MULTIPLEXED DIAGNOSTIC TO RECOGNIZE CONCENTRATIONS OF RELATED PROTEINS AND PEPTIDES
20200200772 ยท 2020-06-25
Inventors
- Brian Michael Cummins (Raleigh, NC, US)
- Frances Smith Ligler (Raleigh, NC, US)
- Glenn Walker (Raleigh, NC, US)
Cpc classification
G01N2333/635
PHYSICS
G01N33/74
PHYSICS
G01N33/566
PHYSICS
International classification
G01N33/74
PHYSICS
G01N33/566
PHYSICS
Abstract
Disclosed are methods and systems for determining concentrations of a target molecule and a variant thereof in a sample. The sample can comprise or be suspected to comprise a target molecule and at least one variant thereof and is exposed to one or more recognition elements that bind to the target molecule and/or the at least one variant. A signal is detected that is associated with the binding of the target molecule and/or a signal is detected that is associated with the binding of the at least one variant to the one or more recognition elements. The concentration of the target molecule and/or the at least one variant thereof is determined based on the signals. The system can comprise a receiver adapted to receive a sample comprising or suspected to comprise a target molecule and the at least one variant thereof, the receiver comprising one or more recognition elements that bind to one or more epitopes in the target molecule and/or the at least one variant thereof.
Claims
1. A method for determining concentrations of a target hormone molecule and a variant thereof in a sample, the method comprising: providing a sample comprising or suspected to comprise a target hormone molecule and at least one variant thereof, wherein the variant has a different number of amino acids than the target hormone molecule; exposing the sample to two or more recognition elements, wherein at least one recognition element binds the target hormone molecule and at least one recognition element binds both the target hormone molecule and the at least one variant, and wherein the two or more recognition elements are spectrally distinguishable; detecting a signal associated with the binding of the target hormone molecule to a recognition element in the two or more recognition elements and a signal associated with the binding of the at least one variant to a recognition element in the two or more recognition elements; and determining the concentration of the target hormone molecule and the at least one variant thereof based on the signals, provided that determining the concentration of the target hormone molecule and the at least one variant thereof based on the signals can comprise determining that only one of the molecules is present.
2. (canceled)
3. The method of claim 1, wherein the target hormone molecule and the at least one variant thereof comprise a hormone and one or more fragment(s) thereof.
4. The method of claim 1, wherein the sample comprises a clinical fluid and/or a tissue aspirate.
5. (canceled)
6. (canceled)
7. The method of claim 1, wherein the two or more recognition elements each comprise an antibody, a peptide, an aptamer, and/or a combination thereof.
8. The method of claim 1, wherein the two or more recognition elements bind to different epitopes of the target hormone molecule.
9. The method of claim 1, wherein the two or more recognition elements have different sensitivities for the target hormone molecule and the at least one variant thereof.
10. The method of claim 1, wherein the two or more recognition elements have different sensitivities for a complex comprising a the target hormone molecule and for a complex comprising the at least one variant thereof.
11. The method of claim 1, wherein the signal associated with the binding of the target hormone molecule to a recognition element in the two or more recognition elements and/or the signal associated with the binding of the at least one variant thereof to a recognition element in the two or more recognition elements is/are compared to a known sensitivity of the one or more recognition element for the target hormone molecule and/or of the recognition element for the at least one variant thereof to predict the concentration of the target hormone molecule and/or the at least one variant thereof within the sample.
12. A system for determining concentrations of a target hormone molecule and at least one variant thereof in a sample, wherein the variant has a different number of amino acids than the target hormone molecule, the system comprising: a receiver adapted to receive a sample comprising or suspected to comprise a target hormone molecule and the at least one variant thereof, the receiver comprising two or more recognition elements, wherein the two or more recognition elements are spectrally distinguishable, and wherein the two or more recognition elements include at least one recognition element that binds the target hormone molecule and at least one recognition element that binds both the target hormone molecule and the at least one variant.
13. (canceled)
14. The system of claim 12, wherein the target hormone molecule and the at least one variant thereof comprise a hormone and one or more fragment(s) thereof.
15. The system of claim 12, wherein the receiver is adapted to receive a sample comprising a clinical sample and/or a tissue aspirate.
16. The system of claim 12, further wherein the two or more recognition elements are placed at spatially separate locations on the receiver.
17. (canceled)
18. The system of claim 12, wherein the two or more recognition elements each comprise an antibody, a peptide, an aptamer, or a combination thereof.
19. The system of claim 12, wherein the two or more recognition elements comprise different elements that bind to different epitopes of the target molecule.
20. The system of claim 12, comprising a detector for detecting a signal associated with the binding of the target hormone molecule to a recognition element of the two or more recognition elements and a signal associated with the binding of the at least one variant to a recognition element of the two or more recognition elements.
21. The system of claim 20, comprising a processor for determining the concentration of the target hormone molecule and the at least one variant thereof based on the signals.
22. The system of claim 21, wherein the processor determines concentration by comparing the signal associated with the binding of the target hormone molecule to a recognition element in the two or more recognition elements and/or the signal associated with the binding of the at least one variant thereof to a recognition element in the two or more recognition elements to a known sensitivity of the recognition element for the target hormone molecule and/or the at least one variant thereof.
23. The system of claim 12, wherein the two or more recognition elements have different sensitivities for the target hormone molecule and the at least one variant thereof.
24. The system of claim 12, wherein the two or more recognition elements have different sensitivities for a complex comprising a and the target hormone molecule and for a complex comprising a the at least one variant thereof.
25. The method of claim 1, wherein the at least one variant is a metabolic fragment of the target hormone molecule.
26. The method of claim 1, wherein the target hormone molecule is whole parathyroid hormone (wPTH, SEQ ID NO: 1).
27. The method of claim 1, wherein the at least one variant thereof is intact parathyroid hormone (iPTH, SEQ ID NO: 2).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
[0028] The presently disclosed subject matter will now be described more fully hereinafter with reference to the accompanying Figures and Examples, in which representative embodiments are shown. The presently disclosed subject matter can, however, be embodied in different forms and should not be construed as limited to the embodiments set forth herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey the scope of the embodiments to those skilled in the art. Certain components in the figures are not necessarily to scale, emphasis instead being placed upon illustrating the principles of the presently disclosed subject matter (in some cases schematically).
[0029] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this presently described subject matter belongs. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety.
[0030] While the following terms are believed to be well understood by one of ordinary skill in the art, the following definitions are set forth to facilitate explanation of the presently claimed subject matter.
[0031] Following long-standing patent law convention, the terms a, an, and the refer to one or more when used herein, including in the claims.
[0032] As used herein, the term about, when referring to a value or an amount, for example, relative to another measure, is meant to encompass variations of in some embodiments 20%, in some embodiments 10%, in some embodiments 5%, in some embodiments 1%, and in some embodiments 0.1% from the specified value or amount, as such variations are appropriate. The term about can be applied to all values set forth herein.
[0033] As used herein, the term and/or when used in the context of a listing of entities, refers to the entities being present singly or in combination. Thus, for example, the phrase A, B, C, and/or D includes A, B, C, and D individually, but also includes any and all combinations and sub-combinations of A, B, C, and D.
[0034] The term comprising, which is synonymous with including, containing, or characterized by is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. Comprising is a term of art used in claim language which means that the named elements are present, but other elements can be added and still form a construct or method within the scope of the claim.
[0035] As used herein, the phrase consisting of excludes any element, step, or ingredient not specified in the claim. When the phrase consists of appears in a clause of the body of a claim, rather than immediately following the preamble, it limits only the element set forth in that clause; other elements are not excluded from the claim as a whole.
[0036] As used herein, the phrase consisting essentially of limits the scope of a claim to the specified materials or steps, plus those that do not materially affect the basic and novel characteristic(s) of the claimed subject matter.
[0037] With respect to the terms comprising, consisting of, and consisting essentially of, where one of these three terms is used herein, the presently disclosed and claimed subject matter can include the use of either of the other two terms.
[0038] As used herein, significance or significant relates to a statistical analysis of the probability that there is a non-random association between two or more entities. To determine whether or not a relationship is significant or has significance, statistical manipulations of the data can be performed to calculate a probability, expressed in some embodiments as a p-value. Those p-values that fall below a user-defined cutoff point are regarded as significant. In some embodiments, a p-value less than or equal to 0.05, in some embodiments less than 0.01, in some embodiments less than 0.005, and in some embodiments less than 0.001, are regarded as significant.
[0039] The presently disclosed subject matter can be used to detect target molecules and their variants. The term variant is used to include but is not limited to fragments, multimers, subunits and the like, of a given target molecule, including variants related to in vivo metabolic activity. In some embodiments, the target molecule and the at least one variant thereof comprise a protein and one or more fragment(s) thereof. In some embodiments, the target molecule and the at least one variant thereof comprise a hormone and one or more fragment(s) thereof.
[0040] The term clinical fluid or clinical sample is used to include materials derived from animals or humans including but not limited to whole blood, serum, plasma, urine, tissue aspirates, saliva, mucous, and any other samples derived from living tissues.
[0041] The presently disclosed subject matter relates in some embodiments to a multiplexed diagnostic system and method that are capable of determining the concentrations of target molecules and variants thereof, such as an original protein and its metabolic fragment(s). The multiplexing of the diagnostic can be performed, for example, spatially (such as via a microarray) or spectrally (such as via unique transduction elements; for background information on multiplexed assays using optical sensors, see reference (Ligler 2008).
[0042] Disclosed in accordance with the presently disclosed subject matter is a method for determining concentrations of a target molecule and/or a variant thereof in a sample. In some embodiments, the method comprises: providing a sample comprising or suspected to comprise a target molecule and/or at least one variant thereof; exposing the sample to one or more recognition elements that bind to the target molecule and/or the at least one variant; detecting a signal associated with the binding of the target molecule to the one or more recognition elements and/or a signal associated with the binding of the at least one variant to the one or more recognition elements; and determining the concentration of the target molecule and/or the at least one variant thereof based on the signals.
[0043] Disclosed in some embodiments is a system for determining concentrations of a target molecule and/or at least one variant thereof in a sample. In some embodiments, the system comprises: a receiver adapted to receive a sample comprising or suspected to comprise a target molecule and/or the at least one variant thereof, the receiver comprising one or more recognition elements that bind to one or more epitopes in the target molecule and/or the at least one variant thereof.
[0044] By the term suspected to comprise it is meant to refer to a sample that could comprise a target molecule and/or at least one variant thereof. To elaborate, the presently disclosed subject matter does not require the sample to have both a target and a variant. Methods and systems in accordance with the presently disclosed subject can thus pertain to situations where there could be a target and variant, but that also include cases where the sample is determined to not be a mixture. In fact, in case of original or initial uncertainty, the methods and systems of the presently disclosed subject matter can determine that only one of the molecules is present.
[0045] In some embodiments, the target molecule and the at least one variant thereof comprise a protein and/or one or more fragment(s) thereof. In some embodiments, the target molecule and the at least one variant thereof comprise a hormone and/or one or more fragment(s) thereof. In some embodiments, the sample comprises a clinical fluid and/or a tissue aspirate.
[0046] In some embodiments, the one or more recognition elements are spatially distinguishable. In some embodiments, the one or more recognition elements are spectrally distinguishable. In some embodiments, the one or more recognition elements bind one or more epitopes in the target molecule and/or the at least one variant thereof. In some embodiments, the one or more recognition elements bind to different epitopes of the target molecule and/or the at least one variant thereof.
[0047] In some embodiments, the one or more recognition elements have different sensitivities for the target molecule and the at least one variant thereof. In some embodiments, the one or more recognition elements have different sensitivities for complexes of tracer recognition molecules and the target and/or variant thereof. That is, in some embodiments, the one or more recognition elements have different sensitivities for a complex comprising a detectable moiety and the target and/or variant thereof. In some embodiments, the resulting signal from each of the one or more recognition elements is used to determine the concentration of the target molecule and/or the at least one variant thereof.
[0048] In some embodiments, two, three, four or more recognition elements can employed. By way of elaboration and not limitation, two or more recognition elements can be employed, wherein the two or more recognition elements distinguish the target molecule and the at least one variant thereof. Indeed, upon a review or the instant disclosure one of ordinary skill in the art would appreciate that any desired number of recognition elements can be employed, often depending on target molecule and variants thereof to be investigated.
[0049] In some embodiments, the signal associated with the binding of the target molecule to the one or more recognition elements and/or the signal associated with the binding of the at least one variant thereof to the one or more recognition elements is/are compared to a known sensitivity of the one or more recognition elements for the target molecule and/or the at least one variant thereof to predict the concentration of the target molecule and/or the at least one variant thereof within the sample. By way of elaboration and not limitation, in some embodiments, after exposing the sample to the recognition elements the signals associated with the binding of the target molecule and the at least one variant thereof to two or more distinguishing recognition elements are compared to the known sensitivities of each distinguishing recognition elements for the target molecule and the at least one variant thereof to predict concentrations of the target molecule and the at least one variant thereof within the sample.
[0050] Reference is now made to an example of an antibody microarray in accordance with the presently disclosed subject matter, which can discriminate between whole protein and a major fragment. This microarray can be constructed in a manner that allows clinical samples to be passed over it so that recognition elements bind to the target molecules. Different elements (spots) of the microarray can present unique recognition elements that bind to different epitopes of the original protein. By printing unique recognition elements with different sensitivities for the relevant forms of the target molecule(s) of interest in different spots, the resulting signal from each spot can be used to identify concentrations, such as the absolute or relative concentrations, of the intact protein and fragments of interest within the clinical sample.
[0051] In some embodiments, one can generate a diagnostic test to determine the concentration of the primary protein and one of the metabolic fragments. Metabolic fragments typically are generated by cleavage of the primary protein. Therefore, one spot (spot 1) can present a recognition element that recognizes an epitope that is present in the whole protein but that has been cleaved off in the metabolic fragment of interest. The other spot (spot 2) can present a recognition element that recognizes an epitope of the protein that also remains in the fragment. Spot 1 would only recognize the full protein, and spot 2 would recognize both the full protein and the fragment of interest. If the readout system requires a label, the detection recognition molecule of the sandwich can then be chosen to bind to an epitope that is on both the fragment of interest and the full protein. By knowing something about the relative sensitivities of spot 2 to the different molecules, the absolute concentrations of the two populations can be determined with the information from spot 1. This strategy can be implemented in more complicated situations to analyze more than one fragment derived from the protein.
[0052] The presently disclosed subject matter provides data comparable to that which is currently only obtained by using multiple tests or by using expensive, complex laboratory equipment like liquid chromatography and mass spectrometry. In some embodiments, the test disclosed herein is faster and less expensive, can be performed by minimally trained personnel, and can be performed using a small portable device. Therefore, this information can be obtained at new points in a clinical setting, and new criteria can be set that utilize this information.
[0053] The data from this new test can be compared to new criteria to increase the positive predictive value (PPV) and negative predictive value (NPV) of certain diagnostic tests. Representative tests (detailed examples below) include determining whether a parathyroidectomy needs to continue and determining whether a certain parathyroid gland is overacting or normal. A more accurate diagnostic directly decreases the incidence of resubmissions for surgery, and indirectly decreases the time and costs for current surgeries.
[0054] Thus, provided in some embodiments of the presently disclosed subject matter is a microfluidic point of care PTH device to detect PTH in the systemic blood from patients undergoing surgery for primary hyperparathyroidism. The microfluidic device can provide clinically relevant information from the PTH levels in parathyroid gland aspirate. Concentrations of whole PTH (amino acids 1-84) and intact PTH (amino acids 7-84) from clinical fluids can be accurately quantified using the novel microfluidic point of care device. The presently disclosed subject matter can thus meet a need for rapid and affordable IOPTH assays at least in part by developing a point-of-surgery PTH assay. In some embodiments, the system or analytical device is a portable device that is cost effective, provides rapid results, and is suitable for implementation in the surgical suite.
[0055] In accordance with some embodiments of the presently disclosed subject matter, a multiplexed diagnostic is provided using microarray technology. By using a microarray in the test cartridge or other receiver, more information can be generated from the test than from a single on-target capture element. In some embodiments the cartridges allow for on-chip replicates to be performed as well as providing internal standards to provide for background subtraction and normalization of the on-target capture spots to minimize inter-cartridge variability and enhance potential for quantitation. In addition, the microarray provides unique on-target capture spots that target different molecules or epitopes of the same molecule.
[0056] In some embodiments, capture or recognition elements are printed onto a single microarray-based test cartridge or other receiver. The responses of these cartridges can be tested against standards for a target molecule and one or more derivatives or variants thereof in buffered samples, such wPTH and iPTH standards, separately, to generate calibration curves. These curves are characterized to determine the standard error of calibration (SEC) and the standard error of prediction (SEP) for each target molecule and one or more variant(s) thereof. The target molecule and one or more variant(s) thereof can then be mixed and loaded onto the cartridge at varying ratios and the calibration curves can be used to predict the concentrations of target molecules within mixed samples. These predictions are compared to the absolute concentrations of the target molecule and one or more variant(s) thereof by calculating the SEP for each. Upon demonstration of the cartridges to predict a mixed sample of wPTH and iPTH, similar tests are performed in spiked clinical fluids (plasma, serum, and blood). As described herein, it is possible to use this information to generate an improved criterion with better negative predictive and positive predictive values. This can be tested with the aspirate from potential hyperfunctioning parathyroid glands and then later tested with the serum/plasma from a blood draw. The required quantitative dynamic range is likely to be different for these two types of tests, and it is possible that a given test is useful in one environment and not in the other. Receiving Operating Curves (ROC) can be generated and compared to those of the traditional diagnostic criterion that are used.
[0057] Referring now to
[0058] In some embodiments, detector D and/or processor P employ a readout system developed by mBio Diagnostics (Boulder, Colo., United States of America), such as a portable fluorescence reader available under the trademark Snap-Esi (Ligler 2007, Lochhead 2011, Meneely 2012). Concentrations can be calculated using any suitable approach as would be understood by one of ordinary skill in the art upon a review of the instant disclosure. Representative approaches are disclosed in the examples, including but not limited to implementation of systems of differential equations. A variety of algorithms can be employed in lieu of or in addition to the differential equations used in the examples. In some embodiments, system SYS comprises portable and/or hand-held sensors or lateral flow tests.
[0059] Further, in some embodiments, the presently disclosed subject matter can be used to detect target molecules and their variants (such as fragments, multimers, subunits and the like) related to other disorders including other endocrinological disorders, such as but not limited to the following.
A. Exemplary Target Molecules and Variants Thereof (including but not limited to fragments) for Multiplexing Technology in Addition to Parathyroid Hormone
[0060] A useful diagnostic can include one or more of these molecules listed below and the related fragments. The number of amino acids (aa) is listed for many of these molecules. Any aa range (e.g. x-y aa) listed for a given variant indicates the range of aa of the original target molecule. Approximate concentrations are listed for some of the examples. [0061] 1. Amylin
[0062] Amylin (islet amyloid polypeptide (IAPP) (37 aa)
[0063] Proislet amyloid polypeptideprolAPP (67 aa)
[0064] Non-fibril forming peptide (1-19 aa of human amylin, metabolic fragment)
[0065] Linked to Type 2 Diabetesislet amyloid deposits
[0066] Unprocessed prolAPP is secreted in addition to amylin. This unprocessed prolAPP can serve as the granule upon which IAPP can accumulate and form amyloid. The repairing of the prolAPP processing may help prevent B-cell death and be a therapeutic approach for Type 2 diabetes. (15 ng/L) normal [0067] 2. Angiotensinogen/Angiotensin
[0068] Angiotensinogen (453 aa)
[0069] Angiotensin 1 (10 aa, 25-143 pg/mL)), 2 (8 aa), 3 (7 aa), 4 (6 aa)
[0070] Causes vasoconstriction
[0071] Target for drugs that lower blood pressure. [0072] 3. Adrenocorticotropic hormone (ACTH)
[0073] Adrenocorticotropic hormone (1-39 aa)
[0074] Alpha-melanocyte stimulating hormone (1-13 aa)
[0075] Corticotropin-like intermediate peptide (CLIP) (19-39 aa)
[0076] Synthetic ACTH (1-24 aa) [0077] 4. Atrial natriuretic peptideregulated by degradation via neutral endopeptidase (NEP) [0078] 5. Brain natriuretic peptide (BNP),
[0079] BNP (32 aa),
[0080] proBNP, (108 aa) cleaved to give BNP and NT-proBNP (76 aa)
[0081] Used for screening acute congestive heart failure
[0082] Secreted in response to excessive stretching of heart muscle cells
[0083] One of several molecules indicating traumatic brain injury [0084] 6. Cholecystokininfamily of hormones, depending on aa length
[0085] Cholecystokininfamily of hormones, depending on aa length
[0086] Found in gastrointestinal system [0087] 7. CRH (Corticotropin releasing hormone)
[0088] CRH (1-41 aa)
[0089] C-terminal fragment of CRH (9-41 aa) acts as CRH antagonist
[0090] Secreted in response to stress, Associated with Alzheimer's and major depression
[0091] Stimulates synthesis of ACT [0092] 8. Cortistatin
[0093] Cortistatin 17 aa and Cortistatin 29 aa
[0094] Neuropeptide that depresses neuronal activity [0095] 9. Erythropoetin 34 kDa, (10 mU/mL)
[0096] Erythropoetin 34 kDa, (10 mU/mL)
[0097] Doping w/recombinant/synthetic fragments
[0098] Controls red blood cell production [0099] 10.Glucagon like peptide (7-37 aa) and (7-36 aa) [0100] 11.Galanin, GMAP, GALP, Alarin
[0101] All are fragments of 123 aa protein pre-pro-galanin, encoded by GAL gene
[0102] Galanin
[0103] Galanin message-associated protein (GMAP)
[0104] Galanin-like peptide (GALP) [0105] 12.Somatostatin14 aa, 28 aa [0106] 13.Prolactin
[0107] 4 kDa, 16 kDa, 22 kDa, big (40-60 kDa), and big-big (>100 kDa) [0108] 14. Pro-opiomelanocortin (POMC)-related end-products
[0109] Gamma-Melanotropin (gamma-MSH)
[0110] Adrenocorticotropic hormone (ACTH) (AKA Corticotropin)
[0111] Alpha-Melanotropin (alpha-MSH)
[0112] Corticotropin-like Intermediate Peptide (CLIP)
[0113] Beta-Melanotropin (beta-MSH)
[0114] Beta-Lipotropin (beta-LPH)
[0115] Gamma-Lipotropin (Gamma-LPH)
[0116] Beta-Endorphin [0117] 15. Orexin A (33 aa)
[0118] Orexin B (28 aa) [0119] 16.Instead of or in addition to fragments, look at multimers of a single protein.
[0120] Adiponectin244 aa, (5 ug/mL)
[0121] High molecular weight forms
[0122] Quantify concentration of monomer, trimer, hexamer, and dodecamer
[0123] Ratios can indicate risk factor of diabetes, coronary artery disease, metabolic syndromes [0124] 17.Instead of fragments or multimers, look at proteins that are composed of multiple subunits that share 1 or more subunits and are different in 1 or more subunits.
[0125] Luteinizing Hormone (LH), Folicle Stimulating Hormone (FSH), Thyroid-Stimulating Hormone (TSH), and Human Chorionic Gonadotropin (HCG) all have the same alpha subunit but have different beta subunits
B. Additional Alternatives
[0126] In some embodiments, the presently disclosed methods and systems employ a technique in which the detection is spectrally multiplexed instead of and/or in addition to spatially multiplexed. That is, in some embodiments, the one or more recognition elements are spectrally distinguishable.
[0127] In some embodiments, the presently disclosed methods and systems employ aptamers or peptides, such as combinatorially selected aptamers or peptides, in place of antibodies as the bio-recognition molecules. That is, in some embodiments, the one or more recognition elements comprise an antibody, a peptide, an aptamer, and/or a combination thereof.
[0128] A variety of algorithms can replace the differential equations used to describe the system in the examples.
[0129] In some embodiments, the presently disclosed methods and systems incorporate multi-target assays for intact and modified proteins into a variety of portable and hand-held sensors or lateral flow tests.
EXAMPLES
[0130] The following Examples have been included to provide guidance to one of ordinary skill in the art for practicing representative embodiments of the presently disclosed subject matter. In light of the present disclosure and the general level of skill in the art, those of skill can appreciate that the following Examples are intended to be exemplary only and that numerous changes, modifications, and alterations can be employed without departing from the scope of the presently disclosed subject matter. The possible targets are not limited to PTH and its variants.
Example 1
PTH Testing for Initial Patient Screening and Intraoperative PTH Testing
[0131] One example where the presently disclosed subject matter can be employed is in the IOPTH measurements during a parathyroidectomy. Physiologically, PTH is originally synthesized as a 115 amino acid polypeptide called pre-pro-PTH. This peptide is cleaved at the N-terminus within parathyroid cells to pro-PTH and then to PTH (84 amino acids). This whole PTH (amino acidsl-84) (wPTH; SEQ ID NO: 1) is stored in the parathyroid glands and is secreted into the blood where it increases the rate of bone resorption. It is cleared by the liver and kidneys as well as broken down into smaller polypeptides (via peripheral metabolism) like intact PTH (amino acids 7-84) (iPTH; SEQ ID NO: 2) (Potts 2013). These C-terminal fragments are cleared through similar processes (by the liver and kidneys and the peripheral metabolism into shorter fragments), but the rates of iPTH clearance can be different than that of wPTH. In fact, these large C-terminal fragments of PTH have been observed to have a longer circulation half-life (20 min) than wPTH (2 min) (Yamashita 2003).
[0132] The primary function of wPTH is to stimulate the release of calcium from the bones into the blood. In healthy individuals, wPTH is released in response to low calcium concentrations in order to return to the desired calcium homeostasis. Normal concentrations of ionized calcium in the serum are 1.19-1.34 mM, and normal concentrations of PTH are 1.0-6.8 pM. However, there are instances where this feedback mechanism does not function properly, and these concentrations are either too high or too low. Because calcium concentrations need to be tightly regulated within normal levels for an individual to lead a full, healthy life, interventions are necessary (Potts 2013).
[0133] Primary hyperparathyroidism is a disorder where the systemic PTH concentrations are abnormally elevated as a result from the hyper-secretion of PTH by one or more parathyroid glands. This hyper-secretion is typically due to an adenoma in the gland. Approximately 80-85% of these cases display a single hyper-functioning gland and 15-20% of these cases display multiple. There are approximately 100,000 new cases of primary hyperparathyroidism appearing in the United States each year (Udelsman 2002, Pelleitteri 2013, Grant 2005). The elevated systemic PTH levels stimulate bone resorption which causes damage to the bone and deleterious, elevated calcium concentrations in the blood. The standard of care is to remove the hyper-secreting parathyroid gland as identified, if possible, with medical imaging and then determine whether additional glands need to be removed during the surgical procedure. After some time, the systemic PTH is expected to drop to normal levels following the removal of all over-acting glands, and, fortunately, wPTH has a very short circulating half-life (Inabnet 2004).
[0134] There has been significant debate in the field regarding the characteristic change in PTH that best indicates a successful surgery. The Miami criterion is the most well-known standard upon which surgeons use the results from intraoperative PTH assays. It states that the surgery is complete/successful (meaning no additional glands should be removed) if the systemic level of PTH drops to less than 50% of the original levels after 10 minutes (Irvin 1991, Irvin 1993, Greene 2009).
[0135] Many different variations of the PTH assay have been developed over the years (Meyer 2009). The most common type of assay that is currently being used is termed the 2.sup.nd generation PTH assay (Goodman 2005). These assays have been shown to recognize both wPTH and iPTH, and these assays output a single PTH measurement. One group recently proposed using a kinetics-based approach with a 2.sup.nd generation assay. They fit the IOPTH data with a single secretion and a single consumption term, and reported how the secretion rate changed upon excision (Bieglmayer 2002). While they reported an improvement on identifying successful surgeries, other groups have since reported that their criterion is no better than the Miami Criterion. This could be because the complex interplay between wPTH and iPTH could not be accounted for by fitting a simplified kinetic model with data from a 2.sup.nd generation assay (Carneiro 2003). At the time, the cause of this problem was poorly understood (Gao, 2005).
[0136] A newer generation of the PTH-assay only recognizes wPTH by using an antibody in the sandwich immunoassay that recognizes the first several amino acids of the N-terminus. These assays are sometimes referred to as 3.sup.rd generation PTH assays. Some groups have compared these 3.sup.rd generation assays with the 2.sup.nd generation assays to determine whether new criteria can be set (Caron 2009, Cavalier 2014). However, while the ratio of 3.sup.rd generation response to 2.sup.nd generation response has found some utility, the limited use of the two separate assays has not generated a new criterion for a successful parathyroidectomy to date (Boudou 2005).
[0137] The presently disclosed subject matter provides for the elucidation of the absolute or relative concentrations of wPTH and iPTH. For a parathyroidectomy, this could be performed at different time points after the removal of the over-acting gland to obtain time-dependent concentrations of these different protein subpopulations.
[0138] Quantitation of wPTH and iPTH in a Mixed Sample on Separate Cartridges (CL1).
[0139] Cartridges were developed using a readout system developed by mBio Diagnostics (Boulder, Colo., United States of America) that employed a microarray to be used with one of their portable fluorescence readers (available under the trademark Snap-Esi) (Ligler 2007, Lochhead 2011, Meneely 2012). In a representative, non-limiting microarray embodiment using a single capture antibody, two different fluorescence detection antibodies were used in adjacent cartridges. These unique detection antibodies had different relative sensitivities to wPTH and iPTH, allowing the responses of the adjacent cartridges to offer information to determine the concentrations of wPTH and iPTH in a mixed sample.
[0140] The hormone (wPTH) and the targeted variant (iPTH) for this example are further described below.
TABLE-US-00001 WholePTH(1-84aa,wPTH;SEQIDNO:1) MolecularWeight(MW):9.4kDa IsoelectricPoint(pI):9.10 AASequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAP LAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ IntactPTH(7-84aa,iPTH;SEQIDNO:2) MW:8.8kDa pI:9.46 AASequence: LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQR PRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
[0141] The antibodies used for this example are further described below. Scanti-N and mAb 15-25 were both fluorescently labeled with Alexa Fluor 647 and served as the detection antibodies. The mAb 53-84 antibody served as the capture antibody in the diagnostic.
[0142] Scanti-N (binds epitope SVSEIQ, SEQ ID NO: 3; see also
[0143] mAb 15-25 (binds epitope LNSMERVEWLR, SEQ ID NO: 4; see also
[0144] mAb 53-84 (binds epitope KKEDNVLVESHEKSLGEADKADVNVLTKAKSQ, SEQ ID NO:5; see also
[0145] A microarray MA was printed in a microfluidic cartridge as described in
[0146]
[0147] In this example, the cartridge presents one type of on-target capture antibody (mAb 53-84). To determine the absolute concentrations of a mixed sample of wPTH and iPTH using this format, each sample was run on two cartridges where each cartridge used a unique type of detection antibody (Cartridge 1 Cl used AF647 labeled mAb 15-25 and Cartridge 2 C2 used AF647 labeled Scanti-N).
[0148] For each sample, the following method was used: [0149] 1. Prepare desired mixture of wPTH and iPTH. [0150] 2. Mix 25 microliters (L) of sample with 11 L 83.33 nM AF647-mAb 15-25 to make Solution 1 and in another solution mix 25 L of sample with 11 L 83.33 nM AF647-Scanti-N to make Solution 2. [0151] 3. After 30 seconds of mixing, load Solution 1 onto Cartridge 1 and Solution 2 onto Cartridge 2 and leave flat. [0152] 4. After 20 minutes, add 100 L wash buffer to each cartridge. [0153] 5. After 1.75 min, scan each cartridge using Snap-Esi Reader
[0154] The images collected for each of three different samples are shown in
[0155] For each image, the following method was used to obtain an averaged, normalized, and background subtracted value to be reported. [0156] 1. Calculate the intensity of each predefined spot of the image. [0157] 2. Intensity of adjacent buffer spots subtracted from on-target (P3108-91B) and AF647-BSA spots [0158] 3. Subtracted on-target intensity is normalized by dividing by intensity of subtracted control AF647-BSA printed spots [0159] 4. The duplicate normalized, subtracted on-target spots are averaged to give the final reported value (F1 for Cartridge 1 and F2 for Cartridge 2).
[0160] The final reported value for Cartridge 1 and 2 for each sample was then plotted against the actual concentration of each target to obtain the various calibration curves. This is shown in
[0161] Surface-based assays typically have a linear region where the signal correlates to the target concentration. Using the multiple cartridges with the appropriate, unique detection antibodies as described in this example, a system of linear equations can be generated to correlate the fluorescence intensities from the different cartridges to the absolute concentrations within the mixture. The system can be described using Equation 1. In this equation, F1 is indicative of the final reported value for Cartridge 1 and F2 is the final reported value for Cartridge 2. The slopes and intercepts can be obtained through the data in
Once the slopes and intercepts for the system of equations have identified via calibration, this multi-cartridge approach can be used to predict the, concentrations of a mixed sample using Equation 2. Note that the miw:mii ratio must be significantly different than m.sub.2w:m.sub.2i ratio to enable the accurate prediction of a mixed sample
[0162]
[0163] The orientation of these assays could be flipped to where the mAb 15-25 and Scanti-N serve as the capture antibodies on a single cartridge and mAb 53-84 serve as the fluorescently labeled detection antibody. Further, more cartridge/detection antibody combinations could optionally be run in parallel. And, if done, Equations 1 and 2 could be made more complex and could still be used predict the concentrations of wPTH and iPTH and/or for any other desired purpose.
Example 2
Quantitation of Whole PTH and Methionine-Whole PTH on a Single Multiplexed Cartridge
[0164] In this example, an approach to quantify the concentrations of a protein and a methionine version of the protein using a single multiplexed cartridge is presented. Recombinant proteins are often used in place of the natural proteins for various purposes. It could be essential for the recombinant protein to be identical in amino acid sequence to the native protein. However, depending on the post-translation processes by the supplier, it is possible that the recombinant protein differs from the natural protein in that it retains an additional methionine residue at the N-terminus. Methionine is often a part of the pro-protein, as it is coded for by the most common start codons, but it is typically cleaved by proteases in nature. Some suppliers do not remove the methionine residue added to the sequence during the production process.
[0165] This example shows that it is possible to quantify the concentration of a mixture of two proteins that differ by only one amino acid using the single multiplexed cartridge. This example describes representative bio-recognition elements that have been identified, screened, and shown to work in approaches similar to those described in Example 1.
[0166] The capability to measure a protein with an additional methionine or other variations of recombinant proteins can be of use in the development, processing, or use of proteins for therapeutics, diagnostics, food, or other purposes.
[0167] Cartridges were developed using a readout system developed by mBio Diagnostics (Boulder, Colo., United States of America) that employed a microarray to be used with one of their portable fluorescence readers (available under the trademark Snap-Esi). In a representative, non-limiting microarray embodiment, two-unique capture elements have different relative sensitivities to wPTH and mPTH, and the information from the microarray can be used to determine the concentrations of wPTH and mPTH in a mixed sample.
[0168] The hormone (wPTH) and the targeted variant (mPTH) for this example are further described below.
TABLE-US-00002 WholePTH(1-84aa,wPTH;SEQIDNO:1) MW:9.4kDa pI:9.10 AASequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAP LAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Methionine-wholePTH(m+1-84aa,nnPTH; SEQIDNO:6) MW9.6kDa pI:9.10 AASequence: MSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAP LAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
[0169] The antibodies used for this example are further described below. The mAb 1-10 and mAb 15-25 were printed in unique spots and served as two different capture antibodies in a single diagnostic cartridge. The mAb 53-84 antibody was fluorescently labeled with Alexa Fluor 647 and served as the detection antibody.
[0170] mAb 1-10 (binds epitope SVSEIQLMHN, SEQ ID NO: 7; see also
[0171] mAb 15-25 (binds epitope LNSMERVEWLR, SEQ ID NO: 4; see also
[0172] mAb 53-84 (binds epitope KKEDNVLVESHEKSLGEADKADVNVLTKAKSQ, SEQ ID NO:5; see also
[0173] A microarray MA was printed in a microfluidic cartridge CT as described in
[0174] In this example, the cartridge CT presents two types of on-target capture antibody (mAb 1-10 and mAb 15-25). Using this format, it is possible to determine the absolute concentrations of a mixed sample of wPTH and mPTH on a single cartridge with a single detection antibody (AF647-labeled mAb 53-84).
[0175] For each sample, the following method was used: [0176] 1. Prepare desired mixture of wPTH and mPTH. [0177] 2. Add 32 L of target sample in buffer [0178] 3. After 60 minutes, load 80 L of 25 nM AF647-mAb 53-84 and place on incline [0179] 4. After 2 minutes on incline, move to flat surface. [0180] 5. After 8 minutes, add 100 L wash buffer and place on incline [0181] 6. After 2 minutes, scan cartridge using Snap-Esi Reader.
[0182] The images collected for each of three different samples (Sample 1, lower panel: 100 ng/mL wPTH, 0 ng/mL mPTH; Sample 2, middle panel: 0 ng/mL wPTH, 100 ng/mL mPTH; Sample 3, upper panel: 0 ng/mL wPTH, 0 ng/mL mPTHBLANK) are shown in
[0183] For each image, the following method was used to obtain an averaged, normalized, and background subtracted value to be reported. [0184] 1. Calculate the intensity of each predefined spot of the image. [0185] 2. Intensity of adjacent buffer spots subtracted from the different on-target spots (ab14493 and P3108-97A) and BSA-AF647 spots. [0186] 3. Subtracted on-target intensity is normalized by dividing by intensity of subtracted control BSA-AF647 printed spots. [0187] 4. The duplicate normalized, subtracted on-target spots are averaged to give the final reported value (F1 for top (mAb 15-25) and F2 for bottom (mAb 1-10)).
[0188] The final reported value for capture spot 1 and 2 (F1 and F2) for each sample was then plotted against the actual concentration of each target to obtain the various calibration curves. This is shown in
[0189] Surface-based assays typically have a linear region where the signal correlates to the target concentration. Using the multiplexed cartridge with the two unique capture antibodies as described in this example, a system of linear equations can be generated to correlate the fluorescence intensities from the different spots to the absolute concentrations within the mixture. The system can be described using Equation 3. In this equation, F.sub.1 is indicative of the final reported value for the mAb 15-25 capture antibody spots and F.sub.2 is the final reported value for the mAb 1-10 capture antibody spots. The slopes and intercepts can be obtained through the data in
Once the slopes and intercepts for the system of equations have been identified via calibration, this multiplexed approach on a single cartridge can be used to predict the concentrations of a mixed sample using Equation 4. Note that the miw:mim ratio must be significantly different than m.sub.2w:m.sub.2m ratio to enable the accurate prediction of a mixed sample
[0190]
[0191] Instead of passing the different components over the microarray in a sequential manner, the sample could first be mixed with the detection antibody. This mixture of the sample and detection antibody would form complexes and would then be passed over the microarray. In this case, the one or more recognition elements would have different sensitivities for the complexes comprising the detectable moiety and the target and/or variant thereof.
[0192] The orientation of these assays could be flipped to where the mAb 53-84 serves as the capture antibody and mAb 15-25 and mAb 1-10 serve as the fluorescently labeled detection antibodies (using a similar approach to Example 1 with multiple cartridges). Further, additional, unique capture Abs could optionally be printed. If done, the signals could be added in Equations 1 and 2 to make them more complex for continued use in predicting the concentrations of wPTH and mPTH and/or for any other desired purpose.
Example 3
Understanding Kinetics of Metabolism and Impact of Complicating Pathological Processes
[0193] By knowing something about the way the different proteins are produced and cleared from the body, the time-dependent concentrations of each molecule can be described with a set of differential equations that account for the secretion and clearance of the two populations. As an example, with a multiplexed diagnostic assay that can accurately measure the absolute concentrations of wPTH and iPTH at unique points of time, the kinetic rate constants for this model can be generated and used to better understand the status of the individual patient. With a sufficient mathematical description, the experimentally determined rate of secretion of wPTH after the suspect gland is excised can be determined and then compared to the original rate of secretion. This reduction can be attributed to the surgical procedure and could potentially be the basis of an improved criterion of a successful surgery.
[0194] All criteria that are currently being used in the clinic are based on the absolute drop in the systemic concentration of PTH detected by the intraoperative assay (detecting both wPTH and iPTH), and they show a range of negative predictive values (42%-88%) and overall accuracies (79-97%) in clinical studies. Through the implementation of the presently disclosed subject matter, a better criterion can be defined that can improve the positive and negative predictive valuesas well as the resulting overall accuracy of the diagnosticbased on the drop in the actual PTH secretion rate. In addition, it allows the measurement to be performed sooner. That is, instead of waiting on the clearance of PTH to achieve concentrations that indicate that the rate of secretion has significantly dropped, one can determine the rate of secretion directly in a manner that can be quicker than current approaches.
[0195] The changing concentrations of wPTH and iPTH in whole blood can be described with the schematic in
[0196] In these equations, k1 is the rate of secretion of wPTH by the parathyroid glands, k2 is the combined rate of clearance of wPTH by the livers and kidneys and the peripheral metabolism of whole PTH to fragments smaller than iPTH, k3 is the rate of peripheral metabolism of wPTH to iPTH, k4 is the rate of secretion of iPTH by the parathyroid glands, and k5 is the combined rate of clearance of intact PTH by the livers and kidneys as well as the peripheral metabolism to smaller fragments. Note that k1 and k4 are calcium dependent.
[0197] The validity of the best-fit kinetic rate constants for this system of differential equations to output meaningful rates was tested with a set of already published data (Nguyen-Yamamoto 2002). In that work, human wPTH (h-wPTH) was administered via a bolus injection to two sets of rats. The rats of one set were healthy. The rats of the other set were nephrectomized but otherwise healthy, preventing them from clearing the through the normal pathway of the kidneys. Because of this, it is expected that the rate of clearance of wPTH and iPTH should be lower in nephrectomized rats than normal rats. Other clearance pathways are expected to continue to perform normally.
[0198] After injection of human wPTH, blood draws were performed at various times. These samples were examined via Gen 2 PTH assays that respond to wPTH and iPTH equally, and therefore detect the combined concentration of wPTH and iPTH. These assays do not respond to rat PTH. These samples were also examined with HPLC to determine the relative concentrations of wPTH and iPTH. By pairing the 2.sup.nd generation assay data with the HPLC data, it is possible to generate the kinetic, decay curves shown below for wPTH and iPTH after injection. PTH (1-84) and non (1-84) PTH are the terms the original authors used for wPTH and iPTH, respectively. Referring to
[0199] Because rats do not synthesize human wPTH or iPTH, it is possible to describe these systems with the system of differential equations (Equation 1 and 2) and set k1 and k4 to zero. By minimizing the standard error of prediction, the optimal rates for k2, k3, and k5 were identified for the best-fit of the data. After getting a rough estimate of k3, it was fixed because the nephrectomy is not expected to change the peripheral metabolism of wPTH into iPTH. The kinetic data was then fit to identify k2 and k5 in order to examine the effect of the nephrectomy on the clearance of the wPTH and iPTH. This generated the plots in
TABLE-US-00003 TABLE 1 Comparison of experimentally determined kinetic rate constants for healthy and nephrectomized rats. Experimentally determined kinetic rate constants Normal Nephrectomized k1 0 0 k2 0.2716 0.1616 k3 0.01 0.01 k4 0 0 k5 0.0714 0.0547
[0200] The best-fit k2 and k5 rateswhich indicate the clearance of wPTH and iPTH, respectivelyare 25-40% lower for nephrectomized rats than normal rats. This value agrees with what is expected in the physiological case. Nephrectomized rats do not have the ability to clear the related PTH proteins via the normal, kidney pathway. However, they do still have other pathways for the proteins to be cleared (via peripheral metabolism and the liver). In this case, the kinetic rates of clearance clearly show the ability to distinguish non-normal from normal. This experiment validates the capability of being able to use the concentrations of a set of related proteins to better understand a specific physiological system and provide an improved diagnosis.
[0201] While obtaining the experimental data originally published in (Nguyen-Yamamoto 2002) required a time-intensive process of purifying a serum sample and then separating it using HPLC to determine the relative concentrations of these two populations, the proposed multiplexed diagnostic test can be used to obtain similar data to that shown in
[0202] Using a similar strategy to compare the secretion rates (specifically k1) of PTH before and after a parathyroidectomy is expected to give an even greater change in rates. Because of the high levels of PTH in primary hyperparathyroidism, the normally functioning parathyroid glands are producing negligible amounts of PTH. This means the secretion rates of PTH immediately after a successful parathyroidectomy should be much lower than normal. Prior to the parathyroidectomy, the over-acting glands are already outputting significantly higher values than normal. Therefore, the decrease in the rate of secretion of wPTH upon successful excision of the over-acting gland is expected to be an order of magnitude or more.
[0203] In addition, it is possible that k2, k3, and k5 can be predicted for a given patient based on basic measurable factors (such as risk factors, weight, age, kidney function, etc.). By having good predictors of these clearance rates, the secretion rates of wPTH and iPTH (k1 and k4) can be determined with minimal samples and time during a parathyroidectomy. In addition, the secretion rate constants k1 and k4 can potentially be determined for a patient by performing a measurement on the microarray before the parathyroidectomy. In this case, the assumption would need to be made that the system was in steady state.
[0204] This type of multiplexed diagnostic can also be implemented to help diagnose whether the hyperparathyroidism is primary, secondary, or tertiary. The kinetics of PTH secretion and clearance can be determined by giving patients a bolus of wPTH and studying the time-dependent changes of wPTH and iPTH back to pre-bolus levels.
Example 4
Parathyroid Aspirate PTH Testing
[0205] Prior to a parathyroidectomy, many surgeons perform a needle aspirate on suspected parathyroid glands to determine whether they are parathyroid tissue or a thyroid nodule. While this test is effective at identifying a parathyroid gland, it is a poor predictor of whether that gland is hyperfunctioning due to the multiple variables involved (i.e. how much tissue is removed, how much volume is used to dilute the aspirate).
[0206] In primary hyperparathyroidism, the ratio of wPTH secretion rate to iPTH secretion rate is expected to be different in hyperfunctioning tissue compared to normal tissue. As such, it is suspected that the relative concentrations of wPTH to iPTH in the aspirate of these glands should reflect the pathology. A test that can distinguish the concentration of wPTH and iPTH (and/or the relative concentrations) can be used as a clinical determinant of normal vs hyperfunctioning tissue. This test is insensitive to the variables that currently prevent needle aspirates from being a diagnostic tool of hyperfunctioning tissue (i.e. how much tissue is removed, how much volume is used to dilute the aspirate). Therefore, the presently disclosed subject matter provides a determination of pathological function of an individual gland prior to or during surgery and can minimize the surgery time of a parathyroidectomy. This can significantly decrease costs and risks to the patient.
[0207] An example procedure is to vigorously syringe 0.5 mL buffer into excited tissue. Retrieve the buffer and perform a one-step assay (similar to the methods of Examples 1 and 2) with a single, multiplexed cartridge using capture molecules against wPTH and iPTH. The results provide a ratio of wPTH to iPTH. Elevated concentrations can be analyzed in 3 minutes.
REFERENCES
[0208] Bieglmayer, C., G. Prager, et al. (2002). Kinetic analyses of parathyroid hormone clearance as measured by three rapid immunoassays during parathyroidectomy. Clinical Chemistry 48(10): 1731-1738.
[0209] Boudou, P., F. Ibrahim, et al. (2005). Third- or second-generation parathyroid hormone assays: A remaining debate in the diagnosis of primary hyperparathyroidism. Journal of Clinical Endocrinology and Metabolism 90(12): 6370-6372.
[0210] Carneiro, D. M., C. C. Solorzano, et al. (2003). Comparison of intraoperative iPTH assay (QPTH) criteria in guiding parathyroidectomy: Which criterion is the most accurate? Surgery 134(6): 973-981.
[0211] Caron, P., J. C. Maiza, et al. (2009). High third generation/second generation PTH ratio in a patient with parathyroid carcinoma: Clinical utility of third generation/second generation PTH ratio in patients with primary hyperparathyroidism. Clinical Endocrinology 70(4): 533-538.
[0212] Cavalier, E., D. Betea, et al. (2014). The third/second generation PTH assay ratio as a marker for parathyroid carcinoma: Evaluation using an automated platform. Journal of Clinical Endocrinology and Metabolism 99(3): E453-E457.
[0213] Gao, P. and P. D'Amour (2005). Evolution of the parathyroid hormone (PTH) assayImportance of circulating PTH immunoheterogeneity and of its regulation. Clinical Laboratory 51(1-2): 21-29.
[0214] Goodman, W. G. (2005). The evolution of assays for parathyroid hormone. Seminars in Dialysis 18(4): 296-301.
[0215] Grant, C S Arch Surg. 2005 May;140(5):472-8; discussion 478-9. PMID: 15897443
[0216] Greene A B. J Am Coll Surg. 2009 September;209(3):332-43. doi: 10.1016/j.jamcollsurg.2009.05.029. PMID: 19717037
[0217] Inabnet W B. World J Surg. 2004 December; 28(12):1212-5. Epub 2004 Nov. 4. Review. PMID:15517480
[0218] Irvin G L III, Dembrow V D, Prudhomme D L. Irvin G L 3rd, Dembrow V D, Prudhomme D L. Am J Surg. 1991 October; 162(4):299-302. PMID:168317
[0219] Irvin G L III, Dembrow V D, Prudhomme D L. Surgery. 1993 December; 114(6):1019-22; discussion 1022-3. PMID:8256205
[0220] Ligler F S, Sapsford K E, Golden J P, Shriver-Lake L C, Taitt C R, Dyer M A Barone S, and Myatt C J. The array biosensor: Portable, automated systems. Anal. Sci. 2007 23:5-10.
[0221] Ligler F S, Taitt C R (eds.). Optical Biosensors: Today and Tomorrow Elsevier, The Netherlands, 2008, 700 pp.).
[0222] Lochhead M J, Todorof K, Delaney M, et al. Rapid multiplexed immunoassay for simultaneous serodiagnosis of HIV-1 and coinfections. J. Clin. Micro. 2011 October:3584-3590.
[0223] Meneely J P, Campbell K, Greef C, Lochhead M J, Elliott C T. Development and validation of an ultrasensitive fluorescence planar waveguid biosensor for the detection of paralytic shellfish toxins in marine algae. Biosensors Bioelectronics 2012 41:691-697.
[0224] Meyer S K, Zorn M, Frank-Raue K, Bchler M W, Nawroth P, Weber T. Clinical impact of two different intraoperative parathyroid hormone assays in primary and renal hyperparathyroidism. Eur J Endocrinol. 2009 February;160(2):275-81. doi: 10.1530/EJE-08-0292. Epub 2008 Nov. 12. PMID 19004983.
[0225] Nguyen-Yamamoto, L., Rousseau, L., Brossard, J. H., Lepage, R., Gao, P., Cantor, T., D'Amour, P., 2002. Origin of parathyroid hormone (PTH) fragments detected by intact-PTH assays. European Journal of Endocrinology 147(1), 123-131.
[0226] Pelleitteri P K Head Neck. 2013 January; 35(1): 123-32. doi: 10.1002/hed.21898. Epub 2011 Oct. 27. Review. PMID:22034046
[0227] Potts, J. T. (2013). A Short History of Parathyroid Hormone, Its Biological Role, and Pathophysiology of Hormone Excess. Journal of Clinical Densitometry 16(1): 4-7.
[0228] Udelsman R. Ann Surg. 2002 May;235(5):665-70; discussion 670-2. PMID:11981212
[0229] Yamashita, H., P. Gao, et al. (2003). Large carboxy-terminal parathyroid hormone (PTH) fragment with a relatively longer half-life than 1-84 PTH is secreted directly from the parathyroid gland in humans. European Journal of Endocrinology 149(4): 301-306.
[0230] It will be understood that various details of the presently disclosed subject matter can be changed without departing from the scope of the presently disclosed subject matter. Furthermore, the foregoing description is for the purpose of illustration only, and not for the purpose of limitation.