino acid deletion in the lower hinge corresponding to IgG1 E233, L234, and L235, herein referred to as “Fc xELL” Fc xELL polypeptides do not engage FcγRs and thus are referred to as “effector silent” or “effector null”, however in some embodiments, xELL Fc regions bind FcRn and therefore have extended half-life and transcytosis associated with FcRn mediated recycling.
[0377] In some embodiments, the Fc region included in a modified IL-2 containing polypeptide is derived from a human Fc region and comprises mutations M252Y and M428V, herein referred to as “Fc-YV”. In some embodiments, the Fc region included in a modified IL-2 containing polypeptide is derived from a human Fc region and comprises mutations M252Y and M428L, herein referred to as “Fc-YL”. In some embodiments, such mutations enhance binding to FcRn at the acidic pH of the endosome (near 6.5), while losing detectable binding at neutral pH (about 7.2), allowing for enhanced FcRn mediated recycling and extended half-life.
[0378] In some embodiments, the Fc region included in a modified IL-2 containing polypeptide herein is derived from a human Fc region and comprises mutations designed for heterodimerization, herein referred to as “knob” and “hole”. In some embodiments, the “knob” Fc region comprises the mutation T366W. In some embodiments, the “hole” Fc region comprises mutations T366S, L368A, and Y407V. In some embodiments, Fc regions used for heterodimerization comprise additional mutations, such as the mutation S354C on a first member of a heterodimeric Fc pair that forms an asymmetric disulfide with a corresponding mutation Y349C on the second member of a heterodimeric Fc pair. In some embodiments, one member of a heterodimeric Fc pair comprises the modification H435R or H435K to prevent protein A binding while maintaining FcRn binding. In some embodiments, one member of a heterodimeric Fc pair comprises the modification H435R or H435K, while the second member of the heterodimeric Fc pair is not modified at H435. In various embodiments, the hole Fc region comprises the modification H435R or H435K (referred to as “hole-R” in some instances when the modification is H435R), while the knob Fc region does not. In some instances, the hole-R mutation improves purification of the heterodimer over homodimeric hole Fc regions that may be present.
[0379] Nonlimiting exemplary Fc regions that may be used in a modified IL-2 containing polypeptide include Fc regions comprising the amino acid sequences of SEQ ID NOs: 47-83, 292, and 293.
[0380] In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 105-290 and an Fc region fused to the C-terminus of that amino acid sequence. In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 270-277 and an Fc region fused to the C-terminus of that amino acid sequence. In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 105-290 and an Fc region fused to the N-terminus of that amino acid sequence. In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 270-277 and an Fc region fused to the N-terminus of that amino acid sequence. In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 105-290 and an amino acid sequence selected from SEQ ID NOs: 47-83, 292, and 293. In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 105-290 and an amino acid sequence selected from SEQ ID NOs: 48, 64, 292, and 293. In some embodiments, a modified IL-2 containing polypeptide that comprises at least one antigen binding domain and an Fc region comprises an amino acid sequence selected from SEQ ID NOs: 270-277 and an amino acid sequence selected from SEQ ID NOs: 48, 64, 292, and 293. In some embodiments the polypeptide comprises an amino acid sequences selected from SEQ ID NOs: 105-290 and an antigen binding domain that binds an antigen expressed on a T cell or natural killer cell. In some embodiments, the polypeptide comprises an amino acid sequence selected from SEQ ID NOs: 270-277 and an antigen binding domain that binds an antigen expressed on a T cell or natural killer cell.
Exemplary Activities of Modified IL-2 Containing Polypeptides
[0381] In various embodiments, the modified IL-2 containing polypeptides provided herein are agonists of IL-2R activity. Agonist activity may be determined, in some embodiments, using the methods provided in the Examples herein, such as using 293F cells or similar cells. In some embodiments, the modified IL-2 containing polypeptides provided herein are agonists of IL-2R activity when targeted to T cells, but show little or no agonist activity in the absence of targeting. In some embodiments, the modified IL-2 containing polypeptides provided herein are agonists of IL-2R activity when targeted to NK cells and/or T cells, but show little or no agonist activity in the absence of targeting. In some embodiments, the modified IL-2 containing polypeptides that target T cells or NK cells comprise at least one antigen binding domain that specifically binds to an antigen expressed on T cells or NK cells.
[0382] In some embodiments, the modified IL-2 containing polypeptides provided herein increase proliferation of CD4.sup.+ and/or CD8.sup.+ T cells in vitro and/or in vivo. In some embodiments, the polypeptide increases CD4.sup.+ and/or CD8.sup.+ T cell proliferation in the presence of Treg cells. In some such embodiments, the CD4.sup.+ and/or CD8.sup.+ T cells are activated CD4.sup.+ and/or CD8.sup.+ T cells. In some embodiments, a modified IL-2 containing polypeptide provided herein increases activated CD4.sup.+ and/or CD8.sup.+ T cells proliferation in vitro. In some embodiments, the modified IL-2 containing polypeptide increases activated CD4.sup.+ and/or CD8.sup.+ T cells proliferation by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold relative to CD4.sup.+ and/or CD8.sup.+ T cell proliferation in the absence of the polypeptide. In some embodiments, the polypeptide increases proliferation of activated CD4.sup.+ and/or CD8.sup.+ T cells by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold and does not substantially increase the proliferation of resting CD4.sup.+ and/or CD8.sup.+ T cells, relative to the proliferation observed in the absence of the polypeptide.
[0383] In some embodiments, the modified IL-2 containing polypeptides provided herein increase proliferation of NK cells in vitro and/or in vivo. In some such embodiments, the NK cells are activated NK cells. In some embodiments, a modified IL-2 containing polypeptide provided herein increases activated NK cells proliferation in vitro. In some embodiments, the modified IL-2 containing polypeptide increases activated NK cells proliferation by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold relative to NK cell proliferation in the absence of the polypeptide. In some embodiments, the polypeptide increases proliferation of activated NK cells by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold and does not substantially increase the proliferation of resting NK cells, relative to the proliferation observed in the absence of the polypeptide.
[0384] The increase in proliferation of activated CD4.sup.+ and/or CD8.sup.+ T cells may be determined by any method in the art, such as for example, the methods provided in the Examples herein. A nonlimiting exemplary assay is as follows. CD4.sup.+ and/or CD8.sup.+ T cells may be isolated from one or more healthy human donors. The T cells are stained with CellTrace Violet (CTV) and activated with anti-CD3 antibody, contacted with a polypeptide comprising a modified IL-2, and then analyzed by FACS. Loss of CTV staining indicates proliferation. In some embodiments, an increase in CD4.sup.+ and/or CD8.sup.+ T cell proliferation is determined as an average from a set of experiments or from pooled T cells, such as by measuring proliferation of CD4.sup.+ and/or CD8.sup.+ T cells isolated from different healthy human donors. In some embodiments, an increase in CD4.sup.+ and/or CD8.sup.+ T cell proliferation is determined as an average from experiments carried out using T cells from at least five or at least ten different healthy donors, or from a pool of T cells from at least five or at least ten different healthy donors. In some embodiments, the modified IL-2 containing polypeptides provided herein increase proliferation of CD4.sup.+ and/or CD8.sup.+ T cells even in the presence of Treg cells.
[0385] In some embodiments, the modified IL-2 containing polypeptides provided herein increase CD71 expression on CD4+ and/or CD8+ T cells in vitro and/or in vivo. CD71 expression indicates T cell activation. In some embodiments, a modified IL-2 containing polypeptide provided herein increases CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells in vitro. In some embodiments, the modified IL-2 containing polypeptide increases CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold relative to CD71 expression in the absence of the polypeptide. In some embodiments, the polypeptide increases CD71 expression on activated CD4.sup.+ and/or CD8.sup.+ T cells by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold and does not substantially increase CD71 expression on resting CD4.sup.+ and/or CD8.sup.+ T cells, relative to the CD71 expression observed in the absence of the polypeptide. In some embodiments, the polypeptide increases CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells in the presence of Treg cells.
[0386] The increase in CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells may be determined by any method in the art, such as for example, the methods provided in the Examples herein. A nonlimiting exemplary assay is as follows. CD4.sup.+ and/or CD8.sup.+ T cells may be isolated from one or more healthy human donors and stimulated with an anti-CD3 antibody, contacted with a modified IL-2 containing polypeptide, and then analyzed by FACS for CD71 expression. In some embodiments, an increase in CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells is determined as an average from a set of experiments or from pooled T cells, such as by measuring CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells isolated from different healthy human donors. In some embodiments, an increase in CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells is determined as an average from experiments carried out using T cells from at least five or at least ten different healthy donors, or from a pool of T cells from at least five or at least ten different healthy donors. In some embodiments, the modified IL-2 containing polypeptides provided herein increase CD71 expression on CD4.sup.+ and/or CD8.sup.+ T cells even in the presence of Treg cells.
[0387] In some embodiments, the modified IL-2 containing polypeptides provided herein increase pSTAT5 expression in CD4.sup.+ and/or CD8.sup.+ T cells in vitro and/or in vivo.
[0388] pSTAT5 expression indicates T cell activation. In some embodiments, a modified IL-2 containing polypeptide provided herein increases pSTAT5 expression in CD4.sup.+ and/or CD8.sup.+ T cells in vitro. In some embodiments, the modified IL-2 containing polypeptide increases pSTAT5 expression on CD4.sup.+ and/or CD8.sup.+ T cells by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold relative to pSTAT5 expression in the absence of the polypeptide. In some embodiments, the polypeptide increases pSTAT5 expression on CD4.sup.+ and/or CD8.sup.+ T cells in the presence of Treg cells. The increase in pSTAT5 expression in CD4.sup.+ and/or CD8.sup.+ T cells may be determined by any method in the art, such as for example, the methods provided in the Examples herein. In some embodiments, the modified IL-2 containing polypeptides provided herein increase pSTAT5expression in CD4.sup.+ and/or CD8.sup.+ T cells even in the presence of Treg cells.
[0389] In some embodiments, the modified IL-2 containing polypeptides provided herein increase pSTAT5 expression in NK cells in vitro and/or in vivo. pSTAT5 expression indicates NK cell activation. In some embodiments, a modified IL-2 containing polypeptide provided herein increases pSTAT5 expression in NK cells in vitro. In some embodiments, the modified IL-2 containing polypeptide increases pSTAT5 expression on NK cells by at least 1.5-fold, at least 2-fold, at least 3-fold, or by at least 5-fold relative to pSTAT5 expression in the absence of the polypeptide. In some embodiments, the polypeptide increases pSTAT5 expression in NK cells in the presence of Treg cells. The increase in pSTAT5 expression in NK cells may be determined by any method in the art, such as for example, the methods provided in the Examples herein.
[0390] In some embodiments, the modified IL-2 containing polypeptides provided herein reduce or attenuate suppressive activity of regulatory T cells (Tregs). In some embodiments, the modified IL-2 containing polypeptides reduce Treg suppressive activity on CD4.sup.+ and/or CD8.sup.+ T cells by at least 10%, at least 20%, at least 30%, or by at least 50%. The decrease in Treg suppressive activity on conventional CD4.sup.+ and/or CD8.sup.+ T cells may be determined by any method in the art, such as for example, the methods provided in the Examples herein. A nonlimiting exemplary assay is as follows. Tregs and CD4.sup.+ T cells are differentially labeled with fluorescent proliferative cellular dyes following isolation from healthy human donor PBMCs. CD4.sup.+ T cells are stimulated with an anti-CD3 antibody, while Treg cells are incubated in the presence of a modified IL-2 containing polypeptide provided herein. The two T cell populations are co-cultured for 3 days and proliferation and activation of CD4.sup.+ T cells is monitored by flow cytometry. In some embodiments, the modified IL-2 containing polypeptides provided herein increase CD4.sup.+ and/or CD8.sup.+ T cell activation and proliferation in the presence of Treg cells, for example, compared to CD4.sup.+ and/or CD8.sup.+ T cell activation and proliferation in the presence of Treg cells but the absence of a modified IL-2 containing polypeptide provided herein.
Polypeptide Expression and Production
[0391] Nucleic acid molecules comprising polynucleotides that encode a modified IL-2 containing binding polypeptide are provided. Thus, in various embodiments, nucleic acid molecules are provided that encode a polypeptide comprising a modified IL-2. In some embodiments, the nucleic acid molecule encodes a modified IL-2 and at least one antigen binding domain. In various embodiments, the nucleic acid molecule encodes a modified IL-2 and an Fc region and, optionally, at least one antigen binding domain. In some embodiments, the Fc region comprises mutations designed for heterodimerization, such as “knob” or “hole” mutations. In some embodiments, a nucleic acid molecule is provided that encodes a modified IL-2 containing polypeptide that comprises a modified IL-2, at least one antigen binding domain, and an Fc region, wherein the Fc region is fused to the C-terminus of the at least one antigen binding domain, and the modified IL-2 is fused to the C-terminus of the Fc region. In any of the foregoing embodiments, the nucleic acid molecule may also encode a leader sequence that directs secretion of the modified IL-2 containing polypeptide, which leader sequence is typically cleaved such that it is not present in the secreted polypeptide. The leader sequence may be a native heavy chain (or VHH) leader sequence, or may be another heterologous leader sequence.
[0392] Nucleic acid molecules can be constructed using recombinant DNA techniques conventional in the art. In some embodiments, a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell.
[0393] Vectors comprising nucleic acids that encode the modified IL-2 containing polypeptides described herein are provided. Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc. In some embodiments, a vector is selected that is optimized for expression of polypeptides in a desired cell type, such as 293F, CHO, or CHO-derived cells, or in NSO cells. Exemplary such vectors are described, for example, in Running Deer et al., Biotechnol. Prog. 20:880-889 (2004).
[0394] In some embodiments, a modified IL-2 containing polypeptide may be expressed in prokaryotic cells, such as bacterial cells; or in eukaryotic cells, such as fungal cells (such as yeast), plant cells, insect cells, and mammalian cells. Such expression may be carried out, for example, according to procedures known in the art. Exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293F cells; CHO cells, including CHO-S, DG44. Lec13 CHO cells, and FUT8 CHO cells; PER.C6® cells (Crucell); and NSO cells. In some embodiments, the modified IL-2 containing polypeptides may be expressed in yeast. See, e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments, a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the polypeptide. For example, in some embodiments, CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293F cells.
[0395] Introduction of one or more nucleic acids (such as vectors) into a desired host cell may be accomplished by any method, including but not limited to, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc. Nonlimiting exemplary methods are described, for example, in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3.sup.rd ed. Cold Spring Harbor Laboratory Press (2001). Nucleic acids may be transiently or stably transfected in the desired host cells, according to any suitable method.
[0396] Host cells comprising any of the nucleic acids or vectors described herein are also provided. In some embodiments, a host cell that expresses a modified IL-2 containing polypeptide described herein is provided. The modified IL-2 containing polypeptides expressed in host cells can be purified by any suitable method. Such methods include, but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography. Suitable affinity ligands include the ROR1 ECD and agents that bind Fc regions. For example, a Protein A, Protein G, Protein A/G, or an antibody affinity column may be used to bind the Fc region and to purify a modified IL-2 containing polypeptide that comprises an Fc region. Hydrophobic interactive chromatography, for example, a butyl or phenyl column, may also suitable for purifying some polypeptides such as antibodies. Ion exchange chromatography (for example anion exchange chromatography and/or cation exchange chromatography) may also suitable for purifying some polypeptides such as antibodies. Mixed-mode chromatography (for example reversed phase/anion exchange, reversed phase/cation exchange, hydrophilic interaction/anion exchange, hydrophilic interaction/cation exchange, etc.) may also suitable for purifying some polypeptides such as antibodies. Many methods of purifying polypeptides are known in the art.
[0397] In some embodiments, the modified IL-2 containing polypeptide is produced in a cell-free system. Nonlimiting exemplary cell-free systems are described, for example, in Sitaraman et al., Methods Mot Biol. 498: 229-44 (2009); Spirin, Trends Biotechnol. 22: 538-45 (2004); Endo et al., Biotechnol. Adv. 21: 695-713 (2003).
[0398] In some embodiments, modified IL-2 containing polypeptides prepared by the methods described above are provided. In some embodiments, the modified IL-2 containing polypeptide is prepared in a host cell. In some embodiments, the modified IL-2 containing polypeptide is prepared in a cell-free system. In some embodiments, the modified IL-2 containing polypeptide is purified. In some embodiments, a cell culture media comprising a modified IL-2 containing polypeptide is provided.
[0399] In some embodiments, compositions comprising antibodies prepared by the methods described above are provided. In some embodiments, the composition comprises a modified IL-2 containing polypeptide prepared in a host cell. In some embodiments, the composition comprises a modified IL-2 containing polypeptide prepared in a cell-free system. In some embodiments, the composition comprises a purified modified IL-2 containing polypeptide.
Exemplary Methods of Treating Diseases Using Modified IL-2 Containing Polypeptides
[0400] In some embodiments, methods of treating disease in an individual comprising administering a modified IL-2 containing polypeptide are provided. Such diseases include any disease that would benefit from increase proliferation and activation of CD4.sup.+ and/or CD8.sup.+ T cells. In some embodiments, methods for treating cancer in an individual are provided. The method comprises administering to the individual an effective amount of a modified IL-2 containing polypeptide provided herein. Such methods of treatment may be in humans or animals. In some embodiments, methods of treating humans are provided. Nonlimiting exemplary cancers that may be treated with modified IL-2 containing polypeptides provided herein include basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer; gastrointestinal cancer; glioblastoma; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; liver cancer; lung cancer; small-cell lung cancer; non-small cell lung cancer; adenocarcinoma of the lung; squamous carcinoma of the lung; melanoma; myeloma; neuroblastoma; oral cavity cancer; ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; cancer of the respiratory system; salivary gland carcinoma; sarcoma; skin cancer; squamous cell cancer; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; and vulval cancer; lymphoma; Hodgkin's lymphoma; non-Hodgkin's lymphoma; B-cell lymphoma; low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; Waldenstrom's macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); Hairy cell leukemia; and chronic myeloblastic leukemia.
[0401] The modified IL-2 containing polypeptides can be administered as needed to subjects. Determination of the frequency of administration can be made by persons skilled in the art, such as an attending physician based on considerations of the condition being treated, age of the subject being treated, severity of the condition being treated, general state of health of the subject being treated and the like. In some embodiments, an effective dose of a modified IL-2 containing polypeptides is administered to a subject one or more times. In some embodiments, an effective dose of a modified IL-2 containing polypeptide is administered to the subject daily, semiweekly, weekly, every two weeks, once a month, etc. An effective dose of a modified IL-2 containing polypeptide is administered to the subject at least once. In some embodiments, the effective dose of a modified IL-2 containing polypeptide may be administered multiple times, including multiple times over the course of at least a month, at least six months, or at least a year.
[0402] In some embodiments, pharmaceutical compositions comprising a modified IL-2 containing polypeptide are administered in an amount effective for treating (including prophylaxis of) cancer and/or increasing T cell proliferation. The therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical or health condition, the extensiveness of the condition to be treated, or the age of the subject being treated. In general, polypeptides may be administered in an amount in the range of about 0.05 mg/kg body weight to about 100 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 10 μg/kg body weight to about 100 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 50 μg/kg body weight to about 5 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 100 μg/kg body weight to about 10 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 100 μg/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 0.5 mg/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 0.5 mg/kg body weight to about 10 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 0.05 mg/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 0.05 mg/kg body weight to about 10 mg/kg body weight per dose. In some embodiments, polypeptides may be administered in an amount in the range of about 5 mg/kg body weight or lower, for example less than 4, less than 3, less than 2, or less than 1 mg/kg of the antibody.
[0403] In some embodiments, modified IL-2 containing polypeptides can be administered in vivo by various routes, including, but not limited to, intravenous, intra-arterial, parenteral, intraperitoneal or subcutaneous. The appropriate formulation and route of administration may be selected according to the intended application.
[0404] In some embodiments, a therapeutic treatment using a modified IL-2 containing polypeptide is achieved by increasing T cell proliferation and/or activation. In some embodiments, increasing T cell proliferation and/or activation inhibits growth of cancer.
Pharmaceutical Compositions
[0405] In some embodiments, compositions comprising modified IL-2 containing polypeptides are provided in formulations with a wide variety of pharmaceutically acceptable carriers (see, for example, Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7.sup.th ed., Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3.sup.rd ed., Pharmaceutical Press (2000)). Various pharmaceutically acceptable carriers, which include vehicles, adjuvants, and diluents, are available. Moreover, various pharmaceutically acceptable auxiliary substances, such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are also available. Non-limiting exemplary carriers include saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
[0406] In some embodiments, a pharmaceutical composition comprises a modified IL-2 containing polypeptide at a concentration of at least 10 mg/mL, 20 mg/mL, 30 mg/mL, 40 mg/mL, 50 mg/mL, 60 mg/mL, 70 mg/mL, 80 mg/mL, 90 mg/mL, 100 mg/mL, 125 mg/mL, 150 mg/mL, 175 mg/mL, 200 mg/mL, 225 mg/mL, or 250 mg/mL.
Combination Therapy
[0407] Modified IL-2 containing polypeptides can be administered alone or in combination with other modes of treatment, such as other anti-cancer agents. They can be provided before, substantially contemporaneous with, or after other modes of treatment (i.e., concurrently or sequentially). In some embodiments, the method of treatment described herein can further include administering: radiation therapy, chemotherapy, vaccination, targeted tumor therapy, CAR-T therapy, oncolytic virus therapy, cancer immunotherapy, cytokine therapy, surgical resection, chromatin modification, ablation, cryotherapy, an antisense agent against a tumor target, a siRNA agent against a tumor target, a microRNA agent against a tumor target or an anti-cancer/tumor agent, or a biologic, such as an antibody, cytokine, or receptor extracellular domain-Fc fusion.
[0408] In some embodiments, a modified IL-2 containing polypeptide provided herein is given concurrently with a second therapeutic agent, for example, a PD-1 antibody. Examples of PD-1 antibodies include nivolumab (BMS); pembrolizumab (Merck); AMP-514 (Amplimmune); TSR-042 (Tesaro/AnaptysBio, ANB-011); STI-A1110 (Sorrento Therapeutics); and other agents that are directed against programmed death-1 (PD-1).
[0409] In some embodiments, a modified IL-2 containing polypeptide provided herein is given concurrently with a second therapeutic agent, for example, a PD-L1 therapy. Examples of PD-L1 therapies include pidilizumab (CureTech, CT-011); durvalumab (Medimmune/AstraZeneca); atezolizumab (Genentech/Roche); avelumab (Pfizer); AMP-224 (Amplimmune); BMS-936559 (Bristol-Myers Squibb); STI-A1010 (Sorrento Therapeutics); and other agents directed against programmed dealth-1 ligand (PD-L1).
[0410] In some embodiments, a modified IL-2 containing polypeptide provided herein is given concurrently with CAR-T (chimeric antigen receptor T cell) therapy, oncolytic virus therapy, cytokine therapy, and/or agents that target other checkpoint molecules, such as VISTA, gpNMB, B7H3, B7H4, HHLA2, CD73, CTLA4, TIGIT, etc.
Nonlimiting Exemplary Methods of Diagnosis and Treatment
[0411] In some embodiments, the methods described herein are useful for evaluating a subject and/or a specimen from a subject (e.g. a cancer patient). In some embodiments, evaluation is one or more of diagnosis, prognosis, and/or response to treatment.
[0412] In some embodiments, the methods described herein comprise evaluating a presence, absence, or level of a protein. In some embodiments, the methods described herein comprise evaluating a presence, absence, or level of expression of a nucleic acid. The compositions described herein may be used for these measurements. For example, in some embodiments, the methods described herein comprise contacting a specimen of the tumor or cells cultured from the tumor with a therapeutic agent as described herein.
[0413] In some embodiments, the evaluation may direct treatment (including treatment with the polypeptides described herein). In some embodiments, the evaluation may direct the use or withholding of adjuvant therapy after resection. Adjuvant therapy, also called adjuvant care, is treatment that is given in addition to the primary, main or initial treatment. By way of non-limiting example, adjuvant therapy may be an additional treatment usually given after surgery where all detectable disease has been removed, but where there remains a statistical risk of relapse due to occult disease. In some embodiments, the polypeptides are used as an adjuvant therapy in the treatment of a cancer. In some embodiments, the antibodies are used as the sole adjuvant therapy in the treatment of a cancer. In some embodiments, the antibodies described herein are withheld as an adjuvant therapy in the treatment of a cancer. For example, if a patient is unlikely to respond to an antibody described herein or will have a minimal response, treatment may not be administered in the interest of quality of life and to avoid unnecessary toxicity from ineffective chemotherapies. In such cases, palliative care may be used.
[0414] In some embodiments the polypeptides are administered as a neoadjuvant therapy prior to resection. In some embodiments, neoadjuvant therapy refers to therapy to shrink and/or downgrade the tumor prior to any surgery. In some embodiments, neoadjuvant therapy means chemotherapy administered to cancer patients prior to surgery. In some embodiments, neoadjuvant therapy means a polypeptide is administered to cancer patients prior to surgery. Types of cancers for which neoadjuvant chemotherapy is commonly considered include, for example, breast, colorectal, ovarian, cervical, bladder, and lung. In some embodiments, the antibodies are used as a neoadjuvant therapy in the treatment of a cancer. In some embodiments, the use is prior to resection.
[0415] In some embodiments, the tumor microenvironment contemplated in the methods described herein is one or more of: tumor vasculature; tumor-infiltrating lymphocytes; fibroblast reticular cells; endothelial progenitor cells (EPC); cancer-associated fibroblasts; pericytes; other stromal cells; components of the extracellular matrix (ECM); dendritic cells; antigen presenting cells; T cells; regulatory T cells; macrophages; neutrophils; and other immune cells located proximal to a tumor.
Kits
[0416] Also provided are articles of manufacture and kits that include any of the modified IL-2 containing polypeptides as described herein, and suitable packaging. In some embodiments, the invention includes a kit with (i) a modified IL-2 containing polypeptide, and (ii) instructions for using the kit to administer the modified IL-2 containing polypeptide to an individual.
[0417] Suitable packaging for compositions described herein are known in the art, and include, for example, vials (e.g., sealed vials), vessels, ampules, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. These articles of manufacture may further be sterilized and/or sealed. Also provided are unit dosage forms comprising the compositions described herein. These unit dosage forms can be stored in a suitable packaging in single or multiple unit dosages and may also be further sterilized and sealed. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable. The instructions relating to the use of the antibodies generally include information as to dosage, dosing schedule, and route of administration for the intended treatment or industrial use. The kit may further comprise a description of selecting an individual suitable or treatment.
[0418] The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. For example, kits may also be provided that contain sufficient dosages of molecules disclosed herein to provide effective treatment for an individual for an extended period, such as about any of a week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, or more. Kits may also include multiple unit doses of molecules and instructions for use and packaged in quantities sufficient for storage and use in pharmacies, for example, hospital pharmacies and compounding pharmacies. In some embodiments, the kit includes a dry (e.g., lyophilized) composition that can be reconstituted, resuspended, or rehydrated to form generally a stable aqueous suspension of polypeptide.
EXAMPLES
[0419] The examples discussed below are intended to be purely exemplary of the invention and should not be considered to limit the invention in any way. The examples are not intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (for example, amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
Example 1: P65R Mutation of IL-2 Essentially Eliminates CD25 Binding
[0420] IL-2 mutants were designed to disrupt the CD25 interface through steric occlusion (P65R and P65E), and were tested for binding to 293F cells transiently transfected with one or more components of the IL-2 receptor (CD25, CD122, and/or CD132). The mutants were compared to IL-2-F42K, a mutant reported to have reduced affinity to CD25. Increasing concentrations of a fusion protein comprising wild type human IL-2 (SEQ ID NO: 32), IL-2-F42K (SEQ ID NO: 33), IL-2-P65R (SEQ ID NO: 35), or IL-2-P65E (SEQ ID NO: 34) fused to the N-terminus of a “knob” Fc and complexed with a “hole” Fc (SEQ ID NO: 44) were added to the transfected 293F cells and incubated at 4° C. for 45 minutes.
[0421] Binding was analyzed by flow cytometry, substantially as follows. Cells were washed once in 200 μL of FACS buffer (PBS, 2% FBS, 0.05% sodium azide) and cell pellets were resuspended in 100 μl of a surface marker staining solution (containing A647-conjugated anti-human Fcg secondary antibody at 1:300 dilution in FACS buffer). Cells were incubated for 45 minutes at 4° C. before the final wash, and analyzed on a flow cytometer. Cellular debris was excluded by FSC/SSC size exclusion, and dead cells were excluded based on their positive propidium iodide signal. Single cells were selected using FSC-A/FSC-H doublet and aggregate exclusion. Transiently transfected cells also expressed cytoplasmic EGFP, and cells that were FL1 positive were analyzed. Increasing MFI levels of anti-human secondary antibody indicated IL-2 binding. FlowJo software was used for analysis of the cell populations. Raw mean fluorescence intensities (“MFI”) for each marker were then exported and analyzed using Excel and GraphPad PRISM. Values were graphed, and titration curves were fitted to assess a dose-response relationship using the non-linear regression One-site—Total curve fit.
[0422] As shown in
Example 2: IL-2 Modifications that Reduce Affinity for CD122
[0423] As noted in Example 1, the P65R IL-2 mutation was designed to disrupt the CD25 interface through steric occlusion. In addition, IL-2 mutations were designed to reduce affinity for the CD122 interface through elimination of certain contact residue interactions (e.g., D84S, E95Q, M23A, H16A, and E15S). Single or double mutants were fused to the N-terminus of the “knob” half of a heterodimeric Fc (disulfide stabilized knob into hole comprising “hole” Fc SEQ ID NO: 44) for monovalent IL-2 binding to IL-2R. Relative binding affinities were assessed by transiently transfecting 293F cells with CD25 and CD122 (co-transfection with CD132 showed similar results, although the additional binding avidity reduced the differences in affinity observed). Bound IL-2-Fc fusion proteins were detected with fluorescent anti-human secondary antibody and analyzed by flow cytometry, substantially as described in Example 1.
[0424] As shown in
Example 3: IL-2-RAS (P65R, H16A, and D84S) has Reduced Affinity for CD122 in the Context of Trimeric and Dimeric Forms of IL-2R
[0425] Mutations to reduce CD122 affinity described in Example 2 were combined with the P65R mutation to construct IL-2 double and triple mutants. The IL-2 mutants were fused to the N-terminus of the “knob” half of a heterodimeric Fc and paired with a “hole” Fc comprising SEQ ID NO: 44 for monovalent IL-2 binding to IL-2 receptor (IL-2R). Relative binding affinities of the resulting fusion proteins were assessed on 293F cells transiently transfected with IL-2R subunits, substantially as described in Example 1.
[0426] Relative to the fusion protein comprising wild type IL-2 (SEQ ID NO: 32), the fusion protein comprising IL-2-P65R-H16A (SEQ ID NO: 41) and the fusion protein comprising IL-2-P65R-D84S (SEQ ID NO: 42) had reduced affinity to both CD122/CD132 (heterodimeric IL-2R) (
Example 4. IL-2-RAS has Reduced Affinity for Resting T Cells and Pre-Activated T Cells
[0427] To isolate T cells, non-T cell populations were labeled with biotinylated anti-lineage marker antibodies against CD14, CD16, CD19, CD20, CD36, CD56, CD123, TCRγ/δ (BioLegend) for 20 minutes at room temperature. Non-T cell populations were then depleted by incubating for 20 minutes at room temperature with magnetic streptavidin particles (500 μl bead slurry plus 500 μl cell suspension per 100×10.sup.6, 2×8 minutes incubation on the magnet). The unbound cell supernatant contained isolated T cells.
[0428] Some of the isolated T cells (5.5×10.sup.6 in 3 mL) were activated by incubating in a 6-well plate pre-coated with 1 μg/ml anti-CD3 OKT3 antibody (BD Biosciences) for 2 days, then washed with PBS/2% FBS, and rested at 2×10.sup.6/mL in RPMI+10% FBS for 1 day. Resting or pre-activated T cells were used directly in the binding assay. Binding of a non-targeting VHH-Fc isotype control and fusion proteins comprising IL-2-RAS or wild type IL-2 fused to the C-terminus of a non-targeted VHH linked to a heterodimeric Fc to resting or pre-activated T cells was measured by flow cytometry, substantially as described in Example 1 except that the following secondary antibodies were used: AF647 anti-human Fc (1:1000), PI (1:2000), BV785-CD4 (1:300), APC/Fire-CD8 (1:500) and PE/Cy7-CD25 (1:100).
[0429] The non-targeted IL-2-RAS fusion protein (comprising SEQ ID NO: 46) bound with reduced affinity to resting (
Example 5: IL-2-RAS has Reduced Affinity for Tregs
[0430] Regulatory T cells (“Tregs”) have high endogenous expression of CD25, as well as of CD122 and CD132, and are highly responsive to wild type IL-2. Binding to Tregs of a fusion protein comprising wild type IL-2 (comprising SEQ ID NO: 45) or the IL-2-RAS triple mutant (comprising SEQ ID NO: 46) fused to the C-terminus of the “knob” half of a heterodimeric Fc (disulfide stabilized knob into hole) of a non-targeted VHH was measured.
[0431] Tregs and CD4+T responder cells (Tresp) were enriched and isolated from fresh, healthy donor PBMCs by using an EasySep Human CD4.sup.+CD127.sup.lowCD25.sup.+ regulatory T cell isolation kit (Stemcell) following the manufacturer's instructions. Tregs were generated from naive CD4+ T cells via 7 day culture in ImmunoCult-XF T Cell Expansion Medium supplemented with rhTGF-B1, all-trans retinoic acid, CD3/CD28 T Cell Activator and IL-2.
[0432] In order to distinguish the two populations of cells, enriched Tregs and CD4.sup.+ responder T cells were labeled with the proliferative dyes CellTrace Violet (CTV) and CFSE, respectively, for 10 minutes at 37° C. After washing, Tregs and CD4.sup.+ T cells were resuspended to 1.5×10.sup.6 cells/ml in RPMI supplemented with 10% FBS and 1× antibiotic/antimycotic. Tregs were seeded in 50 μl volume yielding 75,000 Tregs/well in a 96-well round-bottom plate. Tregs were incubated overnight at 37° C. in the presence of 10 nM of IL-2-RAS by flow cytometry as described in Example 1.
[0433] As shown in
Example 6: IL-2-RAS has Reduced Activity on Resting T Cells
[0434] T cells were isolated by magnetic bead separation, substantially as described in Example 4, labeled with CellTrace Violet (CTV), and treated with a fusion protein comprising wild type IL-2 (comprising SEQ ID NO: 45) or IL-2-RAS (comprising SEQ ID NO: 46) fused to the C-terminus of a non-targeted VHH linked to a heterodimeric Fc. Levels of CD4, CD8, CD71, and CTV were measured by flow cytometry. Proliferating T cells have reduced CTV levels.
[0435] As shown in
[0436] As shown in
[0437] T cell activation can also be measured by phosphorylated STATS levels, which are increased in activated T cells. T cells were isolated by magnetic bead separation and treated with the fusion protein comprising wild-type IL-2 (comprising SEQ ID NO: 45) fused to the C-terminus of a non-targeted VHH comprising a heterodimeric Fc or the fusion protein comprising IL-2-RAS (comprising SEQ ID NO: 46) fused to the C-terminus of a non-targeted VHH comprising a heterodimeric Fc for 15 minutes. Cells were fixed with BD Cytofix/Cytoperm™ (BD Biosciences), permeabilized in 90% ice-cold methanol, and levels of phosphorylated STATS (“pSTAT5”) on CD4+ and CD8+ T cells were measured using flow cytometry using an anti-pSTAT5-PE antibody (1:70). Cells were co-stained with the following antibodies: anti-CD3-FITC (1:200), CD56-BV421 (1:100), CD4-BV785 (1:200), CD8-APC-Fire (1:300).
[0438] As shown in
Example 7: IL-2 Mutants have Reduced Activity on Tregs
[0439] Tregs were isolated from PBMCs using the EasySep™ Human CD4+CD127lowCD25+ Regulatory T cell Isolation Kit (Stemcell). Tregs were labeled with CellTrace Violet and plated at 0.15×10.sup.6 cells per well (96-well, U-bottom) in 100 μl of RPMI/10% FBS. Cells were combined with 100 μl of a fusion protein titration starting at 100 nM, titrated 1:4. Cells were incubated for 7 days. On day 7, proliferation and activation marker CD25 were measured by flow cytometry (Novocyte) substantially as described in Example 1, except that the following antibodies were used: BV785-CD4 (1:300), APC/Fire-CD8 (1:500) PE/Cy7-CD25 (1:100), PI (1:2000).
[0440] As shown in
Example 8: Activated T Cells Expressing PD-1 are Stimulated by PD-1-Targeted IL RAS
[0441] The ability to bind to and stimulate PD-1 expressing T cells was tested using pembrolizumab (an anti-PD-1 conventional antibody) and a fusion protein comprising a pembrolizumab analog and IL-2-RAS linked to the C-terminus of the heavy chain (see
[0442] Enriched T cells from a healthy donor were activated, substantially as described in Example 4. 6-well plates were coated overnight with 1 μg/ml OKT3 antibody at 4° C. The next day, plates were washed two times to remove unbound OKT3 antibody. Enriched T cells were thawed using CTL media and resuspended to 5.5×10.sup.6 cells/mL in complete RPMI and seeded in 3 mL per well in the coated plates. Two days later, the activated T cells were collected and washed once before plating in media without OKT3 antibody for 24 hours to rest. Cells were labeled with the proliferative dye CellTrace™ Violet (CTV). The T cells were counted, then resuspended to 2×10.sup.6 cells/mL. 100 μL of resuspended cells were seeded per well in a 96-well round-bottom plate. Pembrolizumab or a pembrolizumab analog-IL-2-RAS fusion was added starting at a final concentration of 100 nM and titrated 1:5. On day three, T cells were stained for 20 min at room temperature with the viability marker PI and the following fluorescently labeled antibodies: CD4-BV785, CD8-APC/Fire, CD25-PE/Cy7, CD71-FITC, and CD69-APC. The plate was read on the Novocyte flow cytometer substantially as described in Example 7 for measurement of proliferation and as in Example 1 for binding and data was exported into Excel for further analysis.
[0443] As shown in
Example 9: Pre-Blocking PD-1 on Activated T Cells Prevents Signaling by PD-1 Targeted IL-2-RAS
[0444] T cells were isolated and enriched from a healthy donor by magnetic bead separation, and incubated on plates coated with OKT3 antibody to activate them, substantially as described in Example 4. The cells were labeled with CTV. The pre-activated T cells were incubated with pembrolizumab, an anti-PD-1 antibody, to block PD-1 binding sites, or a non-targeted antibody as a control. The cells were then incubated with a fusion protein comprising IL-2-RAS fused to a pembrolizumab analog, or a fusion protein comprising IL-2-RAS fused to a non-targeting antibody as a control, for 3 days. The extent of IL-2 signaling was evaluated by measuring CD4+ and CD8+ T cell proliferation by flow cytometry, substantially as described in Example 7.
[0445] As shown in
Example 10: PD-1-Targeted IL-2-RAS Overcomes Treg Suppression
[0446] CD4+T responder cells and Tregs were isolated as described in Example 5. The CD4+ responder cells were labeled with CTV, mixed with isolated Tregs at a ratio of 2:1 and activated with anti-CD3 beads (1 bead per 2 T cells). The resulting mixture was treated with a dilution series of a wild type IL-2 fused to the C-terminus of a non-targeted VHH, as shown in
[0447] As shown in
Example 11: PD-1 Targeted IL-2-RAS does not Signal in Trans
[0448] Beads are coated with 200 μg PD-1 antigen per 4×10.sup.8 beads according to the manufacturer's recommended coating procedure. In brief, beads are washed once in buffer 1 (0.1 M sodium phosphate buffer, pH 7.4-8.0) and then incubated in a tube rotator for 18 hours at room temperature in buffer 1 containing PD-1 antigen. Beads are then washed 4 times with buffer 2 (PBS, 0.1% BSA, 2 mM EDTA pH 7.4). Free tosyl groups are deactivated by incubation of beads for 4 hours at 37° C. in buffer 3 (0.2 M Tris, 0.1% BSA, pH 8.5). Beads are then washed once in buffer 2 and resuspended to a concentration of 400×10.sup.6 beads/mL.
[0449] Coated beads are incubated with a fusion protein comprising wild typeIL-2 or IL-2-RAS fused to an anti-PD-1 antibody and washed. The beads are then incubated with isolated resting T cells. IL-2 signaling is evaluated by measuring pSTAT5 levels via flow cytometry.
[0450] The fusion protein comprising wild typeIL-2 bound to the beads robustly activates CD8+ T cells and CD4+ T cells, while the fusion protein comprising IL-2-RAS bound to the beads has no activity up to the highest concentration tested on either CD4+ or CD8+ T cells. Thus, T cell targeting of IL-2-RAS is required for IL-2 signaling, and signaling of targeted IL-2-RAS does not occur in trans.
Example 12: IL-2-RAS does not Signal in Trans
[0451] Dilution series of non-targeted wild type IL-2 and of non-targeted IL-2-RAS, starting at 1000 nM and diluted 1:4, were coated on assay plates, incubated overnight, and washed. T cells were added and incubated at 37° C. for 30 minutes. Activation of CD8+ and CD4+ T cells was measured by detecting phosphorylated STATS levels, substantially as described in Example 6.
[0452] As shown in
Example 13: NKp46 Targeted IL-2-RAS Specifically Drives NK Cell Proliferation
[0453] The effects of a fusion protein comprising IL-2-RAS fused to the C-terminus of a heterodimeric scFv antibody targeting NKp46, as shown in
[0454] Fresh PBMCs from a healthy donor were labeled with CellTrace™ Violet and plated in a 96-well round bottom plate at 200,000 cells/well. Dilutions of the fusion proteins and NKp46 scFv-Fc control were added to the plated cells and incubated at 37° C. for 7 days. On day 7, cell proliferation was measured, substantially as described in Example 7, except that the following antibodies were used: anti-CD3-BV785 (1:200), anti-CD56-APC (1:100), anti-CD4-PE (1:200), anti-CD8-APC-Fire (1:300) and PI (1:2000).
[0455] In addition, fresh PBMCs from a healthy donor were treated with the same fusions proteins or NKp46 scFv-Fc control, and incubated at 37° C. for 15 minutes. pSTAT5 levels in CD8+ T cells, CD4+ T cells, and NK cells (CD3−, CD56+) were measured by detecting phosphorylated STATS levels, substantially as described in Example 6.
[0456] Binding of the fusion proteins and the NKp46 scFV-Fc control to fresh PBMCs from a healthy donor was measured, substantially as described in Example 1, except that the following antibodies were used: anti-CD3-FITC (1:100), anti-CD56-BV421 (1:100), anti-CD4-BV785 (1:200), anti-CD8-APC-Fire (1:300), anti-human IgG-Alexa Fluor 647 (1:500), and PI (1:2000).
[0457] As shown in
Example 14: LAG3 Targeted IL-2-RAS Stimulates Pre-Activated LAG3+ T-Cells
[0458] The effects on CD4+ T cells and CD8+ T cells of fusion proteins comprising IL-2-RAS fused to the C-terminus of an anti-LAG3 heterodimeric conventional antibody (MAb), as shown in
[0459] Enriched T cells from a healthy donor were stimulated for 48 hours with 1 μg/mL coated anti-CD3 (OKT3) and 10 μg/mL soluble anti-CD28, then allowed to rest for 24 hours. The pre-activated cells were labeled with CellTrace™ Violet and seeded at 200,000 cells/well. Dilutions of the fusion proteins and control proteins were added and incubated for 3 days. Proliferation and expression of activation markers CD25 and CD71 were measured, substantially as in Example 7, but with these additional antibodies: anti-CD25-FITC (1:100) and anti-CD71-PE/Cy7.
[0460] Stimulated CD8+ T cells upregulated LAG3 to 45% of CD8+ T cells, while CD4+ T cells upregulated LAG3 to 22% of CD4+ T cells. In contrast, non-stimulated T cells are close to 0% positive for LAG3 expression on either CD8+ or CD4+ T cells.
[0461] As shown in
Example 15: Combination Mutants of IL-2 Further Reduce Non-Targeted Activity
[0462] HEK-Blue IL-2 reporter cells (InvivoGen) were used to measure the relative activities of non-targeted IL-2 mutants. Reporter cells were treated with dilutions of IL-2-mutants fused to the C-terminus of a non-targeted VHH and incubated for 20 hours before quantification of the IL-2 induced secretion of alkaline phosphatase by the reporter cells using a colorimetric enzyme substrate, QUANTI-Blue™ (Invivogen).
[0463] As shown in
Example 16: Activities of Polypeptides Comprising a Modified IL-2
[0464] HEK-Blue IL-2 reporter cells (InvivoGen) or modified IL-2 reporter cell clones expressing PD-1 were used to measure were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The IL-2 modifications and SEQ ID NO of each modified IL-2 are shown in Tables 2 and 3. Control polypeptides comprising IL-2 comprising only T3G and C125S mutations or wild type IL-2 were also tested. Untargeted IL-2 activities were measured using the reporter cells that did not express PD-1. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The tested polypeptides' EC.sub.50s on the cells lacking PD-1 were calculated using a four parameter nonlinear curve fit in Prism 8 ([Agonist] vs response—Variable slope) and are shown in Table 2 below, and the dose response curves are shown in
TABLE-US-00002 TABLE 2 EC.sub.50s of polypeptides comprising a modified IL-2 on cells lacking PD-1 EC.sub.50 SEQ ID IL-2 modifications (nM) NO T3A, H16A, F42R, P65R, D84S, C125S 2.1 282 T3A, H16A, Δ42, P65R, D84S, C125S 4.2 278 T3A, H16A, K43E, Y45R, P65R, D84S, C125S 1.5 279 T3A, H16A, P65R, D84S, C125S (INBRX-108) 0.9 28 T3A, H16A, K43E, P65R, D84S, C125S 1.1 280 T3A, H16A, P65R, D84S, I114F, C125S 1.4 281 T3A, H16A, E61R, P65R, D84S, C125S 3.2 108 T3A, H16A, R38A, P65R, D84S, C125S 2.0 109
[0465] As shown in Table 2 and
[0466] The PD-1 targeted IL-2 activities of the same polypeptides were tested in the PD-1-expressing IL-2 reporter cells. The EC.sub.50s on the cells expressing PD-1 were calculated using a four parameter nonlinear curve fit in Prism 8 ([Agonist] vs response—Variable slope) and are shown in Table 3 below, and the dose response curves are shown in
TABLE-US-00003 TABLE 3 EC.sub.50s of polypeptides comprising a modified IL-2 on cells expressing PD-1 EC.sub.50 SEQ ID IL-2 modifications (nM) NO. T3A, H16A, F42R, P65R, D84S, C125S 0.003 282 T3A, H16A, Δ42, P65R, D84S, C125S 0.005 278 T3A, H16A, K43E, Y45R, P65R, D84S, C125S 0.002 279 T3A, H16A, P65R, D84S, C125S (INBRX-108) 0.001 28 T3A, H16A, K43E, P65R, D84S, C125S 0.001 280 T3A, H16A, P65R, D84S, I114F, C125S 0.002 281 T3A, H16A, E61R, P65R, D84S, C125S 0.002 108 T3A, H16A, R38A, P65R, D84S, C125S 0.002 109
[0467] As shown in Table 3 and
Example 17: Effect of Blocking CD25 on Activities of Polypeptides Comprising a Modified IL-2
[0468] HEK-Blue IL-2 reporter cells (InvivoGen) that did not express PD-1 were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH in the presence or absence of a CD25 antibody that blocks binding of IL-2 to CD25. The IL-2 modifications and SEQ ID NOs of the modified IL-2s are shown in Table 4. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The dose response curves are shown in
TABLE-US-00004 TABLE 4 Effects of blocking CD25 on cells lacking PD-1 Activity blocked SEQ by CD25 ID IL-2 modifications antibody? NO. T3A, H16A, F42R, P65R, D84S, C125S No 282 T3A, H16A, Δ42, P65R, D84S, C125S No 278 T3A, H16A, K43E, Y45R, P65R, D84S, C125S No 279 T3A, H16A, P65R, D84S, C125S (INBRX-108) Yes 28 T3A, H16A, K43E, P65R, D84S, C125S Yes 280 T3A, H16A, P65R, D84S, I114F, C125S Yes 281 T3A, H16A, E61R, P65R, D84S, C125S No 108 T3A, H16A, R38A, P65R, D84S, C125S No 109
[0469] As shown in Table 4 and
Example 18: Activities of Polypeptides Comprising a Modified IL-2
[0470] HEK-Blue IL-2 reporter cells described in Example 16 were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The IL-2 modifications and SEQ ID NO of each modified IL-2 are shown in Table 5. Untargeted IL-2 activities were measured using the reporter cells that did not express PD-1. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The tested polypeptides' EC.sub.50s on the cells lacking PD-1 were calculated using a four parameter nonlinear curve fit in Prism 8 ([Agonist] vs response—Variable slope) and are shown in Table 5 below, and the dose response curves are shown in
TABLE-US-00005 TABLE 5 EC.sub.50s of polypeptides comprising a modified IL-2 on cells lacking PD-1 EC.sub.50 SEQ ID IL-2 modifications (nM) NO. T3A, H16A, L19A, P65R, D84S, C125S >100 110 T3A, H16A, P65R, D84S, N88S, C125S 3.1 111 T3A, H16A, P65R, D84S, E95Q, C125S 3.9 112 T3A, H16A, M23A, P65R, D84S, C125S 3.1 113 T3A, H16A, M23A, P65R, D84S, E95Q, C125S 8.7 114 T3A, H16A, P65R, D84S, C125S (INBRX-108) 0.9 28
[0471] As shown in Table 5 and
[0472] The PD-1 targeted IL-2 activities of the same polypeptides were tested in the PD-1-expressing IL-2 reporter cells. The EC.sub.50s on cells expressing PD-1 were calculated using a four parameter nonlinear curve fit in Prism 8 ([Agonist] vs response—Variable slope) and are shown in Table 6 below, and the dose response curves are shown in
TABLE-US-00006 TABLE 6 EC.sub.50s of polypeptides comprising a modified IL-2 on cells expressing PD-1 EC.sub.50 SEQ ID IL-2 modifications (nM) NO. T3A, H16A, L19A, P65R, D84S, C125S >100 110 T3A, H16A, P65R, D84S, N88S, C125S 0.001 111 T3A, H16A, P65R, D84S, E95Q, C125S 0.0006 112 T3A, H16A, M23A, P65R, D84S, C125S 0.001 113 T3A, H16A, M23A, P65R, D84S, E95Q, C125S 0.002 114 T3A, H16A, P65R, D84S, C125S 0.001 28 (INBRX-108)
[0473] As shown in Table 6 and
Example 19: Activities of Polypeptides Comprising a Modified IL-2
[0474] HEK-Blue IL-2 reporter cells described in Example 16 were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The identities and SEQ ID NOs of the modified IL-2s and EC.sub.50s of the tested polypeptides are shown in Table 7 below, and the dose response curves are shown in
TABLE-US-00007 TABLE 7 EC.sub.50s of Polypeptides comprising a modified IL-2 SEQ EC.sub.50 ID Cell Line IL-2 modifications (nM) NO. HEK-Blue IL-2 + PD-1 T3A, H16A, L19A, E61R, 0.002 115 HEK-Blue IL-2 P65R, D84S, C125S 10.13 HEK-Blue IL-2 + PD-1 T3A, H16A, M23A, E61R, 0.003 116 HEK-Blue IL-2 P65R, D84S, E95Q, C125S 39.42 HEK-Blue IL-2 + PD-1 T3A, H16A, M23A, E61R, 0.02 117 HEK-Blue IL-2 P65R, D84S, N88S, C125S >100 HEK-Blue IL-2 + PD-1 T3A, H16A, E61R, P65R, 0.02 118 HEK-Blue IL-2 D84S, N88S, E95Q, C125S >100 HEK-Blue IL-2 + PD-1 T3A, H16A, M23A, E61R, 0.6 119 HEK-Blue IL-2 P65R, D84S, N88S, E95Q, >100 C125S HEK-Blue IL-2 + PD-1 T3A, H16A, P65R, D84S, 0.001 28 HEK-Blue IL-2 C125S (INBRX-108) 0.512
[0475] As shown in Table 7 and
Example 20: Activities of Polypeptides Comprising a Modified IL-2
[0476] HEK-Blue IL-2 reporter cells described in Example 16 were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The identities and SEQ ID NOs of the modified IL-2s and EC.sub.50s of the tested polypeptides are shown in Table 8 below, and the dose response curves are shown in
TABLE-US-00008 TABLE 8 EC.sub.50s of Polypeptides comprising a modified IL-2 SEQ EC.sub.50 ID Cell line IL-2 modifications (nM) NO. HEK-Blue IL-2 + PD-1 T3A, H16A, L19A, R38A, 0.002 120 HEK-Blue IL-2 P65R, D84S, C125S 3.6 HEK-Blue IL-2 + PD-1 T3A, H16A, M23A, R38A, 0.004 121 HEK-Blue IL-2 P65R, D84S, E95Q, C125S 17.5 HEK-Blue IL-2 + PD-1 T3A, H16A, M23A, R38A, 0.05 124 HEK-Blue IL-2 P65R, D84S, N88S, E95Q, >100 C125S HEK-Blue IL-2 + PD-1 T3A, H16A, M23A, R38A, 0.008 122 HEK-Blue IL-2 P65R, D84S, N88S, C125S >100 HEK-Blue IL-2 + PD-1 T3A, H16A, R38A, P65R, 0.06 123 HEK-Blue IL-2 D84S, N88S, E95Q, C125S >100 HEK-Blue IL-2 + PD-1 T3A, H16A, P65R, D84S, 0.001 28 HEK-Blue IL-2 C125S (INBRX-108) 0.512
[0477] As shown in Table 8 and
Example 21: Activities of Polypeptides Comprising a Modified IL-2
[0478] HEK-Blue IL-2 reporter cells described in Example 16 were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The identities and SEQ ID NOs of the modified IL-2s and EC.sub.50s of the tested polypeptides are shown in Table 9 below, and the dose response curves are shown in
TABLE-US-00009 TABLE 9 EC.sub.50s of Polypeptides comprising a modified IL-2 SEQ EC.sub.50 ID Cell line IL-2 modifications (nM) NO. HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, P65R, 0.001 125 HEK-Blue IL-2 D84S, C125S 20.1 HEK-Blue IL-2 + PD-1 T3A, H16A, L19S, P65R, 0.002 126 HEK-Blue IL-2 D84S, C125S 4.02 HEK-Blue IL-2 + PD-1 T3A, H16A, L19T, P65R, 0.005 127 HEK-Blue IL-2 D84S, C125S 4.37 HEK-Blue IL-2 + PD-1 T3A, H16A, L19V, P65R, 0.002 128 HEK-Blue IL-2 D84S, C125S 3.72 HEK-Blue IL-2 + PD-1 T3A, H16A, P65R, D84S, 0.001 28 HEK-Blue IL-2 C125S (INBRX-108) 0.512
[0479] As shown in Table 9 and
Example 22: Activities of Polypeptides Comprising a Modified IL-2
[0480] HEK-Blue IL-2 reporter cells described in Example 16, were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The polypeptides were modified with IL-2 mutations designed to disrupt the IL-2-CD25 interface, and they were compared to control polypeptides comprising IL-2-RAS-T3A-C125S. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The identities and SEQ ID NOs of the modified IL-2s and EC.sub.50s of the tested polypeptides are shown in Table 10 below, and the dose response curves are shown in
TABLE-US-00010 TABLE 10 EC.sub.50s of Polypeptides comprising a modified IL-2 SEQ EC.sub.50 ID Cell line IL-2 modifications (nM) NO. HEK-Blue IL-2 + PD-1 T3A, H16A, P65R, D84S, 0.003 28 HEK-Blue IL-2 C125S (INBRX-108) 0.3 HEK-Blue IL-2 + PD-1 T3A, K43E, C125S 0.005 286 HEK-Blue IL-2 0.004 HEK-Blue IL-2 + PD-1 T3A, K43E, Y45R, C125S 0.004 283 HEK-Blue IL-2 0.006 HEK-Blue IL-2 + PD-1 T3A, E61R, P65R, C125S 0.005 106 HEK-Blue IL-2 0.01 HEK-Blue IL-2 + PD-1 T3A, R38A, P65R, C125S 0.006 107 HEK-Blue IL-2 0.01 HEK-Blue IL-2 + PD-1 T3A, K43E, P65R, C125S 0.005 288 HEK-Blue IL-2 0.007 HEK-Blue IL-2 + PD-1 T3A, K43E, Y45R, P65R, 0.005 289 HEK-Blue IL-2 C125S 0.009 HEK-Blue IL-2 + PD-1 T3A, P65R, I114F, C125S 0.007 287 HEK-Blue IL-2 0.01 HEK-Blue IL-2 + PD-1 T3A, E61R, C125S 0.006 284 HEK-Blue IL-2 0.004 HEK-Blue IL-2 + PD-1 T3A, I114F, C125S 0.02 285 HEK-Blue IL-2 >100 HEK-Blue IL-2 + PD-1 T3A, R38A, C125S 0.02 290 HEK-Blue IL-2 0.01
[0481] As shown in Table 10 and
Example 23: Activities of Polypeptides Comprising a Modified IL-2
[0482] IL-2 reporter cells described in Example 16 were used to measure the relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH. The reporter cells were treated with dilutions of the polypeptides and incubated 20 hours before Quanti-Blue analysis, as described in Example 15. The identities and SEQ ID NOs of the modified IL-2s and EC.sub.50s of the tested polypeptides are shown in Table 11 below, and the dose response curves are shown in
TABLE-US-00011 TABLE 11 EC.sub.50s of Polypeptides comprising a modified IL-2 SEQ EC.sub.50 ID Cell line IL-2 modifications (nM) NO. HEK-Blue IL-2 + PD-1 T3A, H16A, P65R, D84S, 0.003 28 HEK-Blue IL-2 C125S (INBRX-108) 0.3 HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, M23A, 0.017 129 HEK-Blue IL-2 E61R, P65R, D84S, E95Q, 38.46 C125S HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, M23A, 0.044 130 HEK-Blue IL-2 R38A, P65R, D84S, E95Q, 37.98 C125S HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, M23A, 0.015 131 HEK-Blue IL-2 R38A, P65R, D84S, C125S 43.33 HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, R38A, 0.019 132 HEK-Blue IL-2 P65R, D84S, E95Q C125S 60.14 HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, R38A, 0.007 133 HEK-Blue IL-2 P65R, D84S, C125S 13.81 HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, E61R, 0.006 134 HEK-Blue IL-2 P65R, D84S, C125S 17.23 HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, E61R, 0.022 135 HEK-Blue IL-2 P65R, D84S, E95Q, C125S 40.08 HEK-Blue IL-2 + PD-1 T3A, H16A, L19N, M23A, 0.016 136 HEK-Blue IL-2 E61R, P65R, D84S, C125S 29.27
[0483] As shown in Table 11 and
Example 24: CD25 Binding by Polypeptides Comprising a Modified IL-2
[0484] Polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1 binding VHH and control polypeptides were tested for binding to CD25 using Biolayer Interferometry (ForteBio). Histidine-tagged CD25 was immobilized, and 300 nM of a polypeptide listed in the table below was added. The resulting binding results are shown in Table 12 below.
TABLE-US-00012 TABLE 12 Polypeptides tested for binding to CD25 Binding SEQ to ID Polypeptide CD25 NO. IL-2-T3A-RAS-C125S Yes 28 WT IL-2 Yes 1 WT IL-15 No 284 IL-2-T3A-H16A-Δ42-P65R-D84S-C125S No 278 IL-2-T3A-H16A-E61R-P65R-D84S-C125S No 108 IL-2-T3A-H16A-F42R-P65R-D84S-C125S Yes 282 IL-2-T3A-H16A-R38A-P65R-D84S-C125S No 109 IL-2-T3A-H16A-K43E-Y45R-P65R-D84S-C125S No 279 PD-1-IL-2v fusion No 2 IL-2-T3A-H16A-K43E-P65R-D84S-C125S No 280 IL-2-T3A-H16A-P65R-D84S-I114F-C125S No 281
[0485] The polypeptide comprising IL-2-RAS-T3A-C125S bound CD25 despite comprising mutations designed to disrupt the CD25-IL-2 interface. The polypeptides comprising IL-2 comprising E61R and P65R mutations exhibited significantly decreased or no CD25 binding compared to the polypeptide comprising IL-2 comprising only RAS-T3A-C125S mutations.
Example 25: Activities of Polypeptides Comprising a Modified IL-2
[0486] The relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a PD-1-binding VHH were measured using HEK-Blue IL-2 reporter cells (InvivoGen) or modified cell clones expressing PD-1, as described in Example 16. The IL-2 modifications and SEQ ID NOs of the modified IL-2s are shown in Table 13.
[0487] The relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a NKp46-binding VHH were measured using HEK-Blue IL-2 reporter cells (InvivoGen) or modified cell clones expressing cells expressing NKp46. The IL-2 modifications and SEQ ID NOs of the modified IL-2s are shown in Table 13.
[0488] The relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a CD8a-binding VHH were measured using HEK-Blue IL-2 reporter cells (InvivoGen) or modified cell clones expressing cells expressing CD8a. The IL-2 modifications and SEQ ID NOs of the modified IL-2s are shown in Table 14.
[0489] Non-targeted activities were measured using cells lacking PD-1, lacking NKp46, and lacking CD8a expression.
[0490] The results are shown in Tables 13 and 14 below, and the dose response curves corresponding to Table 14 are shown in
TABLE-US-00013 TABLE 13 EC.sub.50s of polypeptides comprising a modified IL-2 Non- PD-1 NKp46 targeted Targeted Targeted EC.sub.50 EC.sub.50 EC.sub.50 PD-1 NKp46 SEQ IL-2 Modifications (nM) (nM) (nM) Window Window ID NO. T3G, C125S 0.020 0.020 1.056 105 None (IL-2 WT) 0.018 0.020 0.943 1 T3A, E61R, P65R, C125S 0.010 0.004 2.308 106 T3A, R38A, P65R, C125S 0.010 0.005 1.786 107 T3A, H16A, E61R, P65R, 3.178 0.002 1570.934 108 D84S, C125S T3A, H16A, R38A, P65R, 1.971 0.002 977.679 109 D84S, C125S T3A, H16A, L19A, P65R, 50.000 50.000 1.000 110 D84S, C125S T3A, H16A, P65R, D84S, 3.089 0.001 2214.337 111 N88S, C125S T3A, H16A, P65R, D84S, 3.859 0.001 6093.479 112 E95Q, C125S T3A, H16A, M23A, 3.125 0.001 2698.618 113 P65R, D84S, C125S T3A, H16A, M23A, 8.695 0.002 5420.823 114 P65R, D84S, E95Q, C125S T3A, H16A, L19A, E61R, 10.130 0.002 0.017 6481.126 581.850 115 P65R, D84S, C125S T3A, H16A, M23A, 39.420 0.003 0.020 11522.947 1976.931 116 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23A, 50.000 0.022 2289.377 117 E61R, P65R, D84S, N88S, C125S T3A, H16A, E61R, P65R, 50.000 0.020 2515.091 118 D84S, N88S, E95Q, C125S T3A, H16A, M23A, 50.000 0.592 84.517 119 E61R, P65R, D84S, N88S, E95Q, C125S T3A, H16A, L19A, R38A, 3.552 0.002 1481.852 120 P65R, D84S, C125S T3A, H16A, M23A, 17.460 0.004 0.017 4100.517 1006.920 121 R38A, P65R, D84S, E95Q, C125S T3A, H16A, M23A, 50.000 0.008 0.098 6344.373 509.892 122 R38A, P65R, D84S, N88S, C125S T3A, H16A, R38A, P65R, 50.000 0.062 806.712 123 D84S, N88S, E95Q, C125S T3A, H16A, M23A, 50.000 0.050 992.654 124 R38A, P65R, D84S, N88S, E95Q, C125S T3A, H16A, L19N, P65R, 20.090 0.001 21808.511 125 D84S, C125S T3A, H16A, L19S, P65R, 4.017 0.002 2376.923 126 D84S, C125S T3A, H16A, L19T, P65R, 4.372 0.005 858.939 127 D84S, C125S T3A, H16A, L19V, P65R, 3.716 0.002 1554.812 128 D84S, C125S T3A, H16A, L19N, 38.460 0.017 0.051 2293.381 748.686 129 M23A, E61R, P65R, D84S, E95Q, C125S T3A, H16A, L19N, 37.980 0.044 854.059 130 M23A, R38A, P65R, D84S, E95Q, C125S T3A, H16A, L19N, 43.330 0.015 2975.962 131 M23A, R38A, P65R, D84S, C125S T3A, H16A, L19N, R38A, 50.000 0.019 0.102 2597.403 491.159 132 P65R, D84S, E95Q, C125S T3A, H16A, L19N, R38A, 13.810 0.007 1943.155 133 P65R, D84S, C125S T3A, H16A, L19N, E61R, 17.230 0.006 0.053 2784.421 324.482 134 P65R, D84S, C125S T3A, H16A, L19N, E61R, 40.080 0.022 0.100 1852.982 400.000 135 P65R, D84S, E95Q, C125S T3A, H16A, L19N, 29.270 0.016 1854.880 136 M23A, E61R, P65R, D84S, C125S T3A, H16A, L19N, Q22A, 50.000 0.021 2373.042 137 E61R, P65R, D84S, C125S T3A, H16A, L19N, E61R, 50.000 0.021 2394.636 138 P65R, D84S, R120A, C125S T3A, H16A, L19N, E61R, 50.000 0.043 1170.412 139 P65R, D84S, C125S, Q126A T3A, H16S, L19N, E61R, 0.211 140 P65R, D84S, C125S T3A, H16T, L19N, E61R, 7.801 0.486 16.048 141 P65R, D84S, C125S T3A, H16V, L19N, E61R, 7.606 0.803 9.478 142 P65R, D84S, C125S T3A, H16N, L19N, E61R, 16.260 0.071 228.467 143 P65R, D84S, C125S T3A, H16A, L19N, E61R, 3.944 0.019 210.684 144 P65R, D84T, C125S T3A, H16A, L19N, E61R, 5.757 0.032 178.567 145 P65R, D84V, C125S T3A, H16A, D20S, E61R, 7.658 4.445 1.723 146 P65R, D84S, C125S T3A, H16A, D20T, E61R, 6.151 3.657 1.682 147 P65R, D84S, C125S T3A, H16A, D20N, E61R, 5.554 5.952 0.933 148 P65R, D84S, C125S T3A, H16A, D20A, E61R, 2.994 2.638 1.135 149 P65R, D84S, C125S T3A, H16A, L19N, E61R, 17.260 0.019 930.458 150 P65R, D84N, C125S T3A, H16A, E61R, P65R, 50.000 0.510 98.116 151 D84S, N88T C125S T3A, H16A, E61R, P65R, 50.000 0.146 341.997 152 D84S, N88AC125S T3A, H16P, L19A, E61R, 50.000 3.707 13.488 153 P65R, D84S, C125S T3A, H16A, L19H, E61R, 17.320 0.048 360.833 154 P65R, D84S, C125S T3A, H16A, L19P, E61R, 50.000 50.000 1.000 155 P65R, D84S, C125S T3A, H16A, L19Q, E61R, 17.870 0.042 423.560 156 P65R, D84S, C125S T3A, H16A, L19Y, E61R, 3.936 0.017 228.704 157 P65R, D84S, C125S T3A, H16A, L19A, E61R, 0.122 50.000 0.002 158 P65R, D84P, C125S T3A, H16A, L19A, E61R, 2.822 0.003 857.230 159 P65R, D84V, C125S T3A, H16A, L19A, E61R, 3.185 0.001 4696.255 160 P65R, D84Y, C125S T3A, H16A, M23A, 7.203 0.012 603.772 161 E61R, P65R, D84S, E95H, C125S T3A, H16A, M23A, 34.230 0.022 1583.989 162 E61R, P65R, D84S, E95N, C125S T3A, H16A, M23A, 4.867 0.002 2919.616 163 E61R, P65R, D84S, E95P, C125S T3A, H16A, M23A, 50.000 50.000 1.000 164 E61R, P65R, D84S, E95S, C125S T3A, H16A, M23A, 13.220 0.012 1111.859 165 E61R, P65R, D84S, E95T, C125S T3A, H16A, M23A, 13.850 0.064 216.711 166 E61R, P65R, D84S, E95V, C125S T3A, H16A, M23A, 20.410 0.088 230.726 167 E61R, P65R, D84S, E95Y, C125S T3A, H16A, L19A, E61A, 2.067 0.001 2145.304 168 P65R, D84S, C125S T3A, H16A, L19A, E61G, 3.263 0.000 12202.693 169 P65R, D84S, C125S T3A, H16A, L19A, E61H, 4.534 0.001 8458.955 170 P65R, D84S, C125S T3A, H16A, L19A, E61N, 1.997 0.000 12044.632 171 P65R, D84S, C125S T3A, H16A, L19A, E61P, 8.436 0.002 5137.637 172 P65R, D84S, C125S T3A, H16A, L19A, E61Q, 2.384 0.002 1129.323 173 P65R, D84S, C125S T3A, H16A, L19A, E61S, 3.269 0.001 2534.109 174 P65R, D84S, C125S T3A, H16A, L19A, E61T, 3.233 0.001 3725.942 175 P65R, D84S, C125S T3A, H16A, L19A, E61V, 0.643 0.003 195.797 176 P65R, D84S, C125S T3A, H16A, L19A, E61Y, 4.446 0.004 992.632 177 P65R, D84S, C125S T3A, H16A, M23D, 50.000 0.217 230.627 178 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23E, E61R, 24.940 0.020 1275.703 179 P65R, D84S, E95Q, C125S T3A, H16A, M23G, 19.120 0.063 301.958 180 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23I, E61R, 17.790 0.011 1648.749 181 P65R, D84S, E95Q, C125S T3A, H16A, M23K, 50.000 0.015 3405.995 182 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23L, E61R, 5.657 0.004 1589.045 183 P65R, D84S, E95Q, C125S T3A, H16A, M23N, 50.000 0.013 3808.073 184 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23P, E61R, 50.000 50.000 1.000 185 P65R, D84S, E95Q, C125S T3A, H16A, M23Q, 18.060 0.024 740.771 186 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23R, 50.000 0.031 1627.604 187 E61R, P65R, D84S, E95Q, C125S T3A, H16A, M23T, E61R, 22.720 0.030 746.632 188 P65R, D84S, E95Q, C125S T3A, H16A, M23V, 8.393 0.019 449.545 189 E61R, P65R, D84S, E95Q, C125S T3A, H16A, Q22A, E61R, 6.656 0.052 128.222 190 P65R, D84S, C125S T3A, H16A, Q22D, E61R, 8.855 0.065 136.042 191 P65R, D84S, C125S T3A, H16A, Q22E, E61R, 50.000 14.320 3.492 192 P65R, D84S, C125S T3A, H16A, Q22G, E61R, 8.201 0.083 98.310 193 P65R, D84S, C125S T3A, H16A, Q22H, E61R, 6.329 0.064 98.721 194 P65R, D84S, C125S T3A, H16A, Q22K, E61R, 2.178 0.020 110.111 195 P65R, D84S, C125S T3A, H16A, Q22N, E61R, 3.134 0.022 140.854 196 P65R, D84S, C125S T3A, H16A, Q22P, E61R, 50.000 45.710 1.094 197 P65R, D84S, C125S T3A, H16A, Q22R, E61R, 2.745 0.017 159.315 198 P65R, D84S, C125S T3A, H16A, Q22S, E61R, 3.131 0.024 129.273 199 P65R, D84S, C125S T3A, H16A, Q22T, E61R, 3.338 0.031 108.061 200 P65R, D84S, C125S T3A, H16A, Q22V, E61R, 4.837 0.050 96.759 201 P65R, D84S, C125S T3A, H16A, Q22Y, E61R, 5.823 0.090 65.061 202 P65R, D84S, C125S T3A, H16A, E61R, P65R, 1.628 0.011 153.440 203 D84S, R120A, C125S T3A, H16A, E61R, P65R, 3.164 0.049 65.210 204 D84S, R120D, C125S T3A, H16A, E61R, P65R, 1.115 0.014 82.531 205 D84S, R120E, C125S T3A, H16A, E61R, P65R, 2.017 0.018 114.278 206 D84S, R120F, C125S T3A, H16A, E61R, P65R, 1.829 0.013 141.345 207 D84S, R120G, C125S T3A, H16A, E61R, P65R, 1.512 0.012 130.570 208 D84S, R120H, C125S T3A, H16A, E61R, P65R, 2.594 0.023 114.323 209 D84S, R120K, C125S T3A, H16A, E61R, P65R, 3.724 0.040 92.522 210 D84S, R120N, C125S T3A, H16A, E61R, P65R, 50.000 50.000 1.000 211 D84S, R120P, C125S T3A, H16A, E61R, P65R, 2.308 0.026 90.227 212 D84S, R120Q, C125S T3A, H16A, E61R, P65R, 3.528 0.032 110.250 213 D84S, R120S, C125S T3A, H16A, E61R, P65R, 50.000 50.000 1.000 214 D84S, R120T, C125S T3A, H16A, E61R, P65R, 4.939 0.062 80.231 215 D84S, R120V, C125S T3A, H16A, E61R, P65R, 2.385 0.021 116.341 216 D84S, R120Y, C125S T3A, H16A, E61R, P65R, 13.010 0.041 320.364 217 D84S, T123D, C125S T3A, H16A, E61R, P65R, 2.191 0.019 115.865 218 D84S, T123E, C125S T3A, H16A, E61R, P65R, 18.790 0.053 352.798 219 D84S, T123H, C125S T3A, H16A, E61R, P65R, 11.010 0.050 219.279 220 D84S, T123K, C125S T3A, H16A, E61R, P65R, 18.150 0.094 192.389 221 D84S, T123N, C125S T3A, H16A, E61R, P65R, 2.337 0.036 64.665 222 D84S, T123Q, C125S T3A, H16A, E61R, P65R, 1.934 0.043 44.634 223 D84S, T123R, C125S T3A, H16A, E61R, P65R, 50.000 50.000 1.000 224 D84S, C125S, S130D T3A, H16A, E61R, P65R, 50.000 0.064 784.437 225 D84S, C125S, S130E T3A, H16A, E61R, P65R, 11.950 0.033 361.683 226 D84S, C125S, S130K T3A, H16A, E61R, P65R, 10.390 0.028 374.549 227 D84S, C125S, S130N T3A, H16A, E61R, P65R, 7.463 0.022 340.776 228 D84S, C125S, S130Q T3A, H16A, E61R, P65R, 8.598 0.029 291.853 229 D84S, C125S, S130R T3A, H16A, E61R, P65R, 50.000 0.085 591.296 230 D84S, C125S, S127D T3A, H16A, E61R, P65R, 5.134 0.015 351.403 231 D84S, C125S, S127E T3A, H16A, E61R, P65R, 7.078 0.020 349.531 232 D84S, C125S, S127H T3A, H16A, E61R, P65R, 50.000 0.017 2915.452 233 D84S, C125S, S127P T3A, H16A, E61R, P65R, 50.000 50.000 1.000 234 D84S, C125S, S127Q T3A, H16A, E61R, P65R, 4.921 50.000 0.098 235 D84S, C125S, S127R T3A, H16A, L19A, Q22A, 5.448 0.017 315.278 236 R38A, P65R, D84S, C125S T3A, H16A, L19A, R38A, 5.476 0.035 154.340 237 P65R, D84S, R120A, C125S T3A, H16A, L19A, Q22A, 7.176 0.045 158.691 238 R38A, P65R, D84S, R120A, C125S T3A, H16A, Q22A, 50.000 0.184 272.331 239 M23A, R38A, P65R, D84S, E95Q, C125S T3A, H16A, M23A, 21.330 0.057 372.707 240 R38A, P65R, D84S, E95Q, R120A, C125S T3A, H16A, Q22A, 50.000 0.274 182.216 241 M23A, R38A, P65R, D84S, E95Q, R120A, C125S T3A, H16A, L19N, Q22A, 50.000 0.524 95.511 242 R38A, P65R, D84S, C125S T3A, H16A, L19N, R38A, 41.050 0.064 643.720 243 P65R, D84S, R120A, C125S T3A, H16A, L19N, Q22A, 50.000 0.197 253.936 244 R38A, P65R, D84S, R120A, C125S A1G, P2G, T3S, S4G, 4.674 0.018 256.531 245 S5G, H16A, L19A, R38A, P65R, D84S, C125S Δ1-5, H16A, L19A, 5.030 0.015 328.758 246 R38A, P65R, D84S, C125S Δ1-5, H16A, L19A, 5.170 0.015 349.561 247 R38A, P65R, D84S, C125V T3A, L19N, R38A, P65R, 10.300 0.021 499.515 248 D84S, C125S T3A, H16A, L19N, R38A, 2.102 0.008 276.216 249 P65R, C125S T3A, L19N, Q22A, R38A, 15.060 0.048 314.208 250 P65R, D84S, C125S T3A, H16A, L19N, Q22A, 3.184 0.017 189.186 251 R38A, P65R, C125S T3A, L19N, Q22A, R38A, 13.730 0.073 188.910 252 P65R, D84S, R120A, C125S T3A, H16A, L19N, Q22A, 2.064 0.021 98.993 253 R38A, P65R, R120A, C125S T3A, Q22A, M23A, 10.370 0.140 73.966 254 R38A, P65R, D84S, E95Q, C125S T3A, Q22A, M23A, 2.063 0.028 73.364 255 R38A, P65R, E95Q, C125S T3A, Q22A, M23A, 10.600 0.148 71.767 256 R38A, P65R, D84S, E95Q, R120A, C125S T3A, H16A, Q22A, 4.556 0.126 36.187 257 M23A, R38A, P65R, E95Q, R120A, C125S T3A, L19A, Q22A, R38A, 2.091 0.054 38.946 258 P65R, D84S, C125S T3A, H16A, L19A, Q22A, 0.503 0.024 21.148 259 R38A, P65R, C125S T3A, L19A, Q22A, R38A, 1.796 0.054 33.265 260 P65R, D84S, R120A, C125S T3A, H16A, L19A, Q22A, 0.327 0.013 24.837 261 R38A, P65R, R120A, C125S T3A, H16A, L19A, E61R, 6.083 0.023 264.134 115 P65R, D84S, C125S T3A, H16A, E61R, P65R, 2.062 0.0422 49 262 D84S, C125S, I129A T3A, H16A, E61R, P65R, 1.435 0.0697 21 263 D84S, C125S, I129H T3A, H16A, E61R, P65R, 26.220 0.0648 405 264 D84S, C125S, H29R T3A, H16A, E61R, P65R, 16.170 0.0561 288 265 D84S, C125S, I129S T3A, H16A, E61R, P65R, 2.062 0.042 49 266 D84S, C125C, Q126N T3A, H16A, E61R, P65R, 1.435 0.070 21 267 D84S, C125C, Q126Y T3A, H16A, E61R, P65R, 26.220 0.065 405 268 D84S, C125C, S127N T3A, H16A, E61R, P65R, 16.170 0.056 288 269 D84S, C125C, S130P
TABLE-US-00014 TABLE 14 EC.sub.50s of polypeptides comprising a modified IL-2 Non- CD8a tar- Tar- geted geted CD8a SEQ EC.sub.50 EC.sub.50 Win- ID IL-2 Modifications (nM) (nM) dow NO. T3A, H16A, E61R, P65R, D84Y, C125S 4.515 0.011 400 270 T3A, H16A, M23T, E61R, P65R, D84Y, 50.000 0.057 871 271 E95Q, C125S T3A, H16A, L19N, E61R, P65R, D84Y, 50.000 0.074 673 272 C125S T3A, H16A, L19N, M23T, E61R, P65R, 50.000 50.000 1 273 D84Y, E95Q, C125S T3A, H16A, E61R, P65R, D84Y, 50.000 0.088 568 274 C125S, S127D T3A, H16A, M23T, E61R, P65R, D84Y, 50.000 50.000 1 275 E95Q, C125S, S127D T3A, H16A, L19N, E61R, P65R, D84Y, 50.000 50.000 1 276 C125S, S127D T3A, H16A, L19N, M23T, E61R, P65R, 50.000 50.000 1 277 D84Y, E95Q, C125S, S127D
Example 26: Non-Targeted Vs Targeted Activities of Polypeptides Comprising a Modified IL-2
[0491] The non-targeted and targeted IL-2 reporter activities of polypeptides described herein were analyzed and compared by plotting non-targeted and targeted EC.sub.50s determined in the IL-2 reporter assays described above.
Example 27: Activities of Polypeptides Comprising a Modified IL-2
[0492] The relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a γδTCR-binding VHH were determined by measuring pSTAT5 levels of PBMCs via flow cytometry. The polypeptides comprise Fc regions selected to form monovalent or bivalent γδTCR-binding polypeptides. The structures of the polypeptides are indicated in the table below.
TABLE-US-00015 TABLE 15 γδTCR-targeted polypeptides comprising modified IL-2 SEQ Va- ID Polypeptide lency NO(s). γδTCR 5C8 VHH-xELL hole T366S, L368A, Y407V, mono- 294, H435RFc; xELL knob Fc-IL-2-T3G-P65R-H16A- valent 295 D84S-C125S; FIGS. 27A, B γδTCR 5C8 VHH-xELL hole T366S, L368A, Y407V, bi- 295, H435R Fc; γδTCR 5C8 VHH-xELL knob Fc-IL-2- valent 296 T3A-H16A-E61R-P65R-D84Y-C125S; FIGS. 27C, D γδTCR 6C4 VHH-xELL hole T366S, L368A, Y407V bi- 298, H435R Fc; γδTCR 6C4 VHH-xELL-knob Fc-IL-2- valent 299 T3A-H16A-E61R-P65R-D84Y-C125S; FIGS. 27E, F 410A9vl (untargeted) VHH-xELL hole T366S, L368A, mono- 298, Y407V H435R Fc; γδTCR 6C4 VHH-xELL-knob Fc- valent 300 IL-2-T3A-H16A- E61R-P65R-D84Y-C125S; FIGS. 27G, H
[0493] PBMCs were isolated from healthy donor leukopaks by lymphoprep density gradient centrifugation. The cells were labeled for 20 minutes at room temperature with the following fluorescently conjugated antibodies: non-competing anti-γδTCR-FITC, anti-CD3-BV785, and anti-CD56-BV421. After washing, 200,000 PBMCs per well were seeded in a 96-well plate. The cells were treated with a titration of a fusion protein listed in the table above, starting at an initial concentration of 100 nM and titrating across the plate 1:5, in duplicate. The plates were incubated for 20 minutes at 37° C./5% CO.sub.2. The cells were fixed with BD Cytofix/Cytoperm™ (BD Biosciences), permeabilized in 90% ice-cold methanol, and levels of phosphorylated STAT5 (“pSTAT5”) on γδT cells were measured using flow cytometry using a phospho-specific anti-pSTAT5-PE antibody (1:70).
[0494] As shown in
Example 28: Activities of Polypeptides Comprising a Modified IL-2
[0495] The relative activities of polypeptides comprising a modified IL-2 fused to the C-terminus of a γδTCR-binding VHH or a non-targeted VHH were determined by measuring γδT cell and αβT cell proliferation and accumulation. The polypeptides comprise Fc regions selected to form monovalent or bivalent polypeptides. The structures of the polypeptides are indicated in the table below.
TABLE-US-00016 TABLE 16 γδTCR-targeted and non-targeted polypeptides comprising modified IL-2 SEQ ID Polypeptide Valency NO(s). γδTCR 5C8 VHH-xELL knob Fc-IL-2-T3A-H16A- mono- 64, E61R-P65R-D84Y-C125S; xELL hole Fc H435R, valent 296 T366S, L368A, Y407V Untargeted VHH-xELL hole T366S, L368A, Y407V N/A 300, H435R Fc; Untargeted VHH-xELL knob Fc-IL-2- 301 T3A-H16A- E61R-P65R-D84Y-C125S
[0496] IL-2 promotes the activation and proliferation of T cell populations. In order to assess the effect of γδTCR-targeted modified IL-2 on T cell proliferation, PBMCs were isolated from healthy donor leukopaks using lymphoprep density gradient medium. The cells were labeled with CellTrace Violet proliferative dye for 10 minutes at 37° C. After washing, the cells were resuspended in RPMI+10% FBS and 300,000 cells per well were added to a 96-well plate. The cells were treated with a titration of a fusion protein listed in the table above, starting at an initial concentration of 100 nM and titrating across the plate 1:5, in duplicate. The plates were incubated at 37° C./5% CO.sub.2 for 7 days. The cells were labeled with the following fluorescently conjugated antibodies: CD3-BV785, γδTCR-FITC, and the viability dye propidium iodide for 30 minutes at 4° C. The cells were washed and analyzed by flow cytometry.
[0497] As shown in
Example 29: Activities of Polypeptides Comprising a Modified IL-2
[0498] The relative activities of polypeptides comprising a modified IL-2 were determined by measuring pSTAT5 levels of PBMCs via flow cytometry. The structures of the polypeptides are indicated in the table below.
TABLE-US-00017 TABLE 17 Polypeptides comprising modified IL-2 SEQ ID Polypeptide NO(s). Wild type IL-2 1 Untargeted VHH-xELL hole T366S, L368A, Y407V H435R 300, Fc; 410A9v1 Untargeted VHH-xELL knob Fc-IL-2-T3A- 301 H16A-E61R-P65R-D84Y-C125S
[0499] Levels of pSTAT5 were measured by intracellular flow cytometry as a proximal readout of IL-2 receptor engagement and signaling. Human PBMCs were plated in a 96-well plate at 1,000,000 cells per well in complete growth media (RPMI, 10% FBS, 1% antibiotic-antimycotic). Test polypeptides were then diluted, and a 5-fold serial dilution was made. Serial dilutions were added to the cells and incubated for 15 minutes at 37° C. Cells were then fixed in 100 μL of Cytofix fixation buffer (BD) for 30 minutes at 4° C. Cells were then washed once in 200 μL FACS buffer and permeabilized in Perm buffer III (BD Phosflow) for 30 minutes at 4° C. Permeabilized cells were washed a total of three times in Permeabilization Buffer (eBioscience) and then incubated in Permeabilization Buffer containing fluorescently labeled antibodies against CD4 (OKT4, 1:100), CD3 (SP34-2, 1:50), CD16 (3G8, 1:1000), pSTAT5 (SRBCZX, 1:70), CD56 (NCAM16.2, 1:500), and CD8 (RPA-T8, 1:4000) overnight at 4° C. The next day, cells were washed with 150 μL FACS buffer and analyzed using an ACEA Biosciences Novocyte-Quanteon Flow Cytometer. IL-2 signaling was quantified via increases in the frequency and median fluorescence intensity levels of the fluorescently labeled antibody detecting pSTAT5 on NK cells (CD3−CD56brightCD16−). The data were plotted and analyzed using GraphPad Prism analysis software.
[0500] As shown in
[0501] The disclosure may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting of the disclosure. Scope of the disclosure is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are therefore intended to be embraced herein.
TABLE-US-00018 TABLE of Certain Sequences SEQ ID NO Description Sequence 1 Wild type Human APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATEL IL-2 KHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCE YADETATIVEFLNRWITFCQSIISTLT 2 IL-2v
In sequences that contain boxes or underlining, the boxes around individual letters indicate amino acid substitutions relative to a corresponding wild type or parental sequence; boxes around groups of letters indicate linker sequences. Underlined letters are linker sequences. Sequences that do not contain boxes or underlining may also contain amino acid substitutions and/or linker sequences.