BIOMARKER FOR COGNITIVE IMPAIRMENT DISORDERS AND DETECTION METHOD FOR COGNITIVE IMPAIRMENT DISORDERS USING SAID BIOMARKER

20200200767 ยท 2020-06-25

Assignee

Inventors

Cpc classification

International classification

Abstract

This invention provides a method for detecting cognitive disfunction diseases including mild cognitive impairment and Alzheimer's disease using a protein and a peptide of the protein different in the presence level in subjects having a normal cognitive function and patients suffering from cognitive disfunction diseases and a biomarker for detecting cognitive disfunction diseases including mild cognitive impairment and Alzheimer's disease containing the protein and the peptide. This invention is a biomarker for diagnosing cognitive disfunction diseases containing a prothrombin precursor protein of SEQ ID NO: 1 or a peptide THRB containing the amino acid sequence represented by SEQ ID NO: 2 which is a peptide of the protein, a diagnosis method for cognitive disfunction diseases using the biomarker, an antigen peptide represented by SEQ ID NO: 3 for creating a THRB peptide specific antibody to be used in the diagnosis method, and a cognitive disfunction disease diagnosis kit containing the THRB peptide specific antibody.

Claims

1-10. (canceled)

11. A peptide consisting of an amino acid sequence represented by SEQ ID NO: 2 or a peptide consisting of an amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added.

12. A peptide consisting of an amino acid sequence represented by SEQ ID NO: 3.

13. An antibody obtained using the peptide according to claim 11 as an immunogen.

14. The antibody according to claim 13, where the antibody is an monoclonal antibody.

15. An antibody obtained using the peptide according to claim 12 as an immunogen.

16. The antibody according to claim 15, where the antibody is an monoclonal antibody.

17. A method for detecting a cognitive dysfunction disease in a subject comprising: detecting a peptide according to claim 11 in a biological sample extracted from the subject.

18. The method for detecting a cognitive dysfunction disease in a subject according to claim 17, wherein the detecting is performed using a monoclonal antibody against said peptide.

19. The method for detecting a cognitive dysfunction disease in a subject according to claim 18, wherein the detecting is performed by an immunoblotting method, a western blotting method, an enzyme-, fluorescence-, or radioactive-labeling method, a mass spectrometry method, an immuno-MS method, or a surface plasmon resonance method.

20. The method for detecting a cognitive dysfunction disease in a subject according to claim 17, wherein the detecting is performed using a monoclonal antibody obtained using the peptide consisting of an amino acid sequence represented by SEQ ID NO: 3 as an immunogen.

21. The method for detecting a cognitive dysfunction disease in a subject according to claim 20, wherein the detecting is performed by an immunoblotting method, a western blotting method, an enzyme-, fluorescence-, or radioactive-labeling method, a mass spectrometry method, an immuno-MS method, or a surface plasmon resonance method.

22. The method for detecting a cognitive dysfunction disease in a subject according to claim 17, wherein the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

23. A method for diagnosing a cognitive dysfunction disease in a subject comprising: providing a separate subject having the cognitive dysfunction disease; preparing a first biological sample extracted from the separate subject having the cognitive dysfunction disease; preparing a second biological sample extracted from the subject to be diagnosed; measuring a peptide according to claim 11 both in the first biological sample and in the second biological sample; and comparing the measurement from the first biological sample with that from the second biological sample.

24. The method for diagnosing a cognitive dysfunction disease in a subject according to claim 23, wherein the measuring a peptide is performed using a monoclonal antibody obtained using the peptide consisting of an amino acid sequence represented by SEQ ID NO: 3 as an immunogen.

25. The method for diagnosing a cognitive dysfunction disease in a subject according to claim 23, wherein the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

26. A kit for detecting a cognitive dysfunction disease comprising: an antibody or an aptamer specifically bound to a peptide according to claim 11.

27. The kit for detecting a cognitive dysfunction disease according to claim 26, wherein the antibody is a monoclonal antibody obtained by immunizing a mouse with the peptide consisting of an amino acid sequence represented by SEQ ID NO: 3.

28. The kit for detecting a cognitive dysfunction disease according to claim 26, wherein the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

Description

BRIEF DESCRIPTION OF DRAWINGS

[0028] FIG. 1 is a figure illustrating the retention time of a mass peak and m/z in a C18 reverse phase chromatography (second dimension) of Marker A detected in serum of a subject.

[0029] FIG. 2 are figures illustrating the differential analysis results in the case of Marker A by dots.

[0030] FIG. 3 are graphs illustrating ROC curves of Marker A (SEQ ID NO: 2, THRB).

[0031] FIG. 4 is an MS/MS spectrum by a TOF/TOF mass spectrometer.

DESCRIPTION OF EMBODIMENTS

[0032] The present invention is a method for diagnosing whether a subject is suffering from a cognitive dysfunction disease by detecting a peptide containing the amino acid sequence represented by SEQ ID NO: 2 or a peptide containing the amino acid represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added or the level thereof and simultaneously measuring a change in the level thereof in a living body sample of the subject, when the subject is suffering from a cognitive dysfunction disease.

[0033] Herein, the peptide generally refers to one having amino acids having a molecular weight of 10,000 or less bound to each other or one having several to about 50 amino acid residues or less. In the present invention, a partial peptide of an intact protein peptide derived from a peptide is usable as a biomarker for detecting cognitive dysfunction diseases. When referred to as the partial peptide, the partial peptide is a peptide having a partial amino acid sequence which is a part of the amino acid sequence possessed by the intact protein and having a molecular weight of 10,000 or less. In the present invention, the partial peptide of an intact protein refers to a peptide having a partial amino acid sequence which is a part of the amino acid sequence possessed by the intact protein and is sometimes formed as a partial peptide in a process of expression and synthesis through transcription and translation or sometimes formed as a digestion product peptide due to an in vivo digestion after being synthesized as an intact protein. This may be due to deregulation of the mechanism for synthesis and control of the protein in the presence of in vivo condition which is not normal, as in a cognitive dysfunction disease or the like. More specifically, the present invention is also a method for discriminating whether a subject is in a normal condition or is suffering from a cognitive dysfunction disease using an in vivo protein expression and synthesis, and/or digestion as an index and also, in the case of suffering from the cognitive dysfunction disease, evaluating the degree to which the disease has been advanced. In the present invention, the detection of cognitive dysfunction diseases means evaluation and discrimination of whether a subject is suffering from a cognitive dysfunction disease, i.e., performing diagnosis. Moreover, the evaluation of the risk at which the subject will suffer from a more serious cognitive dysfunction and the like may be included.

[0034] In the method of the present invention, the intact protein usable as a biomarker for detecting cognitive dysfunction diseases, Prothrombin (SEQ ID NO: 1) is specifically mentioned and a peptide fragment having 5 or more amino acid residues which is the partial peptide of the intact protein may be used for the same purpose.

[0035] Moreover, the peptide usable as the biomarker for detecting cognitive dysfunction diseases is the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added.

[0036] Herein, in the present invention, although the intact proteins and the peptides described above are used as a marker, proteins or peptides containing an amino acid sequence in which one or several amino acids is/are deleted, substituted, or added in each amino acid sequence thereof are also included and the proteins or the peptides are also usable as the biomarker in the method of the present invention.

[0037] As used herein, one or several means one to three, one or two, or one.

[0038] Furthermore, these peptides usable as the biomarker for detecting cognitive dysfunction diseases include peptide fragments generated from the amino acid sequence represented by SEQ ID NO: 1 or SEQ ID NO: 2 having 5 or more amino acid residues. The reason why 5 or more amino acid residues is designated in the peptide fragment having 5 or more amino acid residues is based on the following description in Non-Patent Document 2. This Non-Patent Document 2 reports that a peptide resulting from substituting K for R in the histone H3's C-terminal (130 to 135) amino acid residue sequence IRGERA and a peptide CGGGERA resulting from deletion of IR and ligation of CGG to GERA were recognized by an antibody obtained by using a peptide IRGERA as an immunogen. This reflects that the recognition of the antigenicity is accomplished by a peptide containing 4 or more amino acid residues. While, in the present invention, the number of the residues is 5 or more which is larger by one to give more generality to those other than the histone H3's C-terminal, it is important to cover even such a low molecular weight peptide when the detection and separation are performed by an immunological procedure, such as an immunoblotting method, an ELISA method, and an immuno-MS method.

[0039] To an intact protein or a peptide, a sugar chain is sometimes added. Such a protein or a peptide to which a sugar chain was added is also usable as the biomarker for detecting cognitive dysfunction diseases.

[0040] In the present invention, the biomarker may be quantified or a qualification may be performed to determine the presence or absence.

[0041] As a method for separating the biomarker in a biological sample, such as serum, in the present invention, a two-dimensional electrophoresis or a two-dimensional chromatography is usable. The two kinds of chromatography in this case may be selected from known chromatography, such as ion exchange chromatography, reverse phase chromatography, and gel filtration chromatography. Moreover, the biomarker can also be quantified by an SRM/MRM method using an LC-MS/MS method. In addition, by the use of the immuno-MS method including binding beads (including magnetic beads) developed by the present inventors to antibodies against target proteins or peptides to thereby capture the proteins or peptides to be measured, allowing the proteins or peptides to elute from the beads, and then measuring the proteins or peptides by mass spectrometry, the presence or absence or the level of the target proteins, protein fragments, or peptides can be conveniently evaluated without using two-dimensional electrophoresis or chromatography.

[0042] The method of the present invention also enables the evaluation of a cognitive dysfunction of a subject at a mild stage and is useful also in preventive medicine. When a mental therapy or a medication given to a patient suffering from a cognitive dysfunction disease serves to suppress the progression of the impairment, the suppression is reflected on the levels of the proteins/peptides in biological samples, such as serum. By measuring the levels, the effectiveness of the treatment can be evaluated and judged.

[0043] The type and the level of proteins in a biological sample can be measured by various methods. When the target protein (including a protein fragment and a peptide) is specified and an antibody thereagainst (primary antibody) is obtained, the following methods are usable.

[0044] As the antibody, a polyclonal antibody or a monoclonal antibody is can be produced by immunizing an antibody production animal (for example, rabbit or mouse) with a protein containing the amino acid sequence represented by SEQ ID NO: 1, a peptide containing the amino acid sequence represented by SEQ ID NO: 2, or a peptide containing partial peptides thereof (for example, peptide containing the amino acid sequence represented by SEQ ID NO: 3), followed by purification.

1. Immunoblotting Method

[0045] This is the simplest method. Serially diluted serum samples are prepared, and then an aliquot (about 1 microliter) is dropped onto an appropriate membrane, such as a nitrocellulose membrane, followed by drying in air. After treatment with a blocking solution containing a protein, such as BSA, or a peptide followed by washing, reaction with a primary antibody, and then washing, a labeled secondary antibody for detecting the primary antibody is reacted. After washing the membrane, the label is visualized and the concentration is measured.

2. Western Blotting Method

[0046] After performing one-dimensional or two-dimensional gel electrophoresis including an isoelectric focusing or SDS-PAGE, the separated protein or peptide is once transferred onto an appropriate membrane, such as a PVDF membrane, and a primary antibody and a labeled secondary antibody are used to perform a procedure analogous to the above-described immunoblotting method to thereby measure the presence level of the target protein.

3. ELISA Method

[0047] An antibody against a protein or its partial peptide is bound to a support, such as a microtiter plate, which has been chemically modified in a specific manner, a sample is subjected to a serial dilution, and then an appropriate amount thereof is added to the microtiter plate to which the antibody is bound, followed by incubation. Thereafter, the protein and the peptide which were not captured are washed out. Then, a secondary antibody having a fluorescent or chemiluminescent substance or an enzyme bound thereto is added and incubated. For detection, each substrate is added, and thereafter the fluorescent or chemiluminescent substance or the enzymatic reaction-induced visible light is measured to thereby accomplish evaluation and judgement. Instead of the antibody, a substance capable of binding to the protein or peptide may be used. For example, an aptamer or the like is usable.

[0048] Further methods (see Patent Document 2) are also exemplified below, but the present invention is not limited thereto.

4. Method Using Microarray (Microchip)

[0049] A microarray is a generic name of devices in which substances capable of binding to a substance to be measured are aligned (arrayed) and immobilized on a support (substrate). In the case of the present invention, an antibody against a protein and a peptide or an aptamer may be aligned and immobilized. In the measurement, a biological sample is added to an immobilized antibody and the like, and a protein or a peptide to be measured is bound onto the microarray, and then a secondary antibody having a fluorescent or chemiluminescent substance or an enzyme bound thereto is added and incubated. For detection, each substrate is added and thereafter the fluorescent or chemiluminescent substance or the enzymatic reaction-induced visible light may be measured.

5. Mass Spectrometry Method

[0050] In a mass spectrometry method, for example, an antibody against a certain protein and peptide is bound to a microbead or a substrate (protein chip) which has been chemically modified in a specific manner. The microbead may be a magnetic bead. Materials of the substrate are not limited. The antibody to be used may be all of (1) an antibody recognizing only the full-length of a certain protein, (2) an antibody recognizing only a certain peptide, and (3) an antibody recognizing both the certain protein and the certain peptide, or a combination of the above-described (1) and (2), (1) and (3), or (2) and (3). An appropriate amount of a sample is added as it is or after serial dilution with a buffer solution to a microbead or a substrate to which the antibody has been bound, and then incubated. Thereafter, the non-captured protein and peptide are washed out. Thereafter, the protein and the peptide captured on the microbead or the substrate are analyzed by mass spectrometry using MALDI-TOF-MS, SELDI-TOF-MS, and the like to thereby measure the peak mass numbers and the peak intensities of the protein, protein fragment, and the peptide. By adding a specific amount of an appropriate internal standard substance to the starting biological sample, measuring its peak intensity, and then calculating the ratio to the peak intensity of the target substance, the concentration in the starting biological sample can be known. This method is referred to as an immuno-MS method. A sample is separated by HPLC as it is or after diluting it with a buffer solution or partially removing the protein, and then quantification can be performed by mass spectrometry using an electrospray ionization (ESI) method. In such a case, by means of an absolute quantification by the SRM/MRM method using an isotopically labeled internal standard peptide, the concentration in the sample can be known.

[0051] Furthermore, in addition to the above-described methods, a protein and a peptide can be analyzed also by a method using a two-dimensional electrophoresis, a method using surface plasmon resonance, and the like.

[0052] The present invention also includes a method for detecting cognitive dysfunction diseases using the presence or absence or the level of the above-described biomarker as an index by subjecting a biological sample taken from a subject to a two-dimensional electrophoresis or a surface plasmon resonance.

[0053] In the above-described methods, the peptide containing the amino acid sequence represented by SEQ ID NO: 2 according to the present invention may be combined as appropriate with one or two or more of other biomarkers for detecting cognitive dysfunction diseases. Examples of the other biomarkers for detecting cognitive dysfunction diseases include those described in International Publication No. WO2010/134308 and International Publication No. WO2012/086197, for example.

[0054] Biomarkers particularly preferable for the combination among the biomarkers described in these publications are as follows:

TABLE-US-00001 Neurexin-2-betaprecursor-derivedpeptideNRX2B Aminoacidsequence: (SEQIDNO:4) RSGGNATLQVDSWP Prothrombinprecursor-derivedpeptideTHRB(R) Aminoacidsequence: (SEQIDNO:5) GLDEDSDRAIEG Prothrombinprecursor-derivedpeptideTHRB(R+) Aminoacidsequence: (SEQIDNO:6) GLDEDSDRAIEGR Pendrin-derivedpeptideS26A4 Aminoacidsequence: (SEQIDNO:7) LAGLIFGLLTVVLR Coatomersubunitzeta-1-derivedpeptideCOPZ1 Aminoacidsequence: (SEQIDNO:8) AILILDNDGDRLFAKYYDD Retinoicacidreceptorresponderprotein2 precursor-derivedpeptideRARR2(S) Aminoacidsequence: (SEQIDNO:9) PHSFYFPGQFAFSKALPR Retinoicacidreceptorresponderprotein2 precursor-derivedpeptideRARR2(S+) Aminoacidsequence: (SEQIDNO:10) PHSFYFPGQFAFSKALPRS Gelsolinprecursor-derivedpeptideGELS Aminoacidsequence: (SEQIDNO:11) PVRAATASRGAS Clusterinprecursor-derivedpeptideCLUS(N-term SDVP) Aminoacidsequence: (SEQIDNO:12) SDVPSGVTEVVVKLFDS Clusterinprecursor-derivedpeptideCLUS(N-term RFFT) Aminoacidsequence: (SEQIDNO:13) RFFTREPQDTYHYLPFSLPH Eukaryotictranslationinitiationfactor3subunit J-derivedpeptideEIF3J Aminoacidsequence: (SEQIDNO:14) GVVPGGGLKATMKDDLADYGGYDGG+Oxidation(M) Leucine-richrepeat-containingprotein27-derived peptideLRC27 Aminoacidsequence: (SEQIDNO:15) SSPILDLSESGLCRLEEVFRIPS ComplementC3-derivedpeptideCO3 Aminoacidsequence: (SEQIDNO:16) APVIHQEMIGGLRN TranscriptionfactorAP-2gamma-derivedpeptide AP2C Aminoacidsequence: (SEQIDNO:17) PGRQSQEGAGLPSHHG Synapsin-3-derivedpeptideSYN3 Aminoacidsequence: (SEQIDNO:18) EMFGGLDICAVKAVHSK Oxytocinreceptor-derivedpeptideOXYR Aminoacidsequence: (SEQIDNO:19) AAPPGAEGNRT Inter-alpha-trypsininhibitorheavychainH5-like protein-derivedpeptideITH5L Aminoacidsequence: (SEQIDNO:20) RVSLFSLAFGDDAD E3ubiquitin-proteinligaseHERC2-derivedpeptide HERC2 Aminoacidsequence: (SEQIDNO:21) KLAELPAAAQPSAEDSD Prothrombin-derivedpeptideTHRB Aminoacidsequence: (SEQIDNO:22) TATSEYQTFFNPRTFGSGEAD Transthyretin-derivedpeptideTTHY Aminoacidsequence: (SEQIDNO:23) AVRGSPAINVAVHVFRKAAD Tumornecrosisfactorreceptorsuperfamilymember 16-derivedpeptideTNR16 Aminoacidsequence: (SEQIDNO:24) QTASGQALKGDGGLYS ComplementC4-derivedpeptideCO4-1 Aminoacidsequence: (SEQIDNO:25) NGFKSHALQLNNRQIR ComplementC4-derivedpeptideCO4-2 Aminoacidsequence: (SEQIDNO:26) APLQPVTPLQLFEGRRN Fibrinogenalphachain-derivedpeptideFIBA-1 Aminoacidsequence: (SEQIDNO:27) SSSYSKQFTSSTSYNRGDSTFES Fibrinogenalphachain-derivedpeptideFIBA-2 Aminoacidsequence: (SEQIDNO:28) SSSYSKQFTSSTSYNRGDSTFESKS Fibrinogenalphachain-derivedpeptideFIBA-3 Aminoacidsequence: (SEQIDNO:29) SSSYSKQFTSSTSYNRGDSTFESKSY.

[0055] The present invention also provides a kit for detecting cognitive dysfunction diseases containing an antibody or an aptamer specifically bound to the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added.

[0056] The technology according to the present invention also includes a device capable of detecting the biomarker in the above-described biological samples (for example, detecting device, measuring device, analyzing device, and the like). The device according to the present technology is desirably provided with an antibody- or aptamer-immobilizing portion (capturing portion) and a measuring portion. The antibody- or aptamer-immobilizing portion preferably has a solid support, such as a glass slide and a 96-well titer plate, to which the antibody or the aptamer is immobilized. The measuring portion is preferably provided with a light detecting means corresponding to the detection target, such as a spectrophotometer and fluorescence spectrophotometer.

[0057] The device of the present technology may include an analyzing portion analyzing the obtained data. The analyzing portion preferably includes a data processing device and analysis software.

[0058] Furthermore, a controlling portion including a CPU and the like provided in the device of this disclosure or a system connectable thereto (for example, personal computer, computer network system, and the like) is provided with a program capable of implementing methods for detecting and diagnosing, for example, the cognitive dysfunction diseases of the present technology described above, a memory or a system storing such a program, or the like.

[0059] The present invention enables the judgment of a cognitive dysfunction of a subject. The present technology also enables the evaluation of a cognitive dysfunction of a subject at a mild stage, and thus is useful also in preventive medicine. Furthermore, when a mental therapy or a medication given to a patient suffering from a cognitive dysfunction disease serves to suppress the progression of the impairment, the suppression is reflected on the levels of the proteins/peptides in biological samples, such as serum. By measuring the levels, the effectiveness of the treatment can be evaluated and judged, and screening for a drug discovery target biomolecule becomes possible.

[0060] The present technology can also employ the following configurations.

[1]

[0061] A method for diagnosing a cognitive dysfunction disease, assisting the diagnosis, and treating the cognitive dysfunction disease includes

[0062] a. extracting a living body sample from a subject,

[0063] b. bringing

[0064] an antibody produced by immunizing an antibody production animal (for example, mouse or rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 2 or a peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added,

[0065] an antibody produced by immunizing the antibody production animal (for example, mouse and rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 3, or

[0066] an aptamer specifically bound to the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added

[0067] into contact with the living body sample to detect the presence of a biomarker for detecting the cognitive dysfunction disease represented by SEQ ID NO: 2 in the living body sample,

[0068] c. when the presence of the biomarker for detecting a cognitive dysfunction disease represented by SEQ ID NO: 2 is detected in the living body sample, diagnosing that the subject is suffering from the cognitive dysfunction disease or has a high possibility of being suffering from the cognitive dysfunction disease, and

[0069] d. giving an anti-acetylcholinesterase inhibitor to the subject who has been diagnosed to be suffering from the cognitive dysfunction disease or has a high possibility of being suffering from the cognitive dysfunction disease.

[2]

[0070] The method for diagnosing a cognitive dysfunction disease and assisting the diagnosis according to [1], in which the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

[3]

[0071] The method for diagnosing a cognitive dysfunction disease and assisting the diagnosis according to [1], in which the living body sample is blood, plasma, or serum.

[4]

[0072] A method for diagnosing a cognitive dysfunction disease, assisting the diagnosis, and treating the cognitive dysfunction disease includes

[0073] a. extracting a living body sample from a subject,

[0074] b. bringing

[0075] an antibody produced by immunizing an antibody production animal (for example, rabbit or mouse) with a peptide containing the amino acid sequence represented by SEQ ID NO: 2 or a peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added,

[0076] an antibody produced by immunizing the antibody production animal (for example, mouse and rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 3, or

[0077] an aptamer specifically bound to the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added into contact with the living body sample to measure a biomarker for detecting the cognitive dysfunction disease represented by SEQ ID NO: 2 in the living body sample,

[0078] c. when the presence level of the biomarker for detecting the cognitive dysfunction disease containing the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added in the living body sample extracted from the subject is larger than the presence level of the biomarker for detecting the cognitive dysfunction disease in a living body sample extracted from a person not suffering from the cognitive dysfunction disease, diagnosing that the subject is suffering from the cognitive dysfunction disease or has high possibility of being suffering from the cognitive dysfunction disease, and

[0079] d. giving an anti-acetylcholinesterase inhibitor to the subject who has been diagnosed to be suffering from the cognitive dysfunction disease or has high possibility of being suffering from the cognitive dysfunction disease.

[5]

[0080] The method for diagnosing a cognitive dysfunction disease, assisting the diagnosis, and treating the cognitive dysfunction disease according to [4], in which the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

[6]

[0081] The method for diagnosing a cognitive dysfunction disease, assisting the diagnosis, and treating the cognitive dysfunction disease according to [4], in which the living body sample is blood, plasma, or serum.

[7]

[0082] A method for diagnosing a cognitive dysfunction disease and assisting the diagnosis includes

[0083] a. extracting a living body sample from a subject,

[0084] b. bringing

[0085] an antibody produced by immunizing an antibody production animal (for example, mouse or rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 2 or a peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added,

[0086] an antibody produced by immunizing the antibody production animal (for example, mouse and rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 3, or

[0087] an aptamer specifically bound to the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added into contact with the living body sample to detect the presence of a biomarker for detecting the cognitive dysfunction disease represented by SEQ ID NO: 2 in the living body sample, and

[0088] c. when the presence of the biomarker for detecting a cognitive dysfunction disease represented by SEQ ID NO: 2 is detected in the living body sample, diagnosing that the subject is suffering from the cognitive dysfunction disease or has high possibility of being suffering from the cognitive dysfunction disease.

[8]

[0089] The method for diagnosing a cognitive dysfunction disease and assisting the diagnosis according to [7], in which the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

[9]

[0090] The method for diagnosing a cognitive dysfunction disease and assisting the diagnosis according to [7], in which the living body sample is blood, plasma, or serum.

[10]

[0091] A method for diagnosing a cognitive dysfunction disease and assisting the diagnosis includes

[0092] a. extracting a living body sample from a subject,

[0093] b. bringing

[0094] an antibody produced by immunizing an antibody production animal (for example, mouse or rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 2 or a peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added,

[0095] an antibody produced by immunizing the antibody production animal (for example, mouse and rabbit) with a peptide containing the amino acid sequence represented by SEQ ID NO: 3, or

[0096] an aptamer specifically bound to the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added into contact with the living body sample to measure a biomarker for detecting the cognitive dysfunction disease represented by SEQ ID NO: 2 in the living body sample, and

[0097] c. when the presence level of the biomarker for detecting the cognitive dysfunction disease containing the peptide containing the amino acid sequence represented by SEQ ID NO: 2 or the peptide containing the amino acid sequence represented by SEQ ID NO: 2 in which 1 to 3 amino acids are deleted, substituted, and/or added in the living body sample extracted from the subject is larger than the presence level of the biomarker for detecting the cognitive dysfunction disease in a living body sample extracted from a person not suffering from the cognitive dysfunction disease, diagnosing that the subject is suffering from the cognitive dysfunction disease or has high possibility of being suffering from the cognitive dysfunction.

[11]

[0098] The method for diagnosing a cognitive dysfunction disease and assisting the diagnosis according to [10], in which the cognitive dysfunction disease is mild cognitive impairment or Alzheimer's disease.

[12]

[0099] The method for diagnosing a cognitive dysfunction disease and assisting the diagnosis according to [10], in which the living body sample is blood, plasma, or serum.

EXAMPLES

[0100] Hereinafter, the present invention is described in more detail based on Examples. Examples described below illustrate examples of typical Examples of the present invention and the scope of the present invention should not be narrowly interpreted by Examples.

<Search of Cognitive Dysfunction Disease Diagnostic Marker Peptide by Two-Dimensional Liquid Chromatography-Mass Spectrometry (2D-LC-MALDI-TOF-MS)>

(1) Serum Sample

[0101] Serum samples of 20 AD (Alzheimer's disease) samples, 20 MCI (mild cognitive impairment) samples, 20 NDC (subject having a normal cognitive function matched with the AD patients in the age and the sex, non-demented control) samples, and 10 ODD (Other demented disease) samples were used. Furthermore, for the ODD, 10 serum samples of each of Dementia with Lewy Bodies and Frontotemporal dementia were used.

(2) Method

[0102] 475 l of 0.1% trifluoroacetic acid (TFA) was added to 25 l of each serum, and then boiled at 100 C. for 15 minutes. Thereafter, in order to collect peptides having a molecular weight of 10,000 or less, ultrafiltration was performed using YM-10 of Millipore Corporation.

[0103] Next, the analysis by the 2D-LC-MALDI-TOF-MS method was performed as follows. More specifically, samples collected by the ultrafiltration were fractionated into 382 fractions per sample using a two-dimensional HPLC (SCX cation exchange column in the first dimension and C18 reverse phase column in the second dimension). In the SCX cation exchange column, the sample was fractionated into two fractions. More specifically, SCX 1 is a flow-through fraction and SCX 2 is a fraction eluted at a salt concentration of 100%.

[0104] The two fractions fractionated by the SCX each were fractionated into 191 fractions by the C18 reverse phase column chromatography. One fraction was eluted in 6 seconds. The retention time was obtained by multiplying Number of eluted fractions-1 by 6 seconds.

[0105] All the samples were spotted on a well on a MALDI target plate (MTP AnchorChip 600/384 plate (BRUKER DALTONICS)) for a MALDI TOF/TOF mass spectrometer (ultraflex TOF/TOF, BRUKER DALTONICS) using a spotting robot (AccuSpot, SHIMADZU) connected online while being mixed with a matrix solution (-cyano-hydroxycinnamic acid, -CHCA and cocrystallized.

[0106] After mounted to the ultraflex TOF/TOF, laser was emitted to automatically measure the mass and the peak area (including a normalization process described below) in the mass in a reflectron mode. The peak area was normalized by 250 fmole of bradykinin 1-7 per well added to the matrix solution beforehand and set as an Area value. More specifically, a value obtained by dividing the peak area in the specific mass of the sample by the peak area obtained from the bradykinin 1-7 was set as the Area value. The Area value corresponds to 25 l of sample serum.

[0107] The detection of the peptides different in the presence level (differential analysis) in serum among groups was performed using a DeView (MCBI) which is multi-group statistical analysis software developed by us.

[0108] In the peptide in which the difference was observed in the presence level, the amino acid sequence was determined by the MS/MS using the ultraflex TOF/TOF and an intact protein or peptide which is the origin thereof was identified.

(3) Results

[0109] The results of performing the differential analysis by the DeView software about data obtained by subjecting the serum of each subject to the 2D-LC-MALDI-TOF-MS are described below.

[0110] FIG. 1 is a figure in which the horizontal axis represents the mass per unit charge (m/z) and the vertical axis represents the number of fractions (Fraction) in the reverse phase column chromatography in the second dimension about the spectrum measured by MALDI-TOF-MS for the 191 fractions obtained by fractionating the fractions fractionated first (SCX 1), among the fractions fractionated into the two fractions with the SCX cation exchange column in the first dimension, by the C18 reverse phase column in the second dimension.

[0111] The dots in the figure each are the TOF-MS peak derived from each subject. A portion where the dots gathered is specified as the peak derived from one peptide having the same m/z and the same number of fractions within an error range, which is indicated as a cluster. A group of the dots in the rectangle illustrated in FIG. 1(A) is a cluster of Marker A.

[0112] The dots in the cluster can be regarded to have the same m/z and the same retention time within an error range and is specified to be derived from the same peptide.

[0113] FIG. 2 illustrate the differential analysis results of the Marker A. The Marker A is a Prothrombin-derived peptide THRB as represented in the amino acid sequence obtained as a result of the MS/MS analysis of FIG. 4. FIG. 2(A) illustrates a comparison among subjects having a normal cognitive function (NDC), mild cognitive impairment (MCI), and Alzheimer type dementia patients (AD). FIG. 2(B) illustrates a comparison among the NDC, the AD, and the other dementia patients (ODD).

[0114] The Marker A is a Prothrombin-derived peptide THRB as illustrated later in FIG. 4. FIG. 2(A) illustrates a comparison among the NDC, the MCI, and the AD. FIG. 2(B) is a comparison among the NDC, the AD, and the ODD. FIGS. 2(A) and 2(B) illustrate the results of different experiments, in which the same samples were used in both the experiments for the NDC and the AD (i.e., the reproducibility of the measurement results are illustrated about the NDC and the AD).

[0115] In FIG. 2(A), the Marker A showed a statistically significant increase in the MCI and AD patients rather than the NDC (p<0.05 in a t-test).

[0116] In FIG. 2(B), it was found that the Marker A significantly increased in the AD and the ODD rather than the NDC.

[0117] From the results of FIG. 2, the analysis by a receiver operating characteristic curve (ROC curve) was performed in order to evaluate the useful level as a biomarker of the Marker A.

[0118] FIGS. 3(A) and 3(B) are the ROC curves in a comparison between NDC vs. AD and NDC vs. MCI, respectively.

[0119] The usefulness as a biomarker becomes higher as the area value of the lower side of the ROC curve (AUC of ROC) (hereinafter referred to as AUC value) is closer to 1.

[0120] The typical values of the sensitivity and the specificity are values of the coordinates (open square in the figures) of the dots on the ROC curves in which, when a straight line is drawn on the ROC curves from the 100% point on the y-axis, the distance is the minimum in FIGS. 3(A) and 3(B). A cutoff value giving the point serves as a threshold value useful for the discrimination between different groups. The sensitivity and the specificity (i.e., the above-described typical values) at that time serve as an index of the usefulness of the biomarker together with the AUC value.

[0121] In FIG. 3(A), the sensitivity as the typical value was 100%, the specificity as the typical value was 100%, and the AUC value was 1.0 in NDC vs. AD. In FIG. 3(B), the sensitivity as the typical value was 90%, the specificity as the typical value was 100%, and the AUC value was 0.95 in NDC vs. MCI.

[0122] The results above showed that the marker A is useful for distinguishing the AD patients and the MCI patients from the subjects having a normal cognitive function (NDC). Moreover, it was clarified that the marker A is useful also for distinguishing the NDC and the other dementia (ODD).

[0123] In particular, the MCI is a preceding stage of the AD, and therefore it is considered that the Marker A (THRB) is very useful as a marker for diagnosing and detecting a subject who may shift to the AD at an early stage.

[0124] FIG. 4 illustrates the MS/MS analysis results analyzed by the ultraflex TOF/TOF type mass spectrometer for the Marker A. The amino acid sequence of the THRB and b-ions and y-ions appearing in the MS/MS spectrum are illustrated in the upper side of FIG. 4.

[0125] Signals indicating y-ions, b-ions, and a-ions sufficiently appeared, and thus the amino acid sequence was able to be easily judged. The search by Mascot was performed for the results, so that it was clarified that a protein or a peptide which is the origin thereof (hereinafter, referred to as intact protein or peptide) was identified to be a Prothrombin precursor and the detected peptide contains the amino acid sequence TATSEYQTFFNPR derived from the protein. About the detected peptide, THRB which is the UniProt Entry Name is used as an abbreviated name of a peptide name.

[0126] A set of two amino acid sequences of the THRB are shown below. The first sequence is the amino acid sequence of the intact protein of the THRB and the second sequence is the sequence of the detected peptide. An underline portion of the first sequence corresponds to the sequence of the detected peptide. The amino acid sequence starting with (0001) indicates the N-terminal side sequence.

[1] Prothrombin-Derived Peptide THRB

[0127] With respect to the Area value of the THRB of SEQ ID NO: 2, the cognitive dysfunction diseases (AD, MCI, DLB, FTD) show statistically significantly high values as compared with the NDC (t-test, p<0.05) (FIG. 2), and thus it was found that the THRB of SEQ ID NO: 2 is useful for discriminating the cognitive dysfunction disease (AD, MCI, DLB, FTD) patients from the subjects having normal cognitive function (NDC). According to the analysis by the receiver operating characteristic curves, it is clarified that the THRB of SEQ ID NO: 2 is useful for discriminating the AD and MCI patients from the subjects having normal cognitive function (NDC) (FIG. 3).

TABLE-US-00002 [Intactprotein/peptide] (SEQIDNO:1) 0001ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVF WAKYTACETA 0051RTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWR SRYPHKPEIN 0101STTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSI PVCGQDQVTV 0151AMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLP CLAWASAQAK 0201ALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDF GYCDLNYCEE 0251AVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGE ADCGLRPLFE 0301KKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFR KSPQELLCGA 0351SLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTR YERNIEKISM 0401LEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCL PDRETAASLL 0451QAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVER PVCKDSTRIR 0501ITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWY QMGIVSWGEG 0551CDRDGKYGFYTHVFRLKKWIQKVIDQFGE [Prothrombin-derivedpeptideTHRB] (SEQIDNO:2) TATSEYQTFFNPR

[0128] As described above, it was shown that the THRB of SEQ ID NO: 2 is useful as a biomarker for detecting cognitive dysfunction diseases. By directly measuring the presence level thereof in serum by mass spectrometry or other methods, such as immunological or enzymological methods, using a liquid chromatography and/or other appropriate separation means or without using the same, the cognitive dysfunction diseases, such as AD and MCI, can be discriminated on diagnosis.

<Production of THRB Marker Peptide Specific Monoclonal Antibody>

[0129] An antigen peptide was synthesized in order to create a specific antibody recognizing the Prothrombin precursor-derived peptide THRB of SEQ ID NO: 2. For the synthetic peptide, a cysteine residue was added to the C-terminal in order to be bound to a carrier protein.

[0130] A peptide (TATSEYQTC-KLH, see the description later) bound to the carrier protein was mixed with an adjuvant, and then immunized to a mouse. About two weeks later, additional immunization was performed. Three weeks later, lymphocytes were isolated from the iliac lymph node, cell fusion with myeloma was performed, and then hybridoma culture was started.

[0131] A culture supernatant was measured by an enzyme immunoassay method (EIA method), a hybridoma showing positivity was selected, and single cloning was performed. A large amount of the single cloned hybridoma was cultured, and then a specific antibody was purified using a Protein G column.

[0132] The sequence of the synthetic antigen peptide for creating the specific antibody is shown below. The cysteine residue (C) on the C-terminal of an underline portion was added in order to be bound to the carrier protein.

TABLE-US-00003 [Syntheticantigenpeptide] (SEQIDNO:3) TATSEYQTC

INDUSTRIAL APPLICABILITY

[0133] Since cognitive dysfunction diseases including mild cognitive impairment and Alzheimer's disease can be detected using the biomarker disclosed in the present invention, the present invention is applicable to the use in the diagnostic field including a diagnostic agent.