PERONOSPORA RESISTANCE IN SPINACIA OLERACEA
20200199615 ยท 2020-06-25
Inventors
Cpc classification
International classification
Abstract
The present invention relates to an allele designated alpha-WOLF 25 which confers resistance to at least one Peronospora farinosa f. sp. spinacea race, wherein the protein encoded by said allele is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5. The allele when present in a spinach plant confers complete resistance to at least Peronospora farinosa f. sp. spinacea race Pfs:8, Pfs15 and Pfs:16, and does not confer resistance to Pfs:3.
Claims
1. An allele designated alpha-WOLF 25 which confers resistance to at least one Peronospora farinosa f. sp. spinaciae race, wherein the protein encoded by said allele is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5.
2. The allele of claim 1 wherein the genomic DNA sequence of the LRR domain in order of increased preference has at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 4.
3. The allele of claim 1, wherein the allele when present in a spinach plant confers complete resistance to at least Peronospora farinosa f. sp. spinaciae race Pfs:8, Pfs:15 and Pfs:16, and does not confer resistance to Pfs:3.
4. A spinach plant comprising the allele of claim 1, of which a representative sample of seed capable of growing into a plant comprising said allele was deposited with the NCIMB under NCIMB Accession number 43495.
5. The spinach plant of claim 4, wherein the plant is an agronomically elite plant.
6. The spinach plant of claim 5, wherein the agronomically elite plant is a hybrid variety or an inbred line.
7. The spinach plant of claim 6, further comprising a genetic determinant resulting in resistance against Peronospora farinosa f. sp. spinaciae races Pfs:1 to Pfs:16.
8. A propagation material capable of developing into and/or being derived from the spinach plant of claim 4, wherein the propagation material comprises the allele and wherein the propagation material is selected from a group consisting of a microspore, a pollen, an ovary, an ovule, an embryo, an embryo sac, an egg cell, a cutting, a root, a root tip, a hypocotyl, a cotyledon, a stem, a leaf, a flower, an anther, a seed, a meristematic cell, a protoplast, a cell, or a tissue culture thereof.
9. A cell of a spinach plant, which cell comprises the allele of claim 1.
10. A method of producing a hybrid spinach seed comprising crossing a first parent spinach plant with a second parent spinach plant and harvesting the resultant hybrid spinach seed, wherein said first parent spinach plant comprises the allele as claimed in claim 1.
11. The method of claim 10, wherein the first and/or second parent is a plant of an inbred line.
12. A hybrid spinach plant grown from the seed produced by the method of claim 10.
13. A method for identifying a spinach plant carrying the allele as claimed in claim 1, comprising determining the presence of the LRR domain by determining its genomic nucleotide sequence or a part thereof in the genome of a plant, wherein said sequence has in order of increased preference 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 4.
14. The method of claim 13, wherein the LRR domain is determined by using a primer pair to amplify the LRR domain, wherein the forward primer is a nucleic acid molecule having the sequence of SEQ ID NO: 1.
15. The method of claim 13, wherein the LRR domain is determined by using a primer pair to amplify the LRR domain, wherein the reverse primer is a nucleic acid molecule having the sequence of SEQ ID NO: 2.
16. A primer pair comprising a forward primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 1 and a reverse primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 2.
17. A method for producing a spinach plant showing resistance to Peronospora farinosa f. sp. spinaciae comprising: (a) crossing a plant comprising the allele as claimed in claim 1, with another plant; (b) optionally performing one or more rounds of selfing and/or crossing; (c) selecting after one or more rounds of selfing and/or crossing for a plant that comprises said allele as claimed in claim 1.
18. A method for producing a spinach plant showing resistance to Peronospora farinosa f. sp. spinaciae comprising: (a) crossing a plant comprising an allele designated alpha-WOLF 25 which confers resistance to at least one Peronospora farinosa f. sp. spinaciae race, wherein the protein encoded by said allele is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5, with another plant; (b) optionally performing one or more rounds of selfing and/or crossing; (c) selecting after one or more rounds of selfing and/or crossing for a plant that comprises said allele, wherein the selection of a plant comprising the allele comprises determining the presence of the allele according the method as claimed in claim 13.
Description
DETAILED DESCRIPTION OF THE INVENTION
[0021] A genome assembly for spinach variety Viroflaywhich is susceptible to all known pathogenic races of Peronospora farinosa f. sp. spinaciaeis publicly available (Spinacia oleracea cultivar SynViroflay, whole genome shotgun sequencing project; Bioproject: PRJNA41497; GenBank: AYZV00000000.2; BioSample: SAMN02182572, see also Dohm et al, 2014, Nature 505: 546-549). In this genome assembly for Viroflay, the beta-WOLF gene is located on scaffold12735 (sequence: GenBank: KQ143339.1), at position 213573-221884. The sequence covered by this interval comprises the entire genomic sequence of the beta-WOLF gene of Viroflay, plus 2000 basepairs sequence upstream from the gene, plus the sequence downstream from the gene, up to the locus of the neighbouring gene that is situated downstream from the WOLF gene. Spinach variety Viroflay only possesses a single WOLF gene, namely a beta-WOLF gene, but most other spinach lines harbor a single alpha-type WOLF gene at the same location in the genome. Other spinach lines harbor two WOLF genes at approximately the same location in the genome. In such cases, the two WOLF genes are positioned adjacent to each other. In most spinach lines that harbor two WOLF genes, one of said WOLF genes belongs to the alpha-type, and the other WOLF gene belongs to the beta-type. It was observed that this allelic variation in the WOLF locus is responsible for differences in resistance to pathogenic races of Peronospora farinosa f. sp. spinaciae.
[0022] The difference between an allele of an alpha-WOLF gene and an allele of a beta-WOLF gene lies in the presence of specific conserved amino acid motifs in the encoded protein sequence. As mentioned above, all WOLF proteins possessfrom N- to C-terminusthe following domains that are generally known in the art: a coiled coil domain (RX-CC-like, cd14798), an NBS domain (also referred to as NB-ARC domain, pfam00931; van der Biezen & Jones, 1998, Curr. Biol. 8: R226-R228), and leucine-rich repeats (IPR032675) which encompass the LRR domain. In addition, all WOLF proteins comprise in their amino acid sequence the motif MAEIGYSVC at the N-terminus. In addition to this, all alpha-WOLF proteins comprise the motif KWMCLR in their amino acid sequence, whereas all beta-WOLF proteins comprise the motif HVGCVVDR in their amino acid sequence.
[0023] The present invention relates to a new Peronospora farinosa f. sp. spinaciae resistance conferring allele of the alpha-WOLF gene designated alpha-WOLF 25.
[0024] In particular, the invention relates to a Peronospora farinosa f. sp. spinaciae resistance conferring allele designated alpha-WOLF 25 wherein the protein encoded by said allele is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5. Optionally, the alpha-WOLF 25 allele further comprise an additional motif in their amino acid sequence, namely DQEDEGEDN.
[0025] The invention further relates to a Peronospora farinosa f. sp. spinaciae resistance conferring allele designated alpha-WOLF 25 wherein the protein encoded by said allele is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 5. Optionally, the alpha-WOLF 25 allele further comprise an additional motif in their amino acid sequence, namely DQEDEGEDN
[0026] The invention also relates to an alpha-WOLF 25 allele having an LRR domain which has a genomic sequence that in order in order of increased preference has at least 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 4.
[0027] The invention also relates to an alpha-WOLF 25 allele having an LRR domain which has a genomic sequence that in order of increased preference has at least 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 4.
[0028] For the purpose of this invention, the LRR domain of the protein of the alpha-WOLF 25 allele is defined as the amino acid sequence that in order of increased preference has at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5.
[0029] For the purpose of this invention, the LRR domain of the protein of the alpha-WOLF 25 allele is defined as the amino acid sequence that in order of increased preference has at least 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 5.
[0030] The skilled person is familiar with methods for the calculation of sequence similarity and sequence identity. Sequence similarity for an amino acid sequence is calculated using EMBOSS stretcher 6.6.0 (www.ebi.ac.uk/Tools/psa/emboss_stretcher), using the EBLOSUM62 matrix with settings Gap open: 12 and Gap extend: 2. In case of DNA, sequence similarity is calculated using the DNA full matrix with settings Gap open:16 and Gap extend: 4.
[0031] The LRR domain of the alpha-WOLF 25 allele as defined herein can be determined by amplifying and sequencing the genomic DNA encoding for the amino acid sequence of LRR domain using specific primers, and subsequently translating the DNA sequence into an amino acid sequence, thereby applying common sense in choosing the correct reading frame. The skilled person is capable of doing this, using freely available online bioinformatics tools such as can be found here: http://web.expasy.org/translate/.
[0032] The genomic sequence of a LRR domain of an alpha-WOLF gene such as alpha-WOLF 25 can be amplified using a primer pair having a forward primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 1 and a reverse primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 2.
[0033] The invention also relates to a nucleic acid molecule which confers resistance to at least one Peronospora farinosa f. sp. spinacea race, wherein the protein encoded by said nucleic acid molecule is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5. Optionally this nucleic acid molecule is an isolated nucleic acid molecule.
[0034] The invention also relates to a nucleic acid molecule which confers resistance to at least one Peronospora farinosa f. sp. spinacea race, wherein the protein encoded by said nucleic acid molecule is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 5. Optionally this nucleic acid molecule is an isolated nucleic acid molecule.
[0035] The allele shows a segregation pattern that is consistent with that of a dominant inheritance for the resistance it confers to downy mildew races Pfs8, Pfs15 and Pfs16.
[0036] PCR conditions for amplifying the LRR domain-encoding region of an alpha-WOLF gene using primers having SEQ ID NO: 1 and SEQ ID NO: 2 are, using Platinum Taq enzyme (Thermo Fisher Scientific): 3 minutes at 95 C. (initial denaturing step); 40 amplification cycles, each cycle consisting of: 30 seconds denaturation at 95 C., 30 seconds annealing at 60 C., and 30 seconds extension at 72 C.; 2 minutes at 72 C. (final extension step).
[0037] The LRR domain of a beta-WOLF gene, e.g. the null allele as present in variety Viroflay, can be amplified using a forward primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 3 and a reverse primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 2.
[0038] PCR conditions for amplifying the LRR domain-encoding region of a beta-WOLF gene using primers having SEQ ID NO: 2 and SEQ ID NO: 3 are as follows, using Platinum Taq enzyme (Thermo Fisher Scientific):3 minutes at 95 C. (initial denaturing step); 40 amplification cycles, each cycle consisting of: 30 seconds denaturation at 95 C., 50 seconds annealing at 58 C. and 50 seconds extension at 72 C.; 2 minutes at 72 C. (final extension step).
[0039] Therefore, the invention also relates to a primer pair for amplifying the LRR domain of an alpha-WOLF gene, more in particular for amplifying the LRR domain of an alpha-WOLF 25 allele wherein the forward primer is a nucleic acid molecule having the sequence of SEQ ID NO: 1 and the reverse primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 2. The primers disclosed herein have been specifically designed for selectively amplifying part of a WOLF gene, and not of any other CC-NBS-LRR protein-encoding genes.
[0040] The invention relates to an alpha-WOLF 25 allele which has a coding sequence that in order of increased preference has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 8.
[0041] The invention also relates to an alpha-WOLF 25 allele which has a coding sequence that in order of increased preference has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 8.
[0042] In a further aspect of the invention the alpha-WOLF 25 allele encodes for a protein having an amino acid sequence which in order of increased preference has at least 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 9.
[0043] In a further aspect of the invention the alpha-WOLF 25 allele encodes for a protein having an amino acid sequence which in order of increased preference has at least 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 9.
[0044] The alpha-WOLF 25 allele when present in a spinach plant confers complete resistance to at least one of the 17 officially recognized Peronospora farinosa f. sp. spinacea races. In a further embodiment, the alpha-WOLF 25 allele when present in a spinach plant confers complete resistance to at least two of the 17 officially recognized Peronospora farinosa f. sp. spinacea races. In a further embodiment, the alpha-WOLF 25 allele when present in a spinach plant confers complete resistance in order of increased preference to at least two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen or all of the seventeen officially recognized Peronospora farinosa f. sp. spinacea races.
[0045] The alpha-WOLF 25 allele when heterozygously or homozygously present in a spinach plant confers at least complete resistance to the officially recognized Peronospora farinosa f. sp. spinacea races Pfs:8, Pfs15 and Pfs:16, and does not confer resistance to downy mildew race Pfs:3 (see Table 1).
[0046] The resistance of a spinach plant against one or more races of Peronospora farinosa f. sp. spinaciae can be determined using a seedling test. Herein, a seedling test is defined as a test wherein spinach plants are planted in trays containing growth medium, optionally fertilized twice a week after seedling emergence. Plants were inoculated at the first true leaf stage with a sporangial suspension having a concentration of approximately 2.510.sup.5/ml of one of the pathogenic races of Peronospora farinosa f. sp. spinaciae or isolates to be tested. The inoculated plants are placed in a dew chamber at 18 C. with 100% relative humidity for a 24 h period, and then moved to a growth chamber at 18 C. with a 12 h photoperiod for 6 days. After 6 days, the plants are returned to the dew chamber for 24 h to induce sporulation, and subsequently scored for a disease reaction. Preferably, 30 plants per race are tested.
[0047] As used herein, a plant is completely resistant against a Peronospora farinosa f sp. spinaciae race when a plant shows no symptoms in the seedling test described herein.
[0048] As used herein, a plant is intermediately resistant against a Peronospora farinosa f. sp. spinaciae race when a plant shows only symptoms of chlorosis, or sporulation occurring only on the tips of the cotyledons in the seedling test described herein.
[0049] As used herein, a plant is susceptible to an isolate of a Peronospora farinosa f. sp. spinaciae race when a plant shows more than only symptoms of chlorosis, or when sporulation occurs on area larger than only the tips of the cotyledons in the seedling test described herein.
[0050] Another aspect of the invention relates to a spinach plant, comprising the alpha-WOLF 25 allele of invention, of which a representative sample of seed was deposited with the NCIMB under NCIMB accession number 43495.
[0051] In a further embodiment the plant of the invention which comprises the alpha-WOLF 25 allele is an agronomically elite spinach plant. In the context of this invention an agronomically elite spinach plant is a plant having a genotype that results into an accumulation of distinguishable and desirable agronomic traits which allow a producer to harvest a product of commercial significance, preferably the agronomically elite spinach plant comprising the alpha-WOLF 25 allele is a plant of an inbred line or a hybrid.
[0052] As used herein, a plant of an inbred line is a plant of a population of plants that is the result of three or more rounds of selfing, or backcrossing; or which plant is a double haploid. An inbred line may e.g. be a parent line used for the production of a commercial hybrid.
[0053] As used herein, a hybrid plant is a plant which is the result of a cross between two different plants having different genotypes. More in particular, a hybrid plant is the result of a cross between plants of two different inbred lines, such a hybrid plant may e.g. be a plant of an F.sub.1 hybrid variety.
[0054] A plant carrying the alpha-WOLF 25 allele in heterozygous form may further comprise a beta-WOLF 0 allele as e.g. present in variety Viroflay wherein the beta-WOLF 0 allele does not confer any resistance to downy mildew. However, a plant heterozygous for the alpha-WOLF 25 allele may further comprise an allele of the alpha/beta-WOLF gene that does provide resistance to downy mildew. Preferably, such an allele would complement the alpha-WOLF 25 allele such that the spinach plant will be at least intermediately resistant to one or more other races to which the alpha-WOLF 25 allele does not provide resistance. Most preferably the other allele of the alpha/beta-WOLF gene complements the alpha-WOLF 25 allele such that the plant is resistant to Peronospora farinosa f. sp. spinaciae races Pfs:1 to Pfs:17. In one embodiment such a plant is an agronomically elite plant.
[0055] Alternatively, the resistance profile of a plant carrying the alpha-WOLF 25 allele is complemented by a resistance conferring allele of a totally different gene. Examples of such genes are e.g. DMR1 as described in U.S. Pat. No. 8,354,570, DMR6 as described in U.S. Pat. No. 9,121,029 and p10 as described in US20170327839.
[0056] The invention thus relates to a spinach plant carrying the alpha-WOLF 25 allele and further comprising a genetic determinant resulting in resistance against Peronospora farinosa f sp. spinacea races Pfs:1 to Pfs:17. The genetic determinant can be another resistance conferring alpha/beta-WOLF allele or a resistance conferring allele of a totally different gene.
[0057] The invention further relates to propagation material comprising the alpha-WOLF 25 allele. In one embodiment, the propagation material is suitable for sexual reproduction. Such propagation material comprises for example a microspore, pollen, ovary, ovule, embryo sac and egg cell. In another embodiment, the propagation material is suitable for vegetative reproduction. Such propagation material comprises for example a cutting, root, stem, cell, protoplast, and a tissue culture of regenerable cells. A part of the plant that is suitable for preparing tissue cultures is in particular a leaf, pollen, an embryo, a cotyledon, a hypocotyl, a meristematic cell, a root tip, an anther, a flower, a seed and a stem.
[0058] The invention furthermore relates to a cell of a spinach plant comprising the alpha-WOLF 25 allele. Such a cell may be either in isolated form or may be part of the complete plant or parts thereof and then still constitutes a cell of the invention because such a cell harbors the alpha-WOLF 25 allele that confers resistance to downy mildew. Each cell of a plant of the invention carries the genetic information that confers resistance to Peronospora farinosa f. sp. spinaciae. Such a cell of the invention may also be a regenerable cell that may be used to regenerate a new plant comprising the allele of the invention.
[0059] Yet another aspect of the invention relates to a method for making a hybrid spinach seed comprising crossing a first parent spinach plant with a second parent spinach plant and harvesting the resultant hybrid spinach seed, wherein said first and/or second parent spinach plant comprises the alpha-WOLF 25 allele. In particular embodiment, the first and/or second parent plant is a plant of an inbred line as defined herein.
[0060] The invention further relates to a hybrid spinach plant grown from seed produced by crossing a first parent spinach plant with a second parent spinach plant and harvesting the resultant hybrid spinach seed, wherein said first and/or second parent spinach plant comprises the alpha-WOLF 25 allele.
[0061] Determining the genomic DNA or coding DNA sequence of at least part of a WOLF gene in the genome of a spinach plant may be performed using any suitable molecular biological method known in the art, including but not limited to (genomic) PCR amplification followed by Sanger sequencing, whole-genome-sequencing, transcriptome sequencing, sequence-specific target capture followed by next-generation sequencing (using, for example, the xGen target capture system of Integrated DNA Technologies), specific amplification of LRR-domain-comprising gene sequences (using, for example, the RenSeq methodology, as described in U.S. patent application Ser. No. 14/627,116, and in Jupe et al., 2013, Plant J. 76: 530-544) followed by sequencing, etcetera.
[0062] In one embodiment the invention relates to a method for identifying a plant carrying the alpha-WOLF 25 allele comprises determining the DNA sequence coding for the LRR domain as defined herein.
[0063] In a further embodiment of the method the LRR domain of the alpha-WOLF 25 allele is determined by using a primer pair to amplify the genomic DNA region of the LRR domain. The forward primer is preferably a nucleic acid molecule having the sequence of SEQ ID NO: 1 and the reverse primer is preferably a nucleic acid molecule having the sequence of SEQ ID NO: 2.
[0064] Another aspect of the invention relates to a method for producing a spinach plant comprising resistance to Peronospora farinosa f. sp. spinaciae comprising: (a) crossing a plant comprising the alpha-WOLF 25 allele, with another plant; (b) optionally performing one or more rounds of selfing and/or crossing; (c) optionally selecting after each round of selfing or crossing for a plant that comprises the alpha-WOLF 25 allele.
[0065] Selecting a plant comprising the alpha-WOLF 25 allele can be done genotypically by determining the presence of the genomic DNA sequence of the NBS-LRR domain of the allele having in order of increased preference 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 4, or 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID NO: 4.
[0066] In another embodiment, selecting a plant comprising the alpha-WOLF 25 allele can be done genotypically by determining the presence the coding sequence of the entire allele.
[0067] Alternatively, the presence of the alpha-WOLF 25 allele can be determined phenotypically by assaying a plant in a disease test, for example the test as described herein.
[0068] The invention further relates to the use of a spinach plant carrying the alpha-WOLF 25 allele in breeding to confer resistance against Peronospora farinosa f. sp. spinaciae.
[0069] The invention also relates to a breeding method for the development of spinach plants carrying the alpha-WOLF 25 allele of the invention wherein germplasm which comprises said allele is used. Seed capable of growing into a plant comprising the allele of the invention and being representative for the germplasm was deposited with the NCIMB under deposit number NCIMB 43495.
[0070] In another aspect, the invention relates to a method for the production of a spinach plant which comprises alpha-WOLF 25 allele, which method comprises: (a) crossing a plant comprising the allele with another plant; (b) optionally selecting for plants comprising said allele in the F1; (c) optionally backcrossing the resulting F1 with the preferred parent and selecting for plants that have the said allele in the BC1F1; (d) optionally performing one or more additional rounds of selfing, crossing, and/or backcrossing, and subsequently selecting for a plant which comprises the said allele or shows the resistance profile corresponding to said allele. The invention also encompasses a spinach plant produced by this method.
[0071] The invention also relates to a harvested leaf of a spinach plant of the invention, to a food product which comprises a harvested leaf of a spinach plant of the invention, either in natural or in processed form.
[0072] Spinach leaves are sold in packaged form, including without limitation as pre-packaged spinach leaves or as processed in a salad comprising said leaves. Mention of such a package is e.g. made in U.S. Pat. No. 5,523,136, which provides packaging film, and packages from such packaging film, including such packaging containing leafy produce, and methods for making and using such packaging film and packages, which are suitable for use with the spinach leaves of the invention. Thus, the invention comprehends the use of and methods for making and using the leaves of the spinach plant of the invention, as well as leaves of spinach plants derived from the invention.
[0073] The invention further relates to a container which comprises one or more plants of the invention, or one or more spinach plants derived from a plant of the invention, in a growth substrate for harvest of leaves from the plant, in a domestic environment. This way the consumer may pick very fresh leaves for use in salads, when the plant is in a ready-to-harvest condition.
[0074] The invention also relates to the use of a spinach plant, of which representative seed was deposited with the NCIMB under accession number NCIMB 43495, in the production of a spinach plant comprising the alpha-WOLF 25 allele.
[0075] In a further embodiment the said spinach plant is a hybrid, doubled haploid, or inbred spinach plant.
[0076] Another aspect of the invention is the use of a cell comprising the alpha-WOLF 25 allele for the production of a spinach plant showing resistance to Peronospora farinosa f. sp. spinaciae.
[0077] The invention also relates to the use of a tissue culture comprising the alpha-WOLF 25 allele for the production of a spinach plant showing resistance to Peronospora farinosa f. sp. spinaciae.
TABLE-US-00001 TABLE 1 Resistance profile conferred by the Alpha-WOLF 25 allele. Alpha-WOLF 25 resistance profile Peronospora farinosa f. Resistance sp. spinaciae race score Pfs:1 nt Pfs:2 nt Pfs:3 + Pfs:4 nt Pfs:5 nt Pfs:6 nt Pfs:7 nt Pfs:8 Pfs:9 nt Pfs:10 nt Pfs:11 nt Pfs:12 nt Pfs:13 nt Pfs:14 nt Pfs:15 Pfs:16 A means complete resistance against a particular downy mildew race; () means intermediate resistance against a particular downy mildew race; + means that the allele confers no resistance and would cause a plant only carrying the Alpha-WOLF 25 allele to be fully susceptible for that particular downy mildew race; nt means that it has not been tested against that isolate.
TABLE-US-00002 TABLE2 Sequenceinformation. SEQIDNO:1: ACAAGTGGATGTGTCTTAGG Forwardprimer LRRdomain(Alpha) SEQIDNO:2: TTCGCCCTCATCTTCCTGG Reverseprimer LRRdomain(Alpha) SEQIDNO:3: TCACGTGGGTTGTGTTGT Forwardprimer LRRdomain(Beta) SEQIDNO:4: ACAAGTGGATGTGTCTTAGGATGTTGGACTTGTCAAATTCAG Ampliconof ATGTTAAAAGTTTGCCTAATTCAATAGGTAAGTTGTTGCACT LRRdomainof TACGGTATCTTAACCTGTCAAATAATAGAAATCTAAAGATAC thealpha- TTCCTGATGCAATTACAAGACTGCATAACTTGCAGACACTAC WOLF25allele TTTTAGAAGATTGCAGAAGTTTAAAGGAGTTGCCAAAAGAT TTTTGCAAATTGGTCAAACTGAGGCACTTGGATTTAAGGTTT TGTTCTGATTTGATTGGTATGCCATTGGGAATGGATAGGCTA ACTAGTCTTAGAGTACTGCCATTCTTTGTGGTGGGTAGGAAG GAACAAAGTGTTGATGATGAGCTGAAAGCCCTAAAAGGCCT CACCGAGATAAAAGGCTCCATTCGTATTAGAATCCATTCAA AGTATAGAATAGTTGAAGGCATGAATGACACAGGAGGAGCT GGGTATTTGAAGAGCATGAAACATCTCACGAGGGTTATTATT AGATTTGATGATAAAGAAGGTGGATGTGTTAACCCTGAAGC TGTGTTGGCAACCCTAGAGCCACCTTCAAATATCAAGAGCTT ATCTATAGATAATTACGATGGTACAACAATTCCAGTATGGG GAAGAGCAGAGATTAATTGGGCAATCTCCCTCTCACATCTTG TCGACATCCAGCTTTGGTGTTGTAGTAATTTGCAGGAGATGC CAGTGCTGAGTAAACTGCCTCATTTGAAATCACTGTATCTTT TTAAGTTTTGTAAGTTAGAGTACATGGAGAGTAGAAGCAGC AGCAGTAGCAGTGACACAGAAGCAGCAACACCAGAATTACC AACATTCTTCCCTTCCCTTGAAAAACTTACACTTTGGTATCTG GAAAAGTTGAAGGGTTTTGGGAACAGGAGACCGAGTAGTTT TCCCCGCCTCTCTAAATTGGAAATCTGGGAATGCCCAGATCT AACGTGGTTTCCTCCTTGTCCAAGCCTTAAAACGTTGAAATT GGAAAAAAACAATGAAGCGTTGCAAATAATAGTAAAAATA ACAACAACAAGAGGTAAAGAAGAAAAAGAAGAAGACAAGA ATGCTGGTGTTGGAAATTCACAAGATGATGACAATGTCAAA TTACGGAAGGTGGAAATAGACAATGTGAGTTATCTCAAATC ACTGCCCACAAATTGTCTTACTCACCTCAAAATAACTGGAAT AGATTACAGGGAGGGGGAGATTGAATCAGATTCCGTGGAGG AGGAGATTGAATTGGAAGTTGGGGAGGCATTTCAGAAGTGT GCATCTTCTTTGAGAAGCCTCATCATAATCGGAAATCACGGA ATAAATAAAGTGATGAGACTGTCTGGAAGAACAGGGTTGGA GCATTTCACTCTGTTGGACTCACTCAAACTTTCAAATATAGA AGACCAGGAAGATGAGGGCGAA SEQIDNO:5: KWMCLRMLDLSNSDVKSLPNSIGKLLHLRYLNLSNNRNLKILP aminoacid DAITRLHNLQTLLLEDCRSLKELPKDFCKLVKLRHLDLRFCSDL sequence IGMPLGMDRLTSLRVLPFFVVGRKEQSVDDELKALKGLTEIKG encodedby SIRIRTHSKYRIVEGMNDTGGAGYLKSMKHLTRVIIRFDDKEGG ampliconof CVNPEAVLATLEPPSNIKSLSIDNYDGTTIPVWGRAEINWAISLS LRRdomainof HLVDIQLWCCSNLQEMPVLSKLPHLKSLYLFKFCKLEYMESRS alpha-WOLF25 SSSSSDTEAATPELPTFFPSLEKLTLWYLEKLKGFGNRRPSSFPR LSKLEIWECPDLTWFPPCPSLKTLKLEKNNEALQIIVKITTTRGK EEKEEDKNAGVGNSQDDDNVKLRKVEIDNVSYLKSLPTNCLT HLKITGIDYREGEIESDSVEEEIELEVGEAFQKCASSLRSLIIIGNH GINKVIVIRLSGRTGLEHFTLLDSLKLSNIEDQEDEGE SEQIDNO:6: TCACGTGGGTTGTGTTGTCGATAGAGATCCAGAAATAGTCTT Ampliconof TTTATGTAGCAATAAGATTCGTTCGTATATTAGCGGTCGCTG LRRdomainof CATAAAGAATCCGGTGGATTCACAAATAGACAACTGGATGT thebeta-WOLF GCCTTAGGGTGTTGGACTTGTCAGATTCATGTGTTAAAGATT 0allele TGTCTGATTCAATAGGTAAGCTGCTGCACTTAAGGTATCTTA ACCTCTCTTCTAATATAAAGTTGGAGATAATCCCTGATGCAA TTACAAGACTGCATAACTTGCAGACACTACTTTTAGAAGATT GCAGAAGTTTAAAGGAGTTGCCAAAAGATTTTTGCAAATTG GTCAAACTGAGGCACTTGGAATTACAGGGTTGTCATGATTTG ATTGGTATGTCATTTGGAATGGATAAGCTAACTAGTCTTAGA ATACTACCAAACATTGTGGTGGGTAGGAAGGAACAAAGTGT TGATGATGAGCTGAAAGCCCTAAAAGGCCTCACCGAGATAA AAGGCTCCATTGATATCACAATCTATTCAAAATATAGAAGA GTTGAAGGCATGAATGGCACAGGAGGAGGAGCTGGGTATTT GAAGAGCATGAAACATCTCACGGGGGTTAATATTACATTTG ATGAAGGTGGATGTGTTAACCCTGAAGCTGTGTATTTGAAG AGCATGAAACATCTCACGAGGGTTATTATTATATTTGATTAT AAAGGTGGATGTGTTAACCCTGAAGCTGTGTTGGCAACCCT AGAGCCACCTTCAAATATCAAGAGGTTAGAGATGTGGCATT ACAGTGGTACAACAATTCCAGTATGGGGAAGAGCAGAGATT AATTGGGCAATCTCCCTCTCACATCTTGTCGACATCACGCTT GAAGATTGTTACAATTTGCAGGAGATGCCAGTGCTGAGTAA ACTGCCTCATTTGAAATCACTGGAACTTACAGAGTTGGATAA CTTAGAGTACATGGAGAGTAGAAGCAGCAGCAGTAGCAGTG ACACAGAAGCAGCAACACCAGAATTACCAACATTCTTCCCT TCCCTTGAAAAACTTACACTTTGGCGTCTGGACAAGTTGAAG GGTTTTGGGAACAGGAGATCGAGTAGTTTTCCCCGCCTCTCT AAATTGGAAATCTGGAAATGTCCAGATCTAACGTCATTTCCT TCTTGTCCAAGCCTTGAAGAGTTGGAATTGAAAGAAAACAA TGAAGCGTTGCAAATAATAGTAAAAATAACAACAACAAGAG GTAAAGAAGAAAAAGAAGAAGACAAGAATGCTGGTGTTGG AAATTCACAAGATGATGACAATGTCAAATTATGGAAGGTGG AAATAGACAATCTGGGTTATCTCAAATCACTGCCCACAAATT GTCTGACTCACCTCGACCTTACAATAAGTGATTCCAAGGAGG GGGAGGGTGAATGGGAAGTTGGGGATGCATTTCAGAAGTGT GTATCTTCTTTGAGAAGCCTCACCATAATCGGAAATCACGGA ATAAATAAAGTGAAGAGACTGTCTGGAAGAACAGGGTTGGA GCATTTCACTCTGTTGGAATCACTCAAACTTTCAGATATAGA AGACCAGGAAGATGAGGGCGAA SEQIDNO:7: HVGCVVDRDPEIVFLCSNKIRSYISGRCIKNPVDSQIDNWMCLR aminoacid VLDLSDSCVKDLSDSIGKLLHLRYLNLSSNIKLEIIPDAITRLHNL sequence QTLLLEDCRSLKELPKDFCKLVKLRHLELQGCHDLIGMSFGMD encodedby KLTSLRILPNIVVGRKEQSVDDELKALKGLTEIKGSIDITIYSKYR ampliconof RVEGMNGTGGGAGYLKSMKHLTGVNITFDEGGCVNPEAVYL LRRdomain KSMKHLTRVIIIFDYKGGCVNPEAVLATLEPPSNIKRLEMWHYS BetaWolf0 GTTIPVWGRAEINWAISLSHLVDITLEDCYNLQEMPVLSKLPHL (Viroflay) KSLELTELDNLEYMESRSSSSSSDTEAATPELPTFFPSLEKLTLW RLDKLKGFGNRRSSSFPRLSKLEIWKCPDLTSFPSCPSLEELELK ENNEALQIIVKITTTRGKEEKEEDKNAGVGNSQDDDNVKLWK VEIDNLGYLKSLPTNCLTHLDLTISDSKEGEGEWEVGDAFQKC VSSLRSLTIIGNHGINKVKRLSGRTGLEHFTLLESLKLSDIEDQE DEGE SEQIDNO:8: ATGGCCGAAATCGGATACTCGGTTTGTGCGAAACTCATCGA codingsequence AGTGATTGGCAGTGAGCTGATCAAAGAGATTTGTGACACAT ofthealpha- GGGGTTACAAATCTCTTCTTGAGGACCTCAACAAAACTGTAT WOLF25allele TGACGGTCAGGAACGTTCTCATTCAAGCCGGGGTGATGCGG GAGCTTACTAGTGAACAACAAGGTTTCATTGCAGACCTTAA AGATGTTGTTTATGATGCTGATGACTTGTTCGACAAGTTACT CACTCGTGCTGAGCGAAAACAGATTGATGGAAACGAAATCT CTGAAAAGGTACGTCGTTTCTTTTCCTCTAGTAACAAGATCG GTCAAGCTTACTACATGTCTCGTAAGGTTAAGGAAATTAAG AAGCAGTTGGATGAAATTGTTGATAGGCATACAAAATTTGG GTTTAGTGCTGAGTTTATACCTGTTTGTAGGGAAAGGGGGAA CGAGAGGGAAACACGTTCATATATAGATGTCAAGAATATTC TTGGGAGGGATAAAGATAAGAATGATATCATTGATAGGTTG CTTAATCGTAATGGTAATGAAGCTTGTAGTTTCCTGACCATA GTGGGAGCGGGAGGATTGGGAAAAACTGCTCTTGCACAACT TGTGTTCAATGATGAAAGGGTCAAAATTGAGTTTCATGATTT GAGGTATTGGGTTTGTGTCTCTGATCAAGATGGGGGCCAATT TGATGTGAAAGAAATCCTTTGTAAGATTTTAGAGGTGGTTAC TAAGGAGAAAGTTGATAATAGTTCCACATTGGAATTGGTGC AAAGCCAATTTCAAGAGAAGTTAAGAGGAAAGAAGTACTTC CTTGTTCTCGATGATGTATGGAACGAGGGTCGTGAGAAGTG GCTTCATTTGGAAGAGTTGTTAATGTTGGGTCAAGGGGGAA GCAAGGTTGTAGTGACCGCACGTTCAGAGAAGACAGCAAAT GTCATAGGGAAAAGACATTTTTATACACTGGAATGTTTGTCG CCAGATTATTCATGGAGCTTATTTGAAATGTCGGCTTTTCAG AAAGGGCATGAGCAGGAAAACCATGACGAACTAGTTGATAT TGGGAAAAAGATTGTTGAAAAATGTTATAACAATCCACTTG CTATAACGGTGGTAGGAAGTCTTCTTTATGGAGAGGAGATA AATAAGTGGCGGTCATTTGAAATGAGTGAGTTGGCCAAAAT TGGCAATGGGGATAATAAGATTTTGTCGATATTGAAGCTCA GTTACTACAATCTTGCAAACTCTTTGAAGAGTTGTTTTAGTT ATTGTGCAGTATTTCCCAAGGATCATAAAATAGAGAAGGAG ATGTTGATTGACCTTTGGATAGCACAAGGATATGTTGTGCCG TTGGATGGAGGTCAAAGTATAGAAGATGCTGCCGAGGAACA TTTTGTAATTTTGTTACGAAGGTGTTTCTTTCAAGATGTAGTG AAGGATGAATACGGTGATGTTGATTCTGTTAAAATCCACGA CTTGATGCACGATGTCGCCCAAGAAGTGGGCAGAGAGGAAA TCTGTATAGTGAATGATAATACAAAGAACTTGGGTGATAAA ATCCGTCATGTACATCGTGATGTCATTAGATATGCACAAAGA GTCTCTCTGTGTAGCCATAAGATTCGTTCGTATATTGGTGGT AAATGTGAAAAACGTTGGGTGGATACACTAATAGACAAGTG GATGTGTCTTAGGATGTTGGACTTGTCAAATTCAGATGTTAA AAGTTTGCCTAATTCAATAGGTAAGTTGTTGCACTTACGGTA TCTTAACCTGTCAAATAATAGAAATCTAAAGATACTTCCTGA TGCAATTACAAGACTGCATAACTTGCAGACACTACTTTTAGA AGATTGCAGAAGTTTAAAGGAGTTGCCAAAAGATTTTTGCA AATTGGTCAAACTGAGGCACTTGGATTTAAGGTTTTGTTCTG ATTTGATTGGTATGCCATTGGGAATGGATAGGCTAACTAGTC TTAGAGTACTGCCATTCTTTGTGGTGGGTAGGAAGGAACAA AGTGTTGATGATGAGCTGAAAGCCCTAAAAGGCCTCACCGA GATAAAAGGCTCCATTCGTATTAGAATCCATTCAAAGTATAG AATAGTTGAAGGCATGAATGACACAGGAGGAGCTGGGTATT TGAAGAGCATGAAACATCTCACGAGGGTTATTATTAGATTTG ATGATAAAGAAGGTGGATGTGTTAACCCTGAAGCTGTGTTG GCAACCCTAGAGCCACCTTCAAATATCAAGAGCTTATCTATA GATAATTACGATGGTACAACAATTCCAGTATGGGGAAGAGC AGAGATTAATTGGGCAATCTCCCTCTCACATCTTGTCGACAT CCAGCTTTGGTGTTGTAGTAATTTGCAGGAGATGCCAGTGCT GAGTAAACTGCCTCATTTGAAATCACTGTATCTTTTTAAGTT TTGTAAGTTAGAGTACATGGAGAGTAGAAGCAGCAGCAGTA GCAGTGACACAGAAGCAGCAACACCAGAATTACCAACATTC TTCCCTTCCCTTGAAAAACTTACACTTTGGTATCTGGAAAAG TTGAAGGGTTTTGGGAACAGGAGACCGAGTAGTTTTCCCCG CCTCTCTAAATTGGAAATCTGGGAATGCCCAGATCTAACGTG GTTTCCTCCTTGTCCAAGCCTTAAAACGTTGAAATTGGAAAA AAACAATGAAGCGTTGCAAATAATAGTAAAAATAACAACAA CAAGAGGTAAAGAAGAAAAAGAAGAAGACAAGAATGCTGG TGTTGGAAATTCACAAGATGATGACAATGTCAAATTACGGA AGGTGGAAATAGACAATGTGAGTTATCTCAAATCACTGCCC ACAAATTGTCTTACTCACCTCAAAATAACTGGAATAGATTAC AGGGAGGGGGAGATTGAATCAGATTCCGTGGAGGAGGAGA TTGAATTGGAAGTTGGGGAGGCATTTCAGAAGTGTGCATCTT CTTTGAGAAGCCTCATCATAATCGGAAATCACGGAATAAAT AAAGTGATGAGACTGTCTGGAAGAACAGGGTTGGAGCATTT CACTCTGTTGGACTCACTCAAACTTTCAAATATAGAAGACCA GGAAGATGAGGGCGAAGACAACATCATATTCTGGAAATCCT TTCCTCAAAACCTCCGCAGTTTGGAAATTGAAAACTCTTACA AAATGACAAGTTTGCCCATGGGGATGCAGTACTTAACCTCCC TCCAAACCCTCTATCTACACCATTTTTATGAATTGAATTCCCT TCCAGAATGGATAAGCAGCTTATCATCTCTTCAATACCTGCG CATATACTACTGTCCAGCCCTGAAATCACTACCAGAAGCAAT GCGGAACCTCACCTCCCTTCAGACACTTGGGATATCGGATTG TCCAGACCTAGTTAAAAGATGCAGAAAACCCAACGGCAAGG ACTATCCCAAAATTCAACACATCCCCAAAATTGACATGGATT GA SEQIDNO:9: MAEIGYSVCAKLIEVIGSELIKEICDTWGYKSLLEDLNKTVLTV aminoacid RNVLIQAGVMRELTSEQQGFIADLKDVVYDADDLFDKLLTRAE sequenceofthe RKQIDGNEISEKVRRFFSSSNKIGQAYYMSRKVKEIKKQLDEIV alpha-WOLF25 DRHTKFGFSAEFIPVCRERGNERETRSYIDVKNILGRDKDKNDII allele DRLLNRNGNEACSFLTIVGAGGLGKTALAQLVFNDERVKIEFH DLRYWVCVSDQDGGQFDVKEILCKILEVVTKEKVDNSSTLELV QSQFQEKLRGKKYFLVLDDVWNEGREKWLHLEELLMLGQGG SKVVVTARSEKTANVIGKRHFYTLECLSPDYSWSLFEMSAFQK GHEQENHDELVDIGKKIVEKCYNNPLAITVVGSLLYGEEINKW RSFEMSELAKIGNGDNKILSILKLSYYNLANSLKSCFSYCAVFPK DHKIEKEMLIDLWIAQGYVVPLDGGQSIEDAAEEHFVILLRRCF FQDVVKDEYGDVDSVKIHDLMHDVAQEVGREEICIVNDNTKN LGDKIRHVHRDVIRYAQRVSLCSHKIRSYIGGKCEKRWVDTLID KWMCLRMLDLSNSDVKSLPNSIGKLLHLRYLNLSNNRNLKILP DAITRLHNLQTLLLEDCRSLKELPKDFCKLVKLRHLDLRFCSDL IGMPLGMDRLTSLRVLPFFVVGRKEQSVDDELKALKGLTEIKG SIRIRIHSKYRIVEGMNDTGGAGYLKSMKHLTRVIIRFDDKEGG CVNPEAVLATLEPPSNIKSLSIDNYDGTTIPVWGRAEINWAISLS HLVDIQLWCCSNLQEMPVLSKLPHLKSLYLFKFCKLEYMESRS SSSSSDTEAATPELPTFFPSLEKLTLWYLEKLKGFGNRRPSSFPR LSKLEIWECPDLTWFPPCPSLKTLKLEKNNEALQIIVKITTTRGK EEKEEDKNAGVGNSQDDDNVKLRKVEIDNVSYLKSLPTNCLT HLKITGIDYREGEIESDSVEEEIELEVGEAFQKCASSLRSLIIIGNH GINKVMRLSGRTGLEHFTLLDSLKLSNIEDQEDEGEDNIIFWKSF PQNLRSLEIENSYKMTSLPMGMQYLTSLQTLYLHHFYELNSLPE WISSLSSLQYLRIYYCPALKSLPEAMRNLTSLQTLGISDCPDLVK RCRKPNGKDYPKIQHIPKIDMD
[0078] Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.
[0079] The present invention will be further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.
EXAMPLES
Example 1: Testing for Resistance to Peronospora farinosa f. Sp. Spinaciae in Spinach Plants
[0080] The resistance to downy mildew infection was assayed as described by Irish et al. (2008; Phytopathol. 98: 894-900), using a differential set. Spinach plants of the invention were sown along with spinach plants from different other genotypes (see Table 3) in trays containing Scotts Redi-Earth medium, and fertilized twice a week after seedling emergence with Osmocote Peter's (13-13-13) fertilizer (Scotts). Plants were inoculated with a sporangial suspension (2.510.sup.5/ml) of a pathogenic race of Peronospora farinosa f. sp. spinaciae at the first true leaf stage. In this manner, 4 officially recognized pathogenic race were tested.
[0081] The inoculated plants were placed in a dew chamber at 18 C. with 100% relative humidity for a 24 h period, and then moved to a growth chamber at 18 C. with a 12 h photoperiod for 6 days. After 6 days, the plants were returned to the dew chamber for 24 h to induce sporulation, and they were scored for disease reaction.
[0082] Plants for this specific test were scored as resistant, intermediately resistant, or susceptible based on symptoms of chlorosis and signs of pathogen sporulation on the cotyledons and true leaves, as described by Irish et al. (2007; Plant Dis. 91: 1392-1396). Plants exhibiting no evidence of chlorosis and sporulation were in this specific test considered as resistant. Resistant plants were re-inoculated to assess whether plants initially scored as resistant had escaped infection, or whether they were truly resistant. Plants that showed only symptoms of chlorosis, or sporulation occurring only on the tips of the cotyledons were scored as intermediately resistant. Plants showing more than these symptoms of downy mildew infection were scored as being susceptible.
[0083] Table 1 shows the resistance of a plant carrying the alpha-WOLF 25 allele to each one of these pathogenic races. Table 3 shows the differential set of spinach downy mildew races and the resistance of various spinach varieties (hybrids) to each one of these pathogenic races. A susceptible reaction is scored as + (indicating a successful infection by the fungus, with sporulation occurring on the entire cotyledon), and resistance is depicted as (absence of sporulation on the cotyledons). A weak resistance response is indicated as (), which in practice means a slightly reduced level of infection (with only symptoms of chlorosis, or sporulation only occurring on the tips of the cotyledons in the differential seedling test).
TABLE-US-00003 TABLE 3 Races/ plants Viroflay Resistoflay Califlay Clermont Campania Boeing Lion Lazio Whale Polka Pigeon Meerkat Pfs:1 + Pfs:2 + + Pfs:3 + + Pfs:4 + + + () + Pfs:5 + + + Pfs:6 + + + + + () + Pfs:7 + + + + () + Pfs:8 + + + + + Pfs:9 + + + + Pfs:10 + + + + + + + + + Pfs:11 + + + + Pfs:12 + + + + + + Pfs:13 + + + + () + + () Pfs:14 + + + + + + () + Pfs:15 + + + + + Pfs:16 + + + + + +
Example 2: Amplification of the LRR Domain-Encoding Region
[0084] The isolated genomic DNA of a spinach plant comprising the alpha-WOLF 25 allele, of which a representative sample of seed was deposited with the NCIMB under NCIMB accession number 43495 was used in polymerase chain reactions (PCR), using forward primer ACAAGTGGATGTGTCTTAGG (SEQ ID NO: 1) and reverse primer TTCGCCCTCATCTTCCTGG (SEQ ID NO: 2). The primer pair amplifies the LRR domain-encoding region of an alpha-WOLF gene, and has been designed for selectively amplifying part of a WOLF gene, and not of other CC-NBS-LRR protein-encoding genes.
[0085] PCR conditions for amplifying the LRR domain-encoding region of an alpha-WOLF gene using primers having SEQ ID NO: 1 and SEQ ID NO: 2 were as follows, using Platinum Taq enzyme (Thermo Fisher Scientific): [0086] 3 minutes at 95 C. (initial denaturing step) [0087] 40 amplification cycles, each cycle consisting of: 30 seconds denaturation at 95 C., 30 seconds annealing at 60 C., and 30 seconds extension at 72 C. [0088] 2 minutes at 72 C. (final extension step)
[0089] The isolated genomic DNA of a spinach plant of variety Viroflay comprising the beta-WOLF 0 allele was used in polymerase chain reactions (PCR), using forward primer TCACGTGGGTTGTGTTGT (SEQ ID NO: 3) and reverse primer TTCGCCCTCATCTTCCTGG (SEQ ID NO: 2). The primer pair amplifies the LRR domain-encoding region of a beta-WOLF gene, and has been designed for selectively amplifying part of a WOLF gene, and not of other CC-NBS-LRR protein-encoding genes.
[0090] PCR conditions for amplifying the LRR domain-encoding region of a beta-WOLF gene using primers having SEQ ID NO: 2 and SEQ ID NO: 3 were as follows, using Platinum Taq enzyme (Thermo Fisher Scientific): [0091] 3 minutes at 95 C. (initial denaturing step) [0092] 40 amplification cycles, each cycle consisting of: 30 seconds denaturation at 95 C., 50 seconds annealing at 58 C. and 50 seconds extension at 72 C. [0093] 2 minutes at 72 C. (final extension step)
[0094] The PCR products were visualized on agarose gel (not shown), and DNA was purified from the PCR reaction. Subsequently the sequence of the PCR products was determined using methods well known in the art.
[0095] The sequence of the LRR domain of the alpha-WOLF 25 allele amplified by primers having SEQ ID NO: 1 and SEQ ID NO: 2 is provided in Table 2 under SEQ ID NO: 4.
[0096] The sequence of the LRR domain of the beta-WOLF 0 allele amplified by primers having SEQ ID NO: 2 and SEQ ID NO: 3 is provided in Table 2 under SEQ ID NO: 6.
[0097] Finally, the obtained sequences were translated into the corresponding amino acid sequence of the LRR domain having SEQ ID NO: 5 and SEQ ID NO: 7 for the alpha-WOLF 25 allele and the beta-WOLF 0, respectively (See also Table 2).
[0098] If PCR products were to be sequenced using SMRT sequencing (Pacific Biosciences), PCR primers and PCR conditions were different.
[0099] To the above-mentioned forward primers the following standard amplification sequence was added: GCAGTCGAACATGTAGCTGACTCAGGTCAC.
[0100] To the reverse primer, the following standard amplification sequence was added: TGGATCACTTGTGCAAGCATCACATCGTAG.
Example 3: Introducing Alpha-WOLF 25 Allele in a Plant not Carrying the Allele
[0101] A spinach plant comprising the alpha-WOLF 25 allele, of which a representative sample of seed was deposited with the NCIMB under NCIMB accession number 43495 was crossed with a plant of variety Viroflay carrying the beta-WOLF 0 allele to obtain a F1 generation. Subsequently, a F1 plant was selfed to obtain a F2 population.
[0102] Plants of the F2 population were assayed as described in Example 1 for resistance to Peronospora farinosa f. sp. spinaciae Pfs:16. Approximately 75% of the plants scored completely resistant in the assay. This segregation pattern is consistent with that of a dominant inheritance.
[0103] Genomic DNA of each plant of the same F2 population was isolated and used in two different polymerase chain reactions (PCR). The first PCR reaction was done using primers for amplifying the LRR domain of an alpha-WOLF allele and the second PCR reaction was done using primers for amplifying the LRR domain of a beta-WOLF allele, both as described in Example 2.
[0104] The PCR products were visualized on agarose gel (not shown), this demonstrated that approximately 75% of the plants contained an alpha-WOLF fragment, and that the remaining approximately 25% of the plants only contained a beta-WOLF fragment. The plants containing the alpha-WOLF fragment completely correlated with the plants that scored resistant for Pfs:16. The plants only comprising the beta-WOLF fragment completely correlated with the plants that scored susceptible for Pfs:16.
[0105] DNA from the PCR reaction was purified, and subsequently the sequence of the PCR products was determined. The alpha-WOLF PCR products gave a sequence that corresponded to the sequence of SEQ ID NO: 4, the genomic sequence of the LRR domain of the alpha-WOLF 25 allele. The beta-WOLF PCR products gave a sequence that corresponded to the sequence of SEQ ID NO: 6 the genomic sequence of the LRR domain of the beta-WOLF 0 allele.
[0106] The invention is further described by the following numbered paragraphs: [0107] 1. An allele designated alpha-WOLF 25 which confers resistance to at least one Peronospora farinosa f. sp. spinacea race, wherein the protein encoded by said allele is a CC-NBS-LRR protein that comprises in its amino acid sequence: a) the motif MAEIGYSVC at its N-terminus; and b) the motif KWMCLR; and wherein the LRR domain of the protein has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 5. [0108] 2. The allele of paragraph 1 wherein the genomic DNA sequence of the LRR domain in order of increased preference has at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 4. [0109] 3. The allele of paragraph 1, wherein the allele when present in a spinach plant confers complete resistance to at least Peronospora farinosa f. sp. spinacea race Pfs:8, Pfs15 and Pfs:16, and does not confer resistance to Pfs:3. [0110] 4. A spinach plant comprising the allele of any of the paragraphs 1 to 3, of which a representative sample of seed capable of growing into a plant comprising said allele was deposited with the NCIMB under NCIMB accession number 43495. [0111] 5 The spinach plant of paragraph 4, wherein the plant is an agronomically elite plant. [0112] 6. The spinach plant of paragraph 5, wherein the agronomically elite plant is a hybrid variety or an inbred line. [0113] 7. The spinach plant of paragraph 6, further comprising a genetic determinant resulting in resistance against Peronospora farinosa f. sp. spinacea races Pfs:1 to Pfs:16. [0114] 8. Propagation material capable of developing into and/or being derived from a spinach plant as defined in any of the paragraphs 4 to 7, wherein the propagation material comprises the allele of any of the paragraphs 1 to 3 and wherein the propagation material is selected from a group consisting of a microspore, a pollen, an ovary, an ovule, an embryo, an embryo sac, an egg cell, a cutting, a root, a root tip, a hypocotyl, a cotyledon, a stem, a leaf, a flower, an anther, a seed, a meristematic cell, a protoplast, a cell, or a tissue culture thereof. [0115] 9. Cell of a spinach plant, which cell comprises the allele of any of the paragraphs 1 to 3. [0116] 10. A method of producing a hybrid spinach seed comprising crossing a first parent spinach plant with a second parent spinach plant and harvesting the resultant hybrid spinach seed, wherein said first parent spinach plant comprises the allele of any of the paragraphs 1 to 3. [0117] 11. The method of paragraph 10, wherein the first and/or second parent is a plant of an inbred line. [0118] 12. A hybrid spinach plant grown from the seed produced by the method of paragraph 10 or paragraph 11. [0119] 13. Method for identifying a spinach plant carrying the allele of paragraphs any of the paragraphs 1 to 3, comprising determining the presence of the LRR domain as defined in paragraph 1 by determining its genomic nucleotide sequence or a part thereof in the genome of a plant, wherein said sequence has in order of increased preference 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID NO: 4. [0120] 14. The method of paragraph 13, wherein the LRR domain is determined by using a primer pair to amplify the LRR domain, wherein the forward primer is a nucleic acid molecule having the sequence of SEQ ID NO: 1. [0121] 15. The method of paragraph 13, wherein the LRR domain is determined by using a primer pair to amplify the LRR domain, wherein the reverse primer is a nucleic acid molecule having the sequence of SEQ ID NO: 2. [0122] 16. Primer pair comprising a forward primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 1 and a reverse primer which is a nucleic acid molecule having the sequence of SEQ ID NO: 2. [0123] 17. A method for producing a spinach plant showing resistance to Peronospora farinosa f. sp. spinaciae comprising: (a) crossing a plant comprising the allele of paragraphs 1 or 2, with another plant; (b) optionally performing one or more rounds of selfing and/or crossing; (c) selecting after one or more rounds of selfing and/or crossing for a plant that comprises said allele of any of the paragraphs 1 to 3. [0124] 18. The method of paragraph 16, wherein the selection of a plant comprising the allele comprises determining the presence of the allele according the method of anyone of the paragraphs 13 to 15.
[0125] Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the above paragraphs is not to be limited to particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope of the present invention.