SUPRAMOLECULAR FILAMENTOUS ASSEMBLIES FOR PROTEIN PURIFICATION
20200197902 ยท 2020-06-25
Inventors
- Honggang Cui (Lutherville, MD)
- Yi Li (Baltimore, MD, US)
- Lye Lin Lock (Maynard, MA, US)
- Xuankuo Xu (Boxborough, MA, US)
- Zhengjian Li (Sudbury, MA, US)
Cpc classification
C07K1/22
CHEMISTRY; METALLURGY
B01D15/3809
PERFORMING OPERATIONS; TRANSPORTING
B01J20/24
PERFORMING OPERATIONS; TRANSPORTING
International classification
B01J20/24
PERFORMING OPERATIONS; TRANSPORTING
B01D15/38
PERFORMING OPERATIONS; TRANSPORTING
B01J20/28
PERFORMING OPERATIONS; TRANSPORTING
C07K1/22
CHEMISTRY; METALLURGY
Abstract
The present invention provide novel immunofiber compositions for protein or peptide purification and simple and cost-efficient methods and systems using these compositions. In some embodiments, the immunofibers comprise a customized Z-33 peptide derived from Staphylococcus aureus Protein A which is used to construct immuno-amphiphile molecules that assemble into immunofibers in aqueous solution with bioactive epitopes on the surface and have peptide or protein binding ability.
Claims
1. An immunofiber composition comprising one or more immuno-amphiphiles, wherein said immuno-amphiphiles comprise an antibody binding peptide conjugated to a hydrocarbon chain.
2. The immunofiber composition of claim 1, wherein the immuno-amphiphile has an -helical conformation when in an aqueous solution at physiological pH.
3. The immunofiber composition of claim 1, wherein the antibody binding peptide has a hydrophilic amino acid sequence of the Z33 peptide of Protein A of Staphylococcus aureus, or a functional portion or fragment or derivative thereof.
4. The immunofiber composition of claim 1, wherein the antibody binding peptide has the amino acid sequence FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD (SEQ ID NO: 1), or a functional portion or fragment or derivative thereof.
5. The immunofiber composition of claim 3, wherein the antibody binding peptide has a hydrophilic amino acid sequence selected from the group consisting of SEQ ID NOS: 1-7.
6. The immunofiber composition of claim 1, wherein the hydrocarbon chain is between 8 and 22 carbons in length and is either linear or branched.
7. The immunofiber composition of claim 6, wherein the hydrocarbon chain is linear
8. The immunofiber composition of claim 7, wherein the hydrocarbon chain is between 8 and 12 carbons in length.
9. An immunofiber composition comprising an immunofiber binding molecule wherein said binding molecule comprises an antibody binding peptide conjugated to a hydrocarbon chain at its N-terminus, and said binding peptide conjugated to a first spacer peptide and conjugated to an antibody binding peptide having a hydrophilic amino acid sequence of the Z33 peptide of Protein A of Staphylococcus aureus, or functional portions or fragments or derivatives thereof at its C-terminus, and wherein the first spacer peptide comprises the generic amino acid sequence of XXYYZZ, wherein XX is two amino acids having a small hydrophobic side chain and can be the same or different amino acid, YY is two amino acids having a positively charged side chain and can be the same or different amino acid, and ZZ is two amino acids having a small neutral side chain and can be the same or different amino acid.
10. The immunofiber composition of claim 9, wherein the antibody binding peptide has the amino acid sequence FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD (SEQ ID NO: 1), or a functional portion or fragment or derivative thereof.
11. The immunofiber composition of claim 9, wherein the antibody binding peptide has a hydrophilic amino acid sequence selected from the group consisting of SEQ ID NOS: 1-7.
12. The immunofiber composition of claim 9, wherein the hydrocarbon chain is 8 carbons in length.
13. The immunofiber compositions of claims 9, wherein the amino acids having a small hydrophobic side chain are selected from the group consisting of: Ala, Val, Ile, and Leu.
14. The immunofiber compositions of claims 9, wherein the amino acids with a positively charged side chain are selected from the group consisting of: Arg, His and Lys.
15. The immunofiber compositions of claim 9, wherein the amino acids with a small neutral side chain are selected from the group consisting of: Gly and Pro.
16. An immunofiber composition comprising a spacer molecule having a hydrocarbon chain at its N-terminus conjugated to a peptide sequence comprising the generic amino acid sequence of XXBB, wherein XX is two amino acids having a small hydrophobic side chain and can be the same or different amino acid, and wherein BB is two amino acids having a negatively charged side chain, and can be the same or different amino acid.
17. The immunofiber composition of claim 16, wherein the amino acids having a small hydrophobic side chain are selected from the group consisting of: Ala, Val, Ile, and Leu.
18. The immunofiber composition of claim 16, wherein the amino acids having a negatively charged side chain are selected from the group consisting of: Glu and Asp.
19. A method for purification of antibodies or Fc containing peptides or proteins comprising the steps of: a) dissolving a sample containing the immunofiber (IF) composition of claim 1 in an aqueous solution and a physiological pH and aging overnight to make it self-assemble into IFs; b) mixing a sample containing antibodies with the IFs solution, and allowing the IFs to bind the Fc portion of the immunoglobulin molecule or Fc containing peptides or proteins and form an immunofiber-Fc immunoglobulin or immunofiber-Fc containing peptide or protein complex in solution; c) separating the immunofiber-Fc immunoglobulin or immunofiber-Fc containing peptide or protein complex from the solution by adding salt and centrifugation; d) dissociating the IFs from the immunoglobulins or Fc containing peptides or proteins and collecting the unbound immunoglobulins or Fc containing peptides or proteins.
20. The method of claim 19, wherein the IFs are separated from the immunoglobulins or Fc containing peptides or proteins by lowering the pH to elution condition and filtration, microfiltration, or ultrafiltration.
21. The method of claim 19, wherein the immunoglobulins or Fc containing peptides or proteins are further purified using polishing steps.
22. The method of claim 20, wherein the immunoglobulins or Fc containing peptides or proteins are further purified using polishing steps.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION OF THE INVENTION
[0046] Staphylococcal protein A (SPA) is a protein originally found in the cell wall of Staphylococcus aureus. It is composed of five homologous domains that fold into a three-helix bundle. Protein A plays an important role in immunology due to its specific binding to the Fc-portion of immunoglobulin G (aka IgG) from most mammalian species, including human. Extensive structural and biochemical studies of protein A have been conducted. The first gene encoding SPA was cloned, sequenced and expressed in 1984, was followed by numerous synthetic and minimized IgG-binding domain based on protein A. Among them Z-58 domain is the first and most famous synthetic domain to be widely used in affinity chromatography and affinity precipitation. Another minimized binding domain, Z-33, was developed in 1996 without significantly changing the function of the molecule.
[0047] In accordance with several embodiments, the present invention provides methods for the modification and/derivatization of the amino acid sequence of the antibody binding domain into immuno-amphiphiles which serve as the building unit for IFs. Described herein are examples of the design and creation of IFs useful in binding IgG antibodies or portions or fragments thereof. Once IFs are formed in aqueous solution at physiological pH ranges, the exposed bioactive epitopes (binding sites) displayed on the surface are able to specifically bind IgG.
[0048] In accordance with an embodiment, the present invention self-assembling immunofibers comprising an immuno-amphiphile comprising an antibody binding peptide conjugated to a linear hydrocarbon chain.
[0049] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising an antibody binding peptide conjugated to a linear hydrocarbon chain and wherein the immuno-amphiphile has an -helical conformation when in an aqueous solution at physiological pH.
[0050] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising an antibody binding peptide conjugated to a linear hydrocarbon chain, wherein the antibody binding peptide comprises a hydrophilic amino acid sequence from the Z33 peptide of Protein A of Staphylococcus aureus, or a functional portion or fragment or derivative thereof.
[0051] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising an antibody binding peptide conjugated to a linear hydrocarbon chain, wherein the antibody binding peptide comprises the amino acid sequence FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD (SEQ ID NO: 1), or a functional portion or fragment or derivative thereof.
[0052] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising a fragment of an antibody binding peptide conjugated to a linear hydrocarbon chain.
[0053] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising a fragment of an antibody binding peptide conjugated to a linear hydrocarbon chain and wherein the immuno-amphiphile has an -helical conformation when in an aqueous solution at physiological pH.
[0054] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising a fragment of an antibody binding peptide conjugated to a linear hydrocarbon chain and wherein the immuno-amphiphile has an -sheet conformation when in an aqueous solution at physiological pH.
[0055] In accordance with an embodiment, the present invention provides self-assembling immunofibers comprising one or more immuno-amphiphiles comprising a fragment of an antibody binding peptide conjugated to a linear hydrocarbon chain, wherein the antibody binding peptide has a portion of the hydrophilic amino acid sequence of the Z33 peptide of Protein A of Staphylococcus aureus.
[0056] As used herein, the term a fragment of an antibody binding peptide means a portion or fragment of the Z33 peptide of Protein A of Staphylococcus aureus that has fewer than the 33 amino acids of SEQ ID NO: 1. In some embodiments, the term a fragment of an antibody binding peptide means a portion of the Z33 peptide comprising a peptide having at least one -helical region within the peptide. The fragment of an antibody binding peptide can also comprise additional amino acids that may or may not comprise an -helical region.
[0057] In accordance with an embodiment, the present invention provides an immuno-amphiphile comprising a fragment of an antibody binding peptide conjugated to a linear hydrocarbon chain wherein the fragment of an antibody binding peptide comprises the amino acid sequence of FNMQQQRRFYEALHD (SEQ ID NO: 2) and is referred to as Helix 1. In some embodiments, Helix 1 comprises the amino acid sequence of FNMQQQRRFYEALHDK (SEQ ID NO: 3). In another embodiment, Helix 1 comprises the amino acid sequence of FNMQQQRRFYEALHDKK (SEQ ID NO: 4).
[0058] In accordance with an embodiment, the present invention provides an immuno-amphiphile comprising a fragment of an antibody binding peptide conjugated to a linear hydrocarbon chain wherein the fragment of an antibody binding peptide comprises the amino acid sequence of PNLNEEQRNAKIKSIRDD (SEQ ID NO: 5) and is referred to as Helix 2. In some embodiments, Helix 2 comprises the amino acid sequence of FPNLNEEQRNAKIKSIRDD (SEQ ID NO: 6).
[0059] As used herein, the term immuno-amphiphiles means a molecule that can spontaneously associate into discrete, stable supramolecular nanostructures termed immunofibers (IFs). Generally, the IFs of the present invention can assemble in a pH range between about 2.8 to about 7.5. However, the binding properties are also pH dependent. Those IFs which are more positively charged are easier to associate with higher pH solutions, and conversely, negatively charged IFs will associate easier in lower pH solutions.
[0060] In some embodiments, the immuno-amphiphiles of the present invention comprise a hydrophilic peptide is conjugated to a hydrocarbon chain having between 8 and 22 carbons, and the chain can be linear or branched. There is an upper limit to the number of carbons in view of solubility in an aqueous solution. The hydrophilic peptide increases the aqueous solubility of the nanostructure and can promote the formation of well-defined nanostructure architectures including, but not limited to, cylindrical or spherical micelles, hollow nanotubes, toroids, discs and vesicles, through preferred secondary structure formation, e.g. beta sheet, alpha helix, poly proline type-II helix, beta turn.
[0061] As used herein, the term hydrocarbon chain means is synonymous with the term aliphatic chain, which is an art-recognized term and includes linear, branched, and cyclic alkanes, alkenes or alkynes. In certain embodiments, aliphatic groups in the present invention are linear or branched and have from 8- about 22 carbon atoms.
[0062] The term alkyl is art-recognized, and its use herein includes saturated aliphatic groups, including straight-chain alkyl groups and branched-chain alkyl groups.
[0063] As used herein, the term antibody binding peptide means a peptide that has the ability to bind an antibody, or a specific portion of an antibody molecule, for example, the Fc portion, with high specificity, such as having a K.sub.d of between about 10.sup.6 M to about 10.sup.10 M.
[0064] In some embodiments, the antibody binding peptide is the hydrophilic amino acid sequence of the Z33 two-helix derivative peptide of the Z-domain of Protein A of Staphylococcus aureus, or a functional portion or fragment or derivative thereof.
[0065] As used herein, the Z33 peptide of Protein A has the amino acid sequence of FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD (SEQ ID NO: 1).
[0066] In some embodiments, the antibody binding peptide is a fragment of the Z33 peptide of Protein A conjugated to a linear hydrocarbon chain wherein the fragment of an antibody binding peptide comprises the amino acid sequence of FNMQQQRRFYEALHD (SEQ ID NO: 2) and is referred to as Helix 1. In some embodiments, Helix 1 comprises the amino acid sequence of FNMQQQRRFYEALHDK (SEQ ID NO: 3). In another embodiment, Helix 1 comprises the amino acid sequence of FNMQQQRRFYEALHDKK (SEQ ID NO: 4).
[0067] In some embodiments, the antibody binding peptide is a fragment of the Z33 peptide of Protein A conjugated to a linear hydrocarbon chain, wherein the antibody binding peptide comprises the amino acid sequence of PNLNEEQRNAKIKSIRDD (SEQ ID NO: 5) and is referred to as Helix 2. In some embodiments, Helix 2 comprises the amino acid sequence of FPNLNEEQRNAKIKSIRDD (SEQ ID NO: 6).
[0068] In accordance with another embodiment, the present invention provides a an immunofiber composition comprising one or more immuno-amphiphiles comprising an antibody binding peptide conjugated to a linear hydrocarbon chain, wherein the antibody binding peptide has a hydrophilic amino acid sequence of the Z33 peptide of Protein A of Staphylococcus aureus, or a functional portions or fragments or derivatives thereof. In some embodiments, the functional portion or fragments or derivatives are selected from the group consisting of SEQ ID NOS: 1-6.
[0069] It will be understood by those of ordinary skill in the art that other binding peptides can be substituted for the Z33 peptide to bind other proteins. For example, streptavidin or a function portion or fragment thereof could be incorporated in the immuno-amphiphiles and the resulting IFs could be used to bind biotinylated compounds.
[0070] The term, amino acid includes the residues of the natural -amino acids (e.g., Ala, Arg, Asn, Asp, Cys, Glu, Gln, Gly, His, Lys, Ile, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val) in D or L form, as well as -amino acids, synthetic and non-natural amino acids. Many types of amino acid residues are useful in the polypeptides and the invention is not limited to natural, genetically-encoded amino acids. Examples of amino acids that can be utilized in the peptides described herein can be found, for example, in Fasman, 1989, CRC Practical Handbook of Biochemistry and Molecular Biology, CRC Press, Inc., and the reference cited therein. Another source of a wide array of amino acid residues is provided by the website of RSP Amino Acids LLC.
[0071] Reference herein to derivatives includes parts, fragments and portions of the inventive antibody binding peptides of the present invention. A derivative also includes a single or multiple amino acid substitution, deletion and/or addition. Homologues include functionally, structurally or sterochemically similar peptides from venom from the same species of snake or from within the same genus or family of snake. All such homologues are contemplated by the present invention.
[0072] Analogs and mimetics include molecules which include molecules which contain non-naturally occurring amino acids or which do not contain amino acids but nevertheless behave functionally the same as the peptide. Natural product screening is one useful strategy for identifying analogs and mimetics.
[0073] Examples of incorporating non-natural amino acids and derivatives during peptide synthesis include, but are not limited to, use of norleucine, 4-amino butyric acid, 4-amino-3-hydroxy-5-phenylpentanoic acid, 6-aminohexanoic acid, t-butylglycine, norvaline, phenylglycine, omithine, sarcosine, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-thienyl alanine and/or D-isomers of amino acids. A partial list of known non-natural amino acid contemplated herein is shown in Table 1.
TABLE-US-00001 TABLE 1 Non-natural Amino Acids Non-conventional Non-conventional amino acid Code amino acid Code -aminobutyric acid Abu L-N-methylalanine Nmala -amino--methylbutyrate Mgabu L-N-methylarginine Nmarg aminocyclopropane- Cpro L-N-methylasparagine Nmasn carboxylate L-N-methylaspartic acid Nmasp aminoisobutyric acid Aib L-N-methylcysteine Nmcys aminonorbomyl- Norb L-N-methylglutamine Nmgln carboxylate L-N-methylglutamic acid Nmglu cyclohexylalanine Chexa L-N-methylhistidine Nmhis cyclopentylalanine Cpen L-N-methylisolleucine Nmile D-alanine Dal L-N-methylleucine Nmleu D-arginine Darg L-N-methyllysine Nmlys D-aspartic acid Dasp L-N-methylmethionine Nmmet D-cysteine Dcys L-N-methylnorleucine Nmnle D-glutamine Dgln L-N-methylnorvaline Nmnva D-glutamic acid Dglu L-N-methylornithine Nmorn D-histidine Dhis L-N-methylphenylalanine Nmphe D-isoleucine Dile L-N-methylproline Nmpro D-leucine Dleu L-N-methylserine Nmser D-lysine Dlys L-N-methylthreonine Nmthr D-methionine Dmet L-N-methyltryptophan Nmtrp D-ornithine Dorn L-N-methyltyrosine Nmtyr D-phenylalanine Dphe L-N-methylvaline Nmval D-proline Dpro L-N-methylethylglycine Nmetg D-serine Dser L-N-methyl-t-butylglycine Nmtbug D-threonine Dthr L-norleucine Nle D-tryptophan Dtrp L-norvaline Nva D-tyrosine Dtyr -methyl-aminoisobutyrate Maib D-valine Dval -methyl--aminobutyrate Mgabu D--methylalanine Dmala -methylcyclohexylalanine Mchexa D--methylarginine Dmarg -methylcylcopentylalanine Mcpen D--methylasparagine Dmasn -methyl--napthylalanine Manap D--methylaspartate Dmasp -methylpenicillamine Mpen D--methylcysteine Dmcys N-(4-aminobutyl)glycine Nglu D--methylglutamine Dmgln N-(2-aminoethyl)glycine Naeg D--methylhistidine Dmhis N-(3-aminopropyl)glycine Norn D--methylisoleucine Dmile N-amino--methylbutyrate Nmaabu D--methylleucine Dmleu -napthylalanine Anap D--methyllysine Dmlys N-benzylglycine Nphe D--methylmethionine Dmmet N-(2-carbamylethyl)glycine Ngln D--methylornithine Dmorn N-(carbamylmethyl)glycine Nasn D--methylphenylalanine Dmphe N-(2-carboxyethyl)glycine Nglu D--methylproline Dmpro N-(carboxymethyl)glycine Nasp D--methylserine Dmser N-cyclobutylglycine Ncbut D--methylthreonine Dmthr N-cycloheptylglycine Nchep D--methyltryptophan Dmtrp N-cyclohexylglycine Nchex D--methyltyrosine Dmty N-cyclodecylglycine Ncdec D--methylvaline Dmval N-cylcododecylglycine Ncdod D-N-methylalanine Dnmala N-cyclooctylglycine Ncoct D-N-methylarginine Dnmarg N-cyclopropylglycine Ncpro D-N-methylasparagine Dnmasn N-cycloundecylglycine Ncund D-N-methylaspartate Dnmasp N-(2,2-diphenylethyl)glycine Nbhm D-N-methylcysteine Dnmcys N-(3,3-diphenylpropyl)glycine Nbhe D-N-methylglutamine Dnmgln N-(3-guanidinopropyl)glycine Narg D-N-methylglutamate Dnmglu N-(1-hydroxyethyl)glycine Nthr D-N-methylhistidine Dnmhis N-(hydroxyethyl))glycine Nser D-N-methylisoleucine Dnmile N-(imidazolylethyl))glycine Nhis D-N-methylleucine Dnmleu N-(3-indolylyethyl)glycine Nhtrp D-N-methyllysine Dnmlys N-methyl--aminobutyrate Nmgabu N-methylcyclohexylalanine Nmchexa D-N-methylmethionine Dnmmet D-N-methylornithine Dnmorn N-methylcyclopentylalanine Nmcpen N-methylglycine Nala D-N-methylphenylalanine Dnmphe N-methylaminoisobutyrate Nmaib D-N-methylproline Dnmpro N-(1-methylpropyl)glycine Nile D-N-methylserine Dnmser N-(2-methylpropyl)glycine Nleu D-N-methylthreonine Dnmthr D-N-methyltryptophan Dnmtrp N-(-methylethyl)glycine Nval D-N-methyltyrosine Dnmtyr N-methyla-napthylalanine Nmanap D-N-methylvaline Dnmval N-methylpenicillamine Nmpen -aminobutyric acid Gabu N-(p-hydroxyphenyl)glycine Nhtyr L-t-butylglycine Tbug N-(thiomethyl)glycine Ncys L-ethylglycine Etg penicillamine Pen L-homophenylalanine Hphe L--methylalanine Mala L--methylarginine Marg L--methylasparagine Masn L--methylaspartate Masp L--methyl-t-butylglycine Mtbug L--methylcysteine Mcys L-methylethylglycine Metg L--methylglutamine Mgln L--methylglutamate Mglu L--methylhistidine Mhis L--methylhomophenylalanine Mhphe L--methylisoleucine Mile N-(2-methylthioethyl)glycine Nmet L--methylleucine Mleu L--methyllysine Mlys L--methylmethionine Mmet L--methylnorleucine Mnle L--methylnorvaline Mnva L--methylornithine Morn L--methylphenylalanine Mphe L--methylproline Mpro L--methylserine Mser L--methylthreonine Mthr L--methyltryptophan Mtrp L--methyltyrosine Mtyr L--methylvaline Mval L-N-methylhomophenylalanine Nmhphe N-(N-(2,2-diphenylethyl) Nnbhm N-(N-(3,3-diphenylpropyl) Nnbhe carbamylmethyl)glycine carbamylmethyl)glycine 1-carboxy-1-(2,2-diphenyl- Nmbc ethylamino)cyclopropane
[0074] Analogs of the subject peptides contemplated herein include modifications to side chains, incorporation of non-natural amino acids and/or their derivatives during peptide synthesis and the use of crosslinkers and other methods which impose conformational constraints on the peptide molecule or their analogs.
[0075] Examples of side chain modifications contemplated by the present invention include modifications of amino groups such as by reductive alkylation by reaction with an aldehyde followed by reduction with NaBH.sub.4; amidination with methylacetimidate; acylation with acetic anhydride; carbamoylation of amino groups with cyanate; trinitrobenzylation of amino groups with 2, 4, 6-trinitrobenzene sulphonic acid (TNBS); acylation of amino groups with succinic anhydride and tetrahydrophthalic anhydride; and pyridoxylation of lysine with pyridoxal-5-phosphate followed by reduction with NaBH.sub.4.
[0076] The guanidine group of arginine residues may be modified by the formation of heterocyclic condensation products with reagents such as 2,3-butanedione, phenylglyoxal and glyoxal.
[0077] The carboxyl group may be modified by carbodiimide activation via O-acylisourea formation followed by subsequent derivitization, for example, to a corresponding amide.
[0078] Sulphydryl groups may be modified by methods such as carboxymethylation with iodoacetic acid or iodoacetamide; performic acid oxidation to cysteic acid; formation of a mixed disulphides with other thiol compounds; reaction with maleimide, maleic anhydride or other substituted maleimide; formation of mercurial derivatives using 4-chloromercuribenzoate, 4-chloromercuriphenylsulphonic acid, phenylmercury chloride, 2-chloromercuri-4-nitrophenol and other mercurials; carbamoylation with cyanate at alkaline pH.
[0079] Tryptophan residues may be modified by, for example, oxidation with N-bromosuccinimide or alkylation of the indole ring with 2-hydroxy-5-nitrobenzyl bromide or sulphenyl halides. Tyrosine residues on the other hand, may be altered by nitration with tetranitromethane to form a 3-nitrotyrosine derivative.
[0080] Modification of the imidazole ring of a histidine residue may be accomplished by alkylation with iodoacetic acid derivatives or N-carbethoxylation with diethylpyrocarbonate.
[0081] Crosslinkers can be used, for example, to stabilize 3D conformations, using homo-bifunctional crosslinkers such as the bifunctional imido esters having (CH.sub.2).sub.n spacer groups with n=1 to n=6, glutaraldehyde, N-hydroxysuccinimide esters and hetero-bifunctional reagents which usually contain an amino-reactive moiety such as N-hydroxysuccinimide and another group specific-reactive moiety such as maleimido or dithio moiety (SH) or carbodiimide (COOH). In addition, peptides can be conformationally constrained by, for example, incorporation of C.sub. and N.sub.-methylamino acids, introduction of double bonds between C.sub. and C.sub. atoms of amino acids and the formation of cyclic peptides or analogues by introducing covalent bonds such as forming an amide bond between the N and C termini, between two side chains or between a side chain and the N or C terminus.
[0082] The term, peptide, as used herein, includes a sequence of from four to 100 amino acid residues in length, preferably about 10 to 80 residues in length, more preferably, 15 to 65 residues in length, and in which the -carboxyl group of one amino acid is joined by an amide bond to the main chain (- or -) amino group of the adjacent amino acid.
[0083] In accordance with some embodiments, generally, the present invention provides methods for purification of proteins or peptides of interest wherein the proteins or peptides are capable of being bound by the antibody binding peptide portion of the immunofiber using immunoprecipitation methods with the immunofibers of the present invention.
[0084] In accordance with an embodiment, the present invention provides a method for purification of peptides or proteins having an Fc portion of an immunoglobulin molecule, or a functional portion or fragment thereof, comprising contacting a solution at a first pH level containing one or more peptides or proteins of interest with an immunofiber composition comprising one or more immuno-amphiphiles, wherein the one or more immuno-amphiphiles comprise an Fc binding peptide conjugated to a hydrocarbon chain, and wherein the Fc binding peptide has a hydrophilic amino acid sequence of the Z33 peptide of Protein A of Staphylococcus aureus, or a functional portion or fragment or derivative thereof; allowing the one or more proteins of interest to bind the Fc binding peptide or a functional portion or fragment or derivative thereof; changing the pH level of the solution to a pH which causes a change in the conformation of the Fc binding peptide to a conformation which no longer binds the one or more proteins of interest; and extracting the released one or more proteins of interest from the solution.
[0085] Generally, Fc containing proteins can be immunoglobulins or antibodies (IgG type, for example) or fusion peptides or proteins containing an Fc portion, are purified by mixing the proteins in a sample with the immunofibers of the present invention in an aqueous solution and a physiological pH, and allowing the immunofibers to bind the Fc portion of the protein molecule of interest. In some embodiments, the immunofibers comprise the Z33 portion of Protein A and are specific for the Fc portion of IgG molecules or fusion peptides or proteins comprising them.
[0086] In accordance with some other embodiments, the immunofibers are then separated from bound proteins using various filtration methods, such as, for example diafiltration, microfiltration or ultrafiltration.
[0087] In an embodiment the immunofibers compositions of the present invention comprise two or more fragments of the Z33 peptide of Protein A conjugated to a linear hydrocarbon. In an embodiment, the immunofibers used in the methods of purification or binding of antibodies can comprise a mixture of Helix 1 and Helix 2 peptides. For example the methods can comprise addition of one or more Helix 1 peptides having a peptide sequence of SEQ ID NOS: 2-4, and combinations thereof, and the addition of one or more Helix 2 peptides having a peptide sequence of SEQ ID NO: 5 or 6, and combinations thereof.
[0088] After a period of time to allow the immunofibers to bind, the immunofibers form immunofibers-protein complexes in solution. The complexes formed can then be separated from the unbound fibers and proteins and other components in the sample by many known separation means, including, for example, salt-induced precipitation and centrifugation. The separated complexes can then be introduced into another solution at an acidic pH, where the immunofibers lose their binding affinity for the proteins. The proteins can then be separated from the dissociated immunofibers by filtration, such as diafiltration or other means, and the dissociated monomers can be removed as well.
[0089] It is contemplated that the immunofibers of the present invention can be used with other protein purification methods, such as covalently immobilizing them onto porous resins (such as beaded agarose) or magnetic beads, or combinations of immobilized substrates and immunoprecipitation methods.
[0090] As used herein, the term sample means any sample or solution or fluid containing an antibody of interest which can be bound using the immunofibers of the present invention. In some embodiments, the sample can be a biological sample.
[0091] In accordance with one or more embodiments of the present invention, it will be understood that the term biological sample or biological fluid includes, but is not limited to, any quantity of a substance from a living or formerly living patient or mammal. Such substances include, but are not limited to, blood, serum, plasma, urine, cells, organs, tissues, bone, bone marrow, lymph, lymph nodes, synovial tissue, chondrocytes, synovial macrophages, endothelial cells, and skin.
[0092] All the sequences, CMCs, and secondary structures of IAs in this study are summarized in Table 1. Both long single-chain and double-chain alkylation can lead to the formation of one-dimensional filaments, but differ in morphology, CMC, and secondary structures. The length and number of alkyl chains have been proven to affect the self-assembly behavior of the peptide conjugates. For example, Jan van Hest and coworkers found that the GANPNAAG (SEQ ID NO: 8) peptide conjugated with C12 or shorter alkyl chains showed no aggregates. However, fibrous aggregates and tubular structures were found in C14 conjugates and C16 or longer conjugates, respectively. Similarly, as reported by other researchers previously, the CMC of the single-chain alkylated amphiphiles decreases as the length of alkyl chain increases, due to the enhanced hydrophobicity that promotes the aggregation of IAs. Alkyl chain conjugation was previously demonstrated to enhance the stability of -helix secondary structures and increase in content in the conjugated form. Enhanced bioactivities in some -helix for forming peptide were reported. For example, an increase in bactericidal activity for SC4 peptide-amphiphiles was found by Mayo and Tirell. Our results seem to conflict with the system investigated by Forns and co-workers, where helicity of a 16-residue peptide increases as the alkyl chains enlongates. However, this discrepancy may be caused by the pre-existed -helix structures in the unconjugated 16-residue peptide. Mihara and co-workers found that longer N-terminal alkylated 2-helix peptide underwent a higher rate of -to- transitions, indicating the formation of -sheets promoted by long alkyl chains.
[0093] In conclusion, two series of immuno-amphiphiles were successfully designed and synthesized. Through different molecular design of the IAs, it was found different ways of alkylation led the IA molecules to vary in several self-assembly properties such as the CMC value, morphology and component of secondary structures. Our results clearly show that both single-chain and double-chain alkylation can lead to the formation of one-dimensional filaments. The longer single alkyl chain was able to promote the aggregation of the IA molecules and increase the formation of -sheet. Double-chain alkylation could help the formation of -helix in the self-assembled filaments. However, there are variations in the impact of alkylation among different peptide molecules. This strategy of tuning the length and number of alkyl chains can be further developed and applied in other self-assembled functional peptide system that requires specific secondary structure to exert desired bioactivities.
[0094] In accordance with some embodiments, the alkyl chains used to alkylate the peptides and fragments thereof, can have carbon lengths of two to twenty four carbons in length, including intermediate lengths of 3, 4, 5, 6, 7, 8, 10, 12, 14, 16, 18, 20, 22 and 24 carbons in length. Additionally, the peptides or fragments thereof can have 1 to 4 alkyl chains alkylated to the peptide or fragment thereof.
An Alternative Embodiment of the Immunofiber Compositions of the Present Invention
[0095] The inventor's previous work showed high IgG binding affinity and potential IgG precipitation ability of self-assembling C12-Z33 immunofibers. Considering the tight packing of C12-Z33 in immunofibers, a disadvantage of the first immunofiber design described above is there might he limited ligand accessibility of the Z33 ligand for IgG molecules with diameter of 10 nm. Although high density of Z33 ligands are presented at the surface of immunofibers, it was thought that steric hindrance could prevent the IgG binding efficiency and the crosslinking of immunofibers to form large assemblies for precipitation. As such, an alternative embodiment of the immunofiber compositions of the present invention is provided.
[0096] In accordance with one or more embodiments, an improved immunofiber binding system is provided by combining binding molecules (alkyl-XXYYZZ-antibody binding peptide) and spacer molecules (alkyl-XXBB) in a co-assembled immunofiber system, wherein the first spacer peptide comprises the generic sequence of XXYYZZ, wherein XX is two amino acids having a small hydrophobic side chain and can be the same or different amino acid, YY is two amino acids having a positively charged side chain and can be the same or different amino acid, and ZZ is two amino acids having a small neutral side chain and can be the same or different amino acid, and further comprising an immunofiber spacer molecule having a linear hydrocarbon chain at its N-terminus conjugated to a peptide sequence comprising the generic sequence of XXBB, wherein XX is two amino acids having a small hydrophobic side chain and can be the same or different amino acid, and wherein BB is two amino acids having a negatively charged side chain, and can be the same or different amino acid.
[0097] In an exemplary embodiment, the immunofiber binding molecule contains between 4-8 amino acids, and in some embodiments. 6 amino acids residues comprising VVKKGG (SEQ ID NO: 9) between the carbon chain and antibody binding peptide Z33 compared to the above provided C12-Z33 immunofiber. Two hydrophobic amino acids such as valine (VV, red) promotes the formation of one-dimensional structures. Two positively charged amino acids such as glutamic acid (EE, blue) were designed as the hydrophilic segment in the spacer molecule and two negatively charged amino acids such as lysine (KK, blue) were designed accordingly for electrostatic interactions between positive charged and negative charged amino acids and thus inducing the alternating packing of the binding and spacer immunofibers molecules C12-VVKKGGZ33. Two neutral amino acids such as glycine (GG, green) were designed for further separating antibody binding peptide, such as Z33 from the alkyl chains. When dissolving the binding and spacer molecules in aqueous solution, it was expected that these two molecules can homogeneously co-assemble into one-dimensional immnofibers with the binding ligand Z33 sticking out on the surface (
[0098] In accordance with a further embodiment, the present invention provides an immunofiber composition comprising an immunofiber binding molecule comprising an antibody binding peptide conjugated to a linear hydrocarbon chain at its N-terminus, and conjugated to a first spacer peptide conjugated to an antibody binding peptide having a hydrophilic amino acid sequence of the Z33 peptide of Protein A of Staphylococcus aureus, or functional portions or fragments or derivatives thereof at its C-terminus, and wherein the first spacer peptide comprises the generic sequence of XXYYZZ, wherein XX is two amino acids having a small hydrophobic side chain and can be the same or different amino acid, YY is two amino acids having a positively charged side chain and can be the same or different amino acid, and ZZ is two amino acids having a small neutral side chain and can be the same or different amino acid, and further comprising an immunofiber spacer molecule having a linear hydrocarbon chain at its N-terminus conjugated to a peptide sequence comprising the generic sequence of XXBB, wherein XX is two amino acids having a small hydrophobic side chain and can be the same or different amino acid, and wherein BB is two amino acids having a negatively charged side chain, and can be the same or different amino acid. For example, the amino acid sequence VVEE (SEQ ID NO: 10) can be used to prepare C12-VVEE as the immunofiber spacer peptide.
[0099] It will be understood by those of ordinary skill in the art, that the term amino acids with a hydrophobic side chain means amino acids such as Ala, Val, Ile, Leu. The term amino acids with a positively charged side chain means Arg, His and Lys. The term amino acids with a small neutral side chain means amino acids such as Gly or Pro. The term amino acids with a negatively charged side chain means amino acids such as Asp or Glu.
[0100] The immunofiber compositions and alternative immunofiber binding systems comprising the immunofiber binding molecules (alkyl-XXYYZZ-antibody binding peptide) and spacer molecules (alkyl-XXBB) of the present invention are useful in purifying antibodies and other molecules comprising an Fc portion of an antibody or portion or fragment thereof. In some embodiments, the immunofiber compositions of the present invention can be used to separate or purify any peptide or fusion protein which comprises at least a portion of the Fc of an antibody molecule.
[0101] The removal of last impurity traces from a purified protein is generally called polishing. It is an important step in downstream processing since protein impurities may generate undesirable side effects when the preparation is intended for research, diagnostic and more importantly therapeutic applications. Polishing is generally achieved by using orthogonal separation methods to previous steps, the most common being gel permeation chromatography. In spite of its polishing effectiveness, this technique suffers from a poor separation capacity and modest productivity as a result of low speed. Other approaches, for instance, based on anion exchange or on hydrophobic chromatography, that may be optimized for a given process cannot be used as generic methods. In some embodiments, additional polishing steps will be used to purify the proteins of interest.
[0102] Thus, in view of the foregoing, the present invention provides methods for purification of antibodies or Fc containing peptides or proteins comprising the steps of: a) dissolving a sample containing any of the immunofiber compositions described above in an aqueous solution and a physiological pH and aging overnight to make it self-assemble into IFs; b) mixing a sample containing antibodies with the IFs solution, and allowing the IFs to bind the Fc portion of the immunoglobulin molecule or Fc containing peptides or proteins and form an immunofiber-Fc immunoglobulin or immunofiber-Fc containing peptide or protein complex in solution; c) separating the immunofiber-Fc immunoglobulin or immunofiber-Fc containing peptide or protein complex from the solution by adding salt and centrifugation; d) dissociating the IFs from the immunoglobulins or Fc containing peptides or proteins and collecting the unbound immunoglobulins or Fc containing peptides or proteins.
[0103] The following examples have been included to provide guidance to one of ordinary skill in the art for practicing representative embodiments of the presently disclosed subject matter. In light of the present disclosure and the general level of skill in the art, those of skill can appreciate that the following examples are intended to be exemplary only and that numerous changes, modifications, and alterations can be employed without departing from the scope of the presently disclosed subject matter. The synthetic descriptions and specific examples that follow are only intended for the purposes of illustration, and are not to be construed as limiting in any manner to make compounds of the disclosure by other methods.
EXAMPLES
[0104] Materials. All Fmoc amino acids and resins were purchased from Advanced Automated Peptide Protein Technologies (AAPPTEC, Louisville, Ky., USA), and Fmoc-Lys(Fmoc) were obtained from Novabiochem (San Diego, Calif., USA). The therapeutic human IgG1 (IgG1) was obtained from Bristol-Myers Squibb (Boston, Mass., USA), and IgG elution buffer was sourced from Thermo Fisher Scientific (Rockford, Ill., USA). All other reagents were obtained from VWR (Radnor, Pa., USA) and used as received without further purification.
[0105] Molecular Synthesis. C12-Z33 and 2C8-Z33 immuno-amphiphiles were synthesized using similar methods. In brief, Z33 peptide were first synthesized on the Focus XC automatic peptide synthesizer (AAPPTEC, Louisville, Ky.) using standard 9-fluorenylmethoxycarbonyl (Fmoc) solid phase synthesis protocols. C12 (or 2C8) alkyl chain was then manually coupled at the N-terminus (after Fmoc removal) of Z33 peptide with lauric acid (or octanoic acid)/HBTU/DIEA at a ratio of 4 (or 8): 4: 6 relative to the Z33 peptide, shaking overnight at room temperature. Other alkyl chains were manually coupled at the N-terminus of the peptide or the side chain of lysine (K) to produce different IAs, and shaked overnight at room temperature. Fmoc deprotections were performed using a 20% 4-methylpiperidine in DMF solution for 10 minutes, repeating once. In all cases, reactions were monitored by the ninhydrin test (Anaspec Inc., Fremont, Calif.) for free amines. Completed peptides were cleaved from the solid support using a mixture of TFA/TIS/H2O in a ratio of 92.5:5:2.5 for 2.5 hours. Excess TFA was removed by rotary evaporation and cold diethyl ether was added to precipitate the crude peptide. By centrifugation method, precipitated peptide and diethyl ether were separated at 6000 rpm for 3 minutes. Peptides were washed another 2 times with diethyl ether and solution was removed by centrifugation.
[0106] Molecular Synthesis of IAs with fragment of antibody binding peptides. Peptide amphiphiles were synthesized using similar methods. Below we take Helix1-C16, Helix1-2C8, C16-Helix2, and 2C8-Helix2 as examples to show the synthesis process. In brief, FNMQQQRRFYEALHDK (Helix1+Kmtt) (SEQ ID NO: 3) and FNMQQQRRFYEALHDKK (Helix1+Kmtt+Kmtt) (SEQ ID NO: 4) peptide sequences were first synthesized on the Focus XC automatic peptide synthesizer (AAPPTEC, Louisville, Ky.) using standard 9-fluorenylmethoxycarbonyl (Fmoc) solid phase synthesis protocols. The K-methylthiotetrazole (Kmtt) was added at the C-terminus of Helix1 sequence for further reaction. Palmitic acid (C16) or octanoic acid (2C8) alkyl tails were then manually coupled at the side chain of Kmtt in Helix1+Kmtt and Helix1+Kmtt+Kmtt respectively to produce Helix1-C16 and Helix1-2C8, and shaked overnight at room temperature. Similarly, for C16-Helix2, and 2C8-Helix2, PNLNEEQRNAKIKSIRDD (Helix2) (SEQ ID NO: 5) and FPNLNEEQRNAKIKSIRDD (K-Fmoc-Helix2) (SEQ ID NO: 6) peptide sequences were first synthesized on the Focus XC automatic peptide synthesizer. The K-Fmoc was added at the N-terminus of Helix2 sequence for further reaction. Palmitic acid (C16) or octanoic acid (2C8) alkyl tails were then manually coupled at the N-terminus in Helix2 or both the N-terminus and side chain of K-Fmoc in K-Fmoc-Helix2 respectively to produce Helix1-C16 and Helix1-2C8, shaking overnight at room temperature. Fmoc deprotections were performed using a 20% 4-methylpiperidine in DMF solution for 10 minutes, repeated once. In all cases, reactions were tested using the ninhydrin test (Anaspec Inc., Fremont, Calif.) for free amines. Completed peptides were cleaved from the solid support using a mixture of TFA/TIS/H.sub.2O in a ratio of 92.5:5:2.5 for 2.5 hours. Excess TFA was removed by rotary evaporation and cold diethyl ether was added to precipitate the crude peptide. By centrifugation method, precipitated peptide and diethyl ether were separated at 6000 rpm for 3 minutes. Peptides were washed 2 more times with diethyl ether and the solution was removed by centrifugation.
[0107] The IAs were purified by preparative RP-HPLC using a Varian Polymeric Column (PLRP-S, 100 , 10 m, 15025 mm) at 25 C. on a Varian ProStar Model 325 preparative HPLC (Agilent Technologies, Santa Clara, Calif.) equipped with a fraction collector. A water/acetonitrile gradient containing 0.1% v/v TFA was used as eluent at a flow rate of 20 mL/min. The absorbance peak was monitored at 220 nm for Z33 peptide segments. The crude materials were dissolved in 20 ml of 0.1% aqueous TFA, and each purification run was carried out with a 10 ml injection. Collected fractions were analyzed MALDI-ToF (BrukerAutoflex III MALDI-ToF instrument, Billerica, Mass.) and those containing the desired product were lyophilized (FreeZone 105 C. 4.5 L freeze dryer, Labconco, Kansas City, Mo.) and stored at 30 C.
[0108] Self-Assembly of Immuno-Amphiphiles and TEM Imaging. Immuno-amphiphiles with 1 mM concentration were pretreated with HFIP and then dissolved in 1PBS or deionized water and aged overnight at room temperature; 10 L of 10 fold diluted sample was spotted on a carbon film copper grid with 400 square mesh (from EMS: Electron Microscopy Sciences) and the excess was removed with filter paper to leave a thin film of sample on the grid. After letting the sample dry for 5 minutes, 10 L of 2% uranyl acetate was added to sample grid, and the excess was removed after 30 seconds. All samples were dried for at least 3 hours before TEM imaging.
[0109] Circular Dichroism Spectroscopy (CD). The CD experiments of self-assembled IA samples were conducted on a Jasco J-710 spectropolarimeter (JASCO, Easton, Md., USA) using a 1 mm path length quartz UV-Vis absorption cell (ThermoFisher Scientific, Pittsburgh, Pa., USA) at 25 C. The samples were instantly diluted from the 1 mM stock solution to 100 M in 1PBS prior to the experiment. The spectra were collected in the wavelength range of 190-280 nm as the average of three scans. A background spectrum of the solvent was acquired and subtracted from the sample spectrum. Collected data was normalized with respect to sample concentration.
[0110] ITC Experiment. Isothermal titration calorimetry experiments were performed on the C12 and 2C8 IAs using a high precision VP-ITC titration calorimetric system (Microcal Inc.). The IgG1 solution was titrated with immuno-amphiphiles in 1PBS (pH 7.4 or 2.8) at 15 C. The IgG1 concentration was calculated using the mass extinction coefficient of 1.4 at 280 nm for a 0.1% (1 mg/ml) IgG solution. The concentration of immuno-amphiphles was determined by total nitrogen assay (Anal. Biochem., 61.2 (1974). 623-627). The heat evolved after each injection was obtained from the integral of the calorimetric signal. The heat associated with the binding of immuno-amphiphiles to IgG1 was obtained by subtracting the heat of dilution. Analysis of the data was performed using MicroCal Origin package.
[0111] CMC Measurement. The CMC of the Z33 fragment IAs with fragmented antibody binding peptides was determined by incubating these molecules at various concentrations with a certain amount of Nile Red. The stock solution of Nile Red was initially prepared by dissolving the dye in acetone at 50 M. 10 L stock solution was loaded into several centrifuge tubes, where the solvent evaporates under room temperature to yield the dry mass of Nile Red. Various concentrations of the peptide solutions were prepared in deionized water, and then identical volume was added into the centrifuge tubes containing dry Nile Red and aged overnight. Fluorescent spectra of Nile Red were then monitored by a Fluorolog fluorometer (Jobin Yvon, Edison, N.J.) with fixed excitation wavelength at 560 nm; emission spectra were monitored 580-720 nm. The CMC of IAs is determined by a blue-shift of the emission maximum, whereas this transition occurs as the incubated peptides exceed their CMC values.
[0112] Thioflavin T (ThT) Spectroscopic Assay. A ThT stock solution was prepared in deionized water at 50 M. 100 M Z33 IAs with fragmented antibody binding peptides were vortexed and incubated with identical volume of ThT stock solution for 1 h. The fluorescence intensity was then measured by a Fluorolog fluorometer (Jobin Yvon, Edison, N.J.) with excitation at 440 nm (slit width 5 nm) and emission at 482 nm (slit width 10 nm).
[0113] Molecular Design of full length Z33 immuno-amphiphiles. The construction of this amphiphilic peptide conjugates such as peptide amphiphiles, peptide-polymer conjugates, peptide-drug conjugates, etc., has been widely used to create a variety of supramolecular nanostructures. IgG binding immuno-amphiphiles consisting of hydrophilic Z33 peptide sequence (FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD) (SEQ ID NO: 1) and hydrophobic alkyl chains were designed to serve as the building motifs for immunofibers (IFs). Z33 peptide is a two-helix derivative from protein A (
[0114] Two IAs, C12-Z33 and 2C8-Z33 (
Example 2
[0115] Molecular Self-Assembly and Characterization of full length Z33 immuno-amphiphiles. The self-assembly of two IAs can be easily achieved through a two-step operation. First, the IAs were pretreated in hexafluoroisopropanol (HFIP) separately to eliminate any pre-existing nanostructures that may affect its solubility and the uniformity of the self-assembled morphologies. Second, HFIP were removed via evaporation, followed by subsequent addition of deionized water or phosphate-buffered saline (PBS) to reach a final concentration of 1 mM. The IFs formed with alkyl segment trapped in the core of the IFs by hydrophobic interactions and the bioactive Z33 sequence displayed in the shell facing towards the solvent (
[0116] Given the vital role of pH conditions in the current IgG purification method, the self-assembly behavior of C12-Z33 was evaluated in response to pH variations. Neutral pH is normally used as the binding condition, while acidic pH is used to elute antibodies from the protein A affinity column. To study the self-assembly behavior at neutral and low pH, PBS (pH 7.4) and IgG elution buffer (pH 2.8) were utilized as the aqueous environment for the self-assembly of C12-Z33. The morphologies of C12-Z33 IFs at different pH were studied by TEM (
[0117] To further understand the molecular packing within the self-assembled structures, circular dichroism (CD) was used to study the peptide secondary structure. Strong negative signals at around 222 nm (n-*) and 208 nm (-*) were observed in C12-Z33, suggesting the formation of -helix secondary structure of Z33 segment in the self-assembled state as was shown in the pure Z33 peptide. Based on the CD spectra and the measured diameter of IFs, it is rational to infer the peptides maintained their -helix secondary structure when packing into IFs. It is worth noting that although CD spectra for C12-Z33 in PBS solution or IgG elution buffer only maintained partial -helix signals, the ellipticity of the two negative peaks at around 222 nm and 208 nm changed compared with Z33 peptide in the same buffer. The shift of the CD spectra may result from the formation of the IFs that can change the molecular packing of Z33 segment from its free state and may subsequently influence its binding affinity to IgG due to the specific conformation required for the binding sites.
Example 3
[0118] ITC Experiment for Measuring Binding Affinity of IFs. Given the conformation change in the secondary structure of Z33 peptide after incorporation into IFs, it is of great interest to know if the formation of C12-Z33 IFs would influence the IgG binding ability existing in original Z33 peptide. To investigate the binding affinity of the self-assembled C12-Z33 IFs, thermodynamic properties of the binding to IgG1 were investigated by isothermal titration calorimetry (ITC). ITC has been widely employed to monitor the binding events between great numbers of proteins and ligands, which is an excellent method to explore if the binding could occur between C12-Z33 IFs and IgG1. The heat that is associated with the binding reaction was recorded during the stepwise injections and the thermodynamic parameters including thermodynamic dissociation constant (K.sub.d), molar enthalpy change)(H), and stoichiometry (N), can be obtained directly.
[0119] Table 2. Thermodynamic parameters for binding of Z33-based ligands to IgG1 at 15 C. in phosphate-buffer saline at pH 7.4. Data are reported per ligand.
TABLE-US-00002 TABLE 2 Thermodynamic parameters for binding of Z33-based ligands to IgG1 at 15 C. in phosphate-buffer saline at pH 7.4. Data are reported per IgG1. G H TS K.sub.d (kcal .Math. (kcal .Math. (kcal .Math. Ligands (nM) mol.sup.1) mol.sup.1) mol.sup.1) N Z33 60 9.5 23.1 13.6 2.31 C12-Z33 650 8.1 9.3 1.2 3.10 2C8-Z33 1115 7.8 2.8 5.0 9.13 G H TS K.sub.d (kcal .Math. (kcal .Math. (kcal .Math. Ligands (nM) mol.sup.1) mol.sup.1) mol.sup.1) Z33 26 10.0 53.4 43.4 C12-Z33 209 8.8 28.9 20.1 2C8-Z33 122 9.1 25.9 16.8
[0120] In a typical ITC experiment, a solution of 100 M C12-Z33 in PBS buffer was aged overnight and then injected into a solution of 2 M IgG1 in the same buffer at 15 C., pH 7.4. Typical thermograms and binding isotherms were shown in
[0121] While normalization per ligand allows the determination of the apparent stoichiometry of binding, comparison of the thermodynamic parameters should be done after normalization per mole of IgG as shown in Table 2. The binding of Z33 to IgG was characterized by a large favorable enthalpy opposed by a large unfavorable entropy change. The thermodynamic signature for the binding of C12-Z33 was similar although the magnitudes of the enthalpy and entropy changes were smaller. Although C12-Z33 binds with a less unfavorable entropy than Z33, the loss in favorable enthalpy is even larger which results in an overall lower binding affinity. An overall loss in the favorable binding enthalpy could possibly be caused by the unfavorable enthalpy associated with the disruption of the IFs. There is also a possibility that favorable interactions with IgG1 are limited due to restrictions in the IFs. Titration of IgG1 with C12-Z33 were also performed in IgG elution buffer (pH 2.8) at 15 C. (
[0122] To exclude the non-specific binding between IFs and IgG1, C12-SZ33 with scrambled Z33 peptide sequence was used as negative control. This C12-SZ33 IAs shows similar self-assembly properties and secondary structures characterized with TEM and CD (data not shown). ITC experiment was carried out by injecting 100 M C12-SZ33 IAs into 2 M IgG1 solution at 15 C. in PBS at pH 7.4 to measure their binding ability. The thermograms and binding isotherms in
EXAMPLE 4
[0123] To further prove the universality of the function of IFs, double chain alkylated IAs 2C8-Z33 were also studied from self-assembly property to binding affinity to IgG1 (
Example 5
[0124] Potential Applications for Purification of Immunoglobulin and other Molecules Having an Fc Portion.
[0125] The diversity of constituent amino acids provides a broad basis for non-covalent interactions including hydrogen bonding, - stacking, hydrophobic collapse, and electrostatic interactions between self-assembling peptide nanofibers. For example, the solubility of acidic and basic amino acids is determined by the degree of ionization, a property that is pH and ionic strength dependent. The self-assembly process of charged peptides can thus be facilitated by tuning the pH or adding salts to reduce the electrostatic repulsions, promote aggregation and even precipitation. Considering the numerous charged amino acid residues displayed in Z33 peptide, a fascinating advantage of our immunofiber system relies in the easily-tunable solubility. Once the IgG is bound to IFs, the IgG-IFs complexes are of high potential to be precipitated out by adding salts with high ionic intensity (
[0126] C12-Z33 IFs were chosen to study the possibility to precipitate IgG1 because of its relatively high binding affinity to IgG1. As shown in
Example 6
[0127] Molecular Design of IAs with Fragmented Antibody Binding Peptides. The peptide sequence of Z33 (FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD) (SEQ ID NO: 1) containing two -helices was separated between D and P and alkylated into two series of immuno-amphiphiles: 1) Helix1 (FNMQQQRRFYEALHD) (SEQ ID NO: 2)-based immuno-amphiphiles; 2) Helix2 (PNLNEEQRNAKIKSIRDD) (SEQ ID NO: 5)-based immuno-amphiphiles. We were interested in the possible conformation changes in peptide structures after separation, alkylation and self-assembly. C16 and 2C8 alkyl chains were conjugated on to the C-terminus of Helix1 and N-terminus of Helix2 (
Example 7
[0128] Molecular Assembly of IAs with Fragmented Antibody Binding Peptides. The self-assembly of IAs was achieved through a two-step operation. The IAs were first pretreated with HFIP to eliminate any pre-existing nanostructures formed during the synthesis and purification process. HFIP were then removed via evaporation, followed by subsequent addition of deionized water to reach a final concentration of 1 mM at pH 7.4 and age overnight. To investigate how alkylation can impact morphology of self-assembled IAs, TEM were utilized for all the IAs to visualize the assembled morphologies and representative TEM images of 100 M IA solutions are shown in
Example 8
[0129] To deeply understand the differences between single-chain and double-chain alkylated IAs with fragmented antibody binding peptides, further studies on CMC and secondary structures were conducted. The critical micelle concentration (CMC) values for various IAs were measured using Nile Red, a lipophilic dye that fluoresces depending on solvent polarity. Intensive fluorescence upon exposure to hydrophobic environments can be strongly quenched and red-shifted in aqueous media. When incubated with IAs at different concentrations in aqueous solution, Nile Red prefers to partition into the hydrophobic core offered by the self-assembled nanostructures and the CMC of IAs was determined when a blue-shift of the emission maximum occurred.
Example 9
[0130] Secondary Structure Investigation of Alkylated IAs with Fragmented Antibody Binding Peptides.
[0131] To understand the molecular packing within the self-assembled structures, circular dichroism (CD) was used to study the peptide secondary structure. As shown in
Example 10
[0132] To further confirm the component of secondary structures in the self-assembled IAs, a fluorescent dye Thioflavin-T (ThT) with large enhancement of its fluorescence emission upon binding to -sheet surfaces was used to examine the existence of -sheet secondary structures in Helix1-based IAs. As shown in
[0133] One may argue that the CD signals may come from the free monomers instead of the self-assembling filaments. To exclude this possibility, CD spectra of diluted solutions of -helix IA (represented by Helix1-2C8) and -sheet IA (represented by Helix1-C16) were taken.
[0134] As known from the geometry of -helix and -sheet, the interhelical axis distance is around 12 , while -strands are spaced by 5 , indicating a closer packing is needed for the formation of -sheet than -helix. It has been proven that longer alkyl chains tend to pack tighter and even crystalize in the self-assembled nanostructures, which can bring the peptide segments into closer proximity. For 2C8 conjugation, it should be noticed that two C8 chains were conjugated onto the Helix1 and Helix2 in an asymmetric way. Two C8 were conjugated on two adjacent lysine at the C-terminal of Helix1, and for Helix2 one was conjugated on the N-terminal amine and the other on the side chain of lysine. Increasing the number of alkyl chains with asymmetric structures can largely increase the steric hindrance and attenuate aggregation, resulting in relatively large CMC, loose packing, and wider diameter of filaments.
Example 11
[0135] Effect of Single Alkyl Chain Length.
[0136] Since the looser packing of double-chain alkylated IAs promote the formation and stabilization of -helix assemblies, we assume that shortening the length of single alkylated chains may have same effect. In order to confirm this assumption, two shorter alkyl chains (lauric acid, C12; octanoic acid, C8) were conjugated on to Helix1 and Helix2 separately and the assemblies were characterized with TEM and CD. No well-defined nanostructures and emission maximum transitions were observed for either Helix1-C8 or C8-Helix2 at the highest tested concentration of 100 M, indicating these two IAs cannot self-assemble below this concentration. Helix1-C12 and C12-Helix2 (
TABLE-US-00003 TABLE 3 Summary of IAs with fragmented antibody binding peptides Main Secondary Structure CMC Abbreviation IAs (100 M) (M) Helix1-C8 FNMQQQRRFYEALHDK (SEQ ID NO: 3)- Random coil >100 C.sub.8H.sub.15O Helix1-C12 FNMQQQRRFYEALHDK(SEQ ID NO: 3)- -sheet 5-10 C.sub.12H.sub.21O Helix1-C16 FNMQQQRRFYEALHDK(SEQ ID NO: 3)- -sheet 0.5-1.sup. C.sub.16H.sub.31O Helix1-2C8 FNMQQQRRFYEALHDKK(SEQ ID NO: 4)- -helix 10-20 (C.sub.8H.sub.15O)2 C8-Helix2 C.sub.8H.sub.15O- PNLNEEQRNAKIKSIRDD (SEQ ID Random coil >100 NO: 5) C12-Helix2 C.sub.12H.sub.21O- PNLNEEQRNAKIKSIRDD (SEQ ID -helix 2-5 NO: 5) C16-Helix2 C.sub.16H.sub.31O- PNLNEEQRNAKIKSIRDD (SEQ ID -sheet 0.5-1.sup. NO: 5) 2C8-Helix2 (C.sub.8H.sub.15O)2-KPNLNEEQRNAKIKSIRDD -helix 5-10 (SEQ II NO: 7)
Example 12
[0137] Preparation of Alternative Immnofiber Compositions Comprising an Immunofiber Binding Composition and an Immunofibers Spacer Composition.
[0138] As described above, an improved immunofibers based binding system was designed by combining binding immunofibers molecules (C12-VVKKGGZ33) and spacer molecules (C12-VVEE) in a co-assembled immunofiber system (
Example 13
[0139] To investigate the IgG binding and precipitation ability with the new immunofibers binding system, 100 l of desired immunofibers solution was incubated with IgG (with a 10:1 molar ratio of C12-VVKKGGZ33 and IgG) for half an hour followed by adding ammonium sulfate to a final concentration of 1 M to trigger the precipitation of the immunofibers and IgG. When mixing self-assembled C12-VVKKGGZ33 and IgG, no precipitation was observed after the addition of ammonium sulfate. Interestingly, the solution containing IgG and co-assembled C12-VVEE and C12-VVKKGGZ33 at a molar ratio of 10:1 became cloudy after adding salts. After centrifuging down the precipitates and analyzing the IgG concentration in the supernatant, about 30% IgG were precipitated out from the solution. IgG concentration was quantified with a ProA column (TSKgel Protein A-5PW, 20 m, 354.6 mm) monitored at 280 nm. This preliminary result showed that with a same amount of binding molecule and IgG in the solution, the addition of spacer molecule plays an important role in the IgG capture and precipitation. Spacing the binding molecule and sticking out the binding ligand Z33 at the surface of immunofibers provides more ligand flexibility and IgG accessibility.
Example 14
[0140] To increase the IgG binding efficiency and optimal precipitation condition in the co-assembled immunofibers binding system, several factors will continue to be optimized including the ratio of binding molecules to spacer molecules, the ratio of binding molecules to IgG, salt concentration, binding and salting time, and so on. The molar ratio of C12-VVEE and C12-VVKKGGZ33 and the molar ratio of C12-VVKKGGZ33 were firstly studied and preliminary results were shown in
[0141] All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein.
[0142] The use of the terms a and an and the and similar referents in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The terms comprising, having, including, and containing are to be construed as open-ended terms (i.e., meaning including, but not limited to,) unless otherwise noted. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.
[0143] Preferred embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.