Mtu Delta-I-CM Intein Variant and the Use Thereof

20200199183 ยท 2020-06-25

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure describes a Mtu I-CM intein variant containing one or more mutations or a biologically active fragment thereof, and a method for producing and purifying a molecule of interest using the intein variant. Further described are isolated fusion proteins comprising the intein variant and a tag and a molecule of interest. Also described are expression systems for expressing the intein variant as well as polypeptide screening methods employing the intein variant.

    Claims

    1. An isolated fusion protein comprising: a variant of Mtu I-CM intein or a biologically active fragment thereof, the Mtu I-CM intein having an amino acid sequence set forth in SEQ ID NO:1, a purification tag, and a molecule of interest, wherein the purification tag is located at the N terminus of the polypeptide and the molecule of interest is located at the C terminus of the polypeptide, wherein the variant or the biologically active fragment thereof comprises one or more amino acid substitutions at one or more sites corresponding to one or more sites within the range of 5 around H157 and H167 of the Mtu I-CM intein, and the N-terminal cleavage activity of the variant or the biologically active fragment thereof remains silenced; and comparing with the Mtu I-CM intein, the amino acid substitutions enable the variant or the biologically active fragment thereof to have reduced C-terminal cleavage efficiency at a first pH value and similar or increased C-terminal cleavage efficiency at a second pH value.

    2. The fusion protein according to claim 1, wherein the first pH value is a pH of 7.2-8.5, and the second pH value is a pH of 5.5-6.8.

    3. The fusion protein according to claim 1, wherein the variant or the biologically active fragment thereof comprises one or more substitutions at one or more of the sites E152, V153, E154, E155, L156, T158, L159, V166, H167, L2, H73, K74, V75, W81, H157, and V165 corresponding to SEQ ID NO:1.

    4. The fusion protein according to claim 1, wherein the variant or the biologically active fragment thereof comprises one or more substitutions at one or more of the sites H73, K74, E152, E154, E155 and T158 corresponding to SEQ ID NO:1.

    5. The fusion protein according to claim 4, wherein the amino acid substitution is selected from a group consisting of: H73Y or H73V, K74N; E154S; T158V, T158C or T158S, and any combination of the above.

    6. The fusion protein according to claim 4, wherein the amino acid substitution is selected from a group consisting of: H73Y and T158V; H73V and T158S; and H73V and T158C.

    7. The fusion protein according to claim 1, wherein the variant or the biologically active fragment thereof comprises an amino acid sequence selected from a group consisting of: i) SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9; ii) an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity with any sequence set forth in SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9; and iii) an amino acid sequence having one or more amino acids substitutions, deletions and/or additions as compared with the amino acid sequence set forth in SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9.

    8. The fusion protein according to claim 1, wherein the purification tag is linked to the N terminus of the variant or the biologically active fragment thereof through a spacer.

    9. The fusion protein according to claim 4, wherein the spacer comprises a sequence set forth in SEQ ID NO:10.

    10. The fusion protein according to claim 1, wherein the purification tag is an amphipathic self-assembling short peptide.

    11. The fusion protein according to claim 1, wherein the molecule of interest is a peptide segment, which is 20, 50, 70, 100, 150, 200, 250, 300, 350, 400, 450 or 500 amino acid residues in length, or any length in between any two lengths stated above.

    12. A method for producing a molecule of interest, comprising the steps of: (a) cultivating host cells comprising a polynucleotide encoding the fusion protein of claim 1 to express said fusion protein; (b) disrupting the host cells and recovering the fusion protein produced in step (a) at the first pH value; (c) cleaving the fusion protein at the second pH value to release the molecule of interest; and (d) recovering the molecule of interest.

    13. The method according to claim 12, wherein the first pH value is a pH of 7.2-8.5, and the second pH value is a pH of 5.5-6.8.

    14. A method for purifying a molecule of interest from a sample, comprising the steps of: (a) providing a sample containing the fusion protein of claim 1; (b) collecting the fusion protein by the purification tag; (c) adjusting pH value of a solution containing the fusion protein collected from step (b) such that the molecule of interest is cleaved from the fusion protein; and (d) recovering the molecule of interest.

    15. The method according to claim 14, wherein adjusting pH value in step (c) comprises adjusting the pH from the first pH value to the second pH value, wherein the first pH value is a pH of 7.2-8.5, and the second pH value is a pH of 5.5-6.8.

    16. The method according to claim 14, wherein the purification tag is an amphipathic self-assembling short peptide.

    17. The method according to claim 14, wherein the molecule of interest is a peptide segment, which is 20, 50, 70, 100, 150, 200, 250, 300, 350, 400, 450 or 500 amino acid residues in length, or any length in between any two lengths stated above.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0014] FIG. 1 is a diagram of constructing a FRET system. A positive control system C-I-Y and a negative control system C-Ia-Y are shown. It shows the cleavage products and related FRET values corresponding to a positive control and a negative control, respectively.

    [0015] FIG. 2 shows FRET spectrograms of positive and negative controls in a 96-well plate in vivo and in vitro, wherein (a) is a FRET spectrogram of the positive and negative controls in vivo, and (b) is a FRET spectrogram of the positive and negative controls in vitro; and abscissae are emission wavelength (nm) and ordinates are fluorescence intensity (RFU).

    [0016] FIG. 3 shows the preliminary screening results of a first 96-well plate at the H73 site, wherein (a) is the in vivo preliminary screening result of the first 96-well plate at the H73 site, with the right pane showing the FRET spectrograms of the positive and negative controls and a mutant strain 12-G in vivo; (b) is the in vitro preliminary screening result of the first 96-well plate at the H73 site, with the right pane showing the FRET spectrograms of the positive and negative controls and the mutant strain 12-G in vitro; and C3 and F10 show the positive control, D6 and H12 show the negative control, and the remaining gray markers show the other screened mutant strains.

    [0017] FIG. 4 shows a map of a fusion protein expression vector of the present invention.

    [0018] FIG. 5 shows the detection results of single mutant strains in the L6KD-I-LipA system, wherein (a) to (e) are the verification results of variants H73Y, H73V, T158S, K74N and E154S in the L6KD-I-LipA system, respectively; lane 1 is the supernatant of cell lysate; lane 2 is the precipitate of cell lysate; lane 3 is the precipitate after cleavage; lane 4 is the supernatant after cleavage; and lanes I, II and III are BSA standards (concentrations of BSA are 1000, 250 and 125 g/ml, respectively).

    [0019] FIG. 6 shows the detection results of single mutant strains in the L6KD-I-GLP1 system, wherein (a) and (b) are the results of variants T158S, H73V, H73Y, K74N and E154S in the L6KD-I-GLP1 system, and (c) is the result of the supernatant after cleavage; lane 1 is the precipitate of cell lysate; lane 2 is the precipitate after cleavage; lane 3 is the supernatant after cleavage; and lanes I, II and III are BSA and aprotinin standards (at 1000, 250 and 125 g/ml for BSA; and 500, 250 and 125 g/ml for aprotinin, respectively).

    [0020] FIG. 7 shows the detection results of double mutant strains in the L6KD-I-LipA system, wherein (a), (b) and (c) are the results of variants H73Y/T158V, H73V/T158S and H73V/T158C in the L6KD-I-LipA system respectively; lane 1 is the supernatant of cell lysate; lane 2 is the precipitate of cell lysate; lane 3 is the precipitate after cleavage; lane 4 is the supernatant after cleavage; and lanes I, II, III and IV are BSA standards (at 1000, 500, 250 and 125 g/ml, respectively).

    [0021] FIG. 8 shows the detection results of double mutant strains in the L6KD-I-GLP1 system, wherein (a) is the results of variants H73Y/T158V, H73V/T158S and H73V/T158C in the L6KD-I-GLP1 system, and (b) is the detection result of the supernatant after cleavage; wherein lane 1 is the precipitate of cell lysate; lane 2 is the precipitate after cleavage; lane 3 is the supernatant after cleavage; and lanes I, II, III and IV are BSA and aprotinin standards (at 1000, 500, 250 and 125 g/ml for BSA; 250, 125 and 67.5 g/ml at aprotinin, respectively).

    DETAILED DESCRIPTION OF THE INVENTION

    [0022] Mtu I-CM intein is an intein modified by the Wood group (David W. Wood et al., A genetic system yields self-cleaving inteins for bioseparations, Nat Biotechnol., 17(9):889-92 (1999)), which can be rapidly cleaved at the C terminus. Firstly, Wood group deleted an endonuclease domain from a Mtu RecA maxi-intein (440aa) from Mycobacterium tuberculosis, leaving 110 amino acids at the N terminus and 58 amino acids at the C terminus, so that to engineer the Mtu RecA maxi-intein into a mini intein. Further, the Wood group evolved the mini intein by introducing four point mutations: CIA, blocking the N-terminal cleavage activity; V67L, restoring the stability of the intein (the intein became unstable after the deletion of the endonuclease domain); D24G, having no effect on phenotype; and D150G (corresponding to the mutation site D422G in the Mtu RecA maxi-intein), cutting off the connection between C-terminal cleavage and N-terminal cleavage to improve the C-terminal cleavage activity of the intein. The resulted variant is called Mtu I-CM intein. Mtu I-CM intein can be rapidly cleaved at the C terminus. As used herein, the amino acid sequence of the term Mtu I-CM intein comprises the mutation C1A, as well as one or more mutations of V67L, D24G, and D150G (corresponding to the mutation site D422G in the Mtu RecA maxi-intein). In one embodiment of the invention, the amino acid sequence of the Mtu I-CM intein comprises mutations C1A, V67L, and D150G (corresponding to the mutation site D422G in the Mtu RecA maxi-intein). In one specific embodiment of the invention, the Mtu I-CM intein has an amino acid sequence set forth in SEQ ID NO:1, with a length of 168 amino acids and a molecular weight of 18.5 kDa. In one embodiment of the invention, one or more of amino acids E152, V153, E154, E155, L156, T158, L159, V166, H167, L2, H73, K74, V75, W81, H157, and V165 that within a range of 5 around H157 and H167 in the Mtu I-CM intein are subjected to site-directed mutagenesis.

    [0023] As used herein, the term variant refers to a polypeptide or polynucleotide comprising one or more amino acid or nucleotide mutations compared with its parent. The terms variant and mutant are used interchangeably herein. In some embodiment, the term template refers to a parent, i.e., Mtu I-CM intein.

    [0024] As used herein, the term biologically active entity or an entity having biological activity refers to an entity having reduced C-terminal cleavage efficiency compared with the Mtu I-CM intein at a first pH value, but has similar or increased C-terminal cleavage efficiency compared with the Mtu I-CM intein at a second pH value. As used herein, biologically active fragment of Mtu I-CM intein variant is an active fragment exhibits similar but not necessarily the same activity as the Mtu I-CM intein variant of the invention. In one embodiment, the amino acid at A1 of the Mtu I-CM intein variant or the biologically active fragment of the variant does not mutate. In one embodiment, the amino acid at A1 of the Mtu I-CM intein variant or the biologically active fragment of the variant does not mutate, and one or more of the amino acids at L67, G150 (corresponding to the mutation site G422 in the Mtu RecA maxi-intein) and G24 do not mutate. In a specific embodiment, the amino acids at A1, L67 and G150 of the Mtu I-CM intein variant or the biologically active fragment of the variant do not mutate.

    [0025] As used herein, the term amino acid is an organic compound containing an amino group and a carboxylic acid group. In the present invention, amino acids include 20 natural amino acids, unnatural amino acids, and amino acid analogs (i.e., amino acids in which -carbon has a side chain). Natural amino acids include amino acids selected from the group consisting of tyrosine, glycine, phenylalanine, methionine, alanine, serine, isoleucine, leucine, threonine, valine, proline, lysine, histidine, glutamine, glutamic acid, tryptophan, arginine, aspartic acid, asparagine, and cysteine. The abbreviations of natural amino acid residues are shown below in Table 1:

    TABLE-US-00001 TABLE 1 Symbol 1-letter 3-letter amino acid Y Tyr tyrosine G Gly glycine F Phe phenylalanine M Met methionine A Ala alanine S Ser serine I Ile isoleucine L Leu leucine T Thr threonine V Val valine P Pro proline K Lys lysine H His histidine Q Gln glutamine E Glu glutamic acid Z Glx Glu and/or Gln W Trp tryptophan R Arg arginine D Asp aspartic acid N Asn asparagine B Asx Asn and/or Asp C Cys cysteine X Xaa unknown or others

    [0026] Examples of unnatural amino acids and amino acid analogs are known to those skilled in the art, and include but not limited to 2-aminoadipic acid (Aad), 3-aminoadipic acid (Baad), -alanine/-amino-propionic acid (Bala), 2-aminobutyric acid (Abu), 6-aminocaproic acid (Acp), 2-aminoheptanoic acid (Ahe), 2-aminoisobutyric acid (Aib), 3-aminoisobutyric acid (Baib), 2-aminoheptanoic acid (Apm), 2,4-diaminobutyric acid (Dbu), desmosine (Des), 2,2-diaminopimelate (Dpm), 2,3-diaminopropionic acid (Dpr), N-etHylglycine (EtGly), N-ethylasparagine (EtAsn), hydroxylysine (hyl), allo-hydroxylysine (Ahyl), 3-hydroxyproline (3Hyp), 4-hydroxyproline (4Hyp), isodesmosine (Ide), alto-isoleucine (Aile), N-methylglycine, sarcosine (MeGly), N-methylisoleucine (Melle), 6-N-methyllysine (MeLys), N-methylvaline (MeVal), norvaline (Nva), norleucine (Nle) and ornithine (Orn).

    [0027] As used herein, the term polypeptide refers to a biomolecule composed of amino acids linked by peptide bonds. The terms polypeptide, peptide and protein are used interchangeably herein.

    [0028] As used herein, the term corresponding to or corresponds to refers to the portions, sites or regions aligned with each other when a person skilled in the art uses a known sequence alignment method to align two or more related polypeptide or nucleic acid sequences (including the sequences of molecules, regions of molecules and/or theoretical sequences) based on maximum matching to obtain the highest level of matching. In other words, when two or more polypeptide or nucleic acid sequences are optimally matched, two similar sites (or portions or regions) are aligned. When aligning two or more sequences, similar portions/sites/regions are identified based on the sites along linear nucleic acid or amino acid sequences.

    [0029] As used herein, the term host cell refers to a cell used to receive, maintain, replicate and amplify a vector. Host cells are particularly used for expressing the fusion polypeptide of the present invention encoded by a vector. Host cells can be used in the present invention include, but not limited to, cells are of prokaryotes and eukaryotes origin. In one embodiment, prokaryotes are bacteria selected from the group consisting of Escherichia, Mycobacterium (e.g., Mycobecterium Tuberculosis), Bacillus, Salmonella, Pseudomonas and Streptomyces. In a preferred embodiment, the host cells are Escherichia cells, more preferably Escherichia coli cells. In a specific embodiment of the present invention, the host cells used herein are Escherichia coli BL21 (DE3) strain cells. In one embodiment, the eukaryotes are selected from Pichia.

    [0030] Therefore, in a first aspect, the present invention relates to an isolated polypeptide comprising a variant of Mtu I-CM intein or a biologically active fragment thereof, the Mtu I-CM intein having an amino acid sequence set forth in SEQ ID NO:1, wherein the polypeptide comprises amino acid substitutions at sites corresponding to sites within the range of 5 around H157 and H167 of the Mtu I-CM intein, and the N-terminal cleavage activity of the polypeptide remains silenced; and compared with the Mtu I-CM intein set forth in SEQ ID NO:1, the amino acid substitutions enable the polypeptide having reduced C-terminal cleavage efficiency at a first pH value and similar or increased C-terminal cleavage efficiency at a second pH value. As used herein, the reduced cleavage efficiency refers to cleavage efficiency reduced from 87% of the Mtu I-CM intein to 18%-45%, preferably lower than 35%, under the same conditions; and the similar or increased cleavage efficiency refers to cleavage efficiency changing from 85% of the Mtu I-CM intein to 71%-92%, preferably higher than 80%, under the same conditions.

    [0031] In one embodiment, the first pH value is neutral to weakly basic. In a particular embodiment, the first pH value is a pH value within the host cell or is close to the pH value within the host cell. In a specific embodiment, the first pH value is 7.2-8.5. In a preferred embodiment, the first pH value is 7.4-7.8. In a more preferred embodiment, the first pH value is 7.4-7.6. In the most preferred embodiment, the first pH value is 7.5. In one embodiment, the second pH value refers to a pH value which is weakly acidic. In a preferred embodiment, the second pH value is 5.5-6.8, and preferably 5.5-6.5. In the most preferred embodiment, the second pH value is 6.0.

    [0032] In one embodiment, the amino acid substitutions comprise substitutions at one or more of the sites E152, V153, E154, E155, L156, T158, L159, V166, H167, L2, H73, K74, V75, W81, H157, and V165 corresponding to SEQ ID NO:1. In a preferred embodiment, the amino acid substitutions comprise substitutions at one or more of the sites H73, K74, E152, E154, E155 and T158 corresponding to SEQ ID NO:1. In a preferred embodiment, the amino acid substitutions comprise substitutions at one or more of the sites H73, K74, E154 and T158 corresponding to SEQ ID NO:1. In a more preferred embodiment, the amino acid substitutions occur at sites H73 and T158 corresponding to SEQ ID NO:1. In another embodiment, the amino acid substitutions are selected from the group consisting of H73Y, H73V; K74N; E154S; and/or T158V, T158C or T158S corresponding to SEQ ID NO:1. In a specific embodiment, the amino acid substitutions are H73Y and T158V, H73V and T158S; or H73V and T158C corresponding to SEQ ID NO:1.

    [0033] Methods for introducing amino acid mutations into polypeptides are well known to those skilled in the art. See, for example, Ausubel, Current Protocols in Molecular Biology, John Wiley and Sons, Inc. (1994); T. Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor laboratory, Cold Spring Harbor, N. Y. (1989). For example, commercially available kits such as QuikChange site-directed mutagenesis kit Stratagene can be used, or polypeptides with mutations can be synthesized directly by chemical methods.

    [0034] Those skilled in the art understand that the polypeptide of the first aspect of the present invention can be further modified, for example, by introducing substitution, addition or deletion of one or more additional amino acids, while still maintaining the biological activity of the variant of the Mtu I-CM intein or the biologically active fragment of the variant, i.e., compared with the Mtu I-CM intein, the further modified polypeptide has reduced C-terminal cleavage efficiency at the first pH value, but has similar or increased C-terminal cleavage efficiency at the second pH value. As used herein, the reduced cleavage efficiency means that compared with the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention is reduced by about 30% to about 40%, preferably by about 40% to about 50%, more preferably by about 50% to about 70%, and still more preferably by about 70% to about 80%, or more under the same first pH value. In a specific example, under the first pH value, the cleavage efficiency of the Mtu I-CM intein variant of the present invention is reduced to 18%-45%, preferably less than 35%, compared to about 87% of the Mtu I-CM intein. As used herein, the similar or increased cleavage efficiency means that compared with the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention decreases by no more than about 20%, preferably by no more than about 10%, or more preferably by no more than about 5%, or remains substantially the same, or increases by about 5%, preferably by about 10%, or more preferably by about 20% or more, under the same second pH value. In a specific embodiment, under the second pH value, compared with the about 85% cleavage efficiency of the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention is 71%-92%, preferably more than 80%.

    [0035] In one embodiment, the polypeptide may be subjected to conservative amino acid substitutions. As used herein, the term conservative amino acid substitution refers to the substitution of one amino acid residue by another amino acid residue of which a side chain R group having similar chemical properties, such as charge or hydrophobicity. Generally speaking, conservative amino acid substitutions do not substantially change the functional properties of proteins.

    [0036] Examples of amino acid groups having side chains with similar chemical properties include: (1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; (2) aliphatic hydroxyl side chains: serine and threonine; (3) side chains containing amides: asparagine and glutamine; (4) aromatic side chains: phenylalanine, tyrosine and tryptophan; (5) basic side chains: lysine, arginine and histidine; (6) acidic side chains: aspartic acid and glutamic acid; and (7) sulfur-containing side chains: cysteine and methionine. Preferred conservative amino acid substitutions include valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamic acid-aspartic acid, and asparagine-glutamine. Those skilled in the art can determine whether an amino acid substitution belongs to conservative amino acid substitutions according to the teaching of the prior art. Conservative amino acid substitutions can be carried out according to Table 2 below:

    TABLE-US-00002 TABLE 2 Conservative Amino Original Residue Acid Substitution Ala (A) Gly; Ser Arg (R) Lys Asn (N) Gln; His Cys (C) Ser Gln (Q) Asn Glu (E) Asp Gly (G) Ala; Pro His (H) Asn; Gln Ile (I) Leu; Val Leu (L) Ile; Val Lys (K) Arg; Gln; Glu Met (M) Leu; Tyr; Ile Phe (F) Met; Leu; Tyr Ser (S) Thr Thr (T) Ser Trp (W) Tyr Tyr (Y) Trp; Phe Val (V) Ile; Leu

    [0037] Herein, when used to define a polypeptide or polynucleotide sequence, the terms comprising, including, having or synonymous thereof are open-ended, meaning that other amino acids or nucleotide residues are optionally included at one or both termini of the defined polypeptide or polynucleotide sequence. As used herein, when defining a polypeptide or polynucleotide sequence, the term consisting of or consists of is closed, meaning that other amino acids or nucleotide residues are no longer contained at the two termini of the defined polypeptide or polynucleotide sequence.

    [0038] In one embodiment, the polypeptide comprises the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9. In a preferred embodiment, the polypeptide consists of the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9.

    [0039] As used herein, the term sequence identity refers to the degree to which amino acid or nucleotide sequences remain unchanged. Methods for evaluating the degree of sequence identity between amino acid sequences or nucleotide sequences are known to those skilled in the art. For example, amino acid sequence identity is usually measured by sequence analysis software. For example, the BLAST program of the NCBI database can be used to determine the identity. For the determination of sequence identity, see, for example, Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991.

    [0040] In one embodiment, the polypeptide of the first aspect has conservative amino acid substitutions. Therefore, in one embodiment, the amino acid sequence of the polypeptide of the first aspect has one or more amino acids substitutions, deletions and/or additions as compared with the amino acid sequence set forth in SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9. In another embodiment, the polypeptide comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity with any sequence set forth in SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 or SEQ ID NO:9. In the above embodiment, because the amino acid substitutions are conservative amino acid substitutions, the polypeptide of the present invention still maintains the biological activity of the Mtu I-CM intein, and has reduced cleavage efficiency at the first pH value, but has similar or increased cleavage efficiency at the second pH value compared with the Mtu I-CM intein. As used herein, the reduced cleavage efficiency means that compared with the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention is reduced by about 30% to about 40%, preferably by about 40% to about 50%, more preferably by about 50% to about 70%, and still more preferably by about 70% to about 80%, or more under the same first pH value. In a specific embodiment, under the first pH value, compared with about 87% cleavage efficiency of the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention is reduced to 18%-45%, preferably lower than 35%. As used herein, the similar or increased cleavage efficiency means that compared with the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention decreases by no more than about 20%, preferably by no more than about 10%, or more preferably by no more than about 5%, or remains substantially the same, or increases by about 5%, preferably by about 10%, or more preferably by about 20% or more under the same second pH value. In a specific embodiment, under the second pH value, compared with the about 85% cleavage efficiency of the Mtu I-CM intein, the cleavage efficiency of the Mtu I-CM intein variant of the present invention is 71%-92%, and preferably more than 80%.

    [0041] In a second aspect, the present invention relates to an isolated fusion protein comprising the polypeptide of the first aspect, a purification tag and a molecule of interest, wherein the purification tag is located at the N terminus of the polypeptide and the molecule of interest is located at the C terminus of the polypeptide.

    [0042] As used herein, the term purification tag refers to a molecule that purifies a molecule of interest through its own properties. Many different types of purification tags (according to the function) have been developed, including affinity tags, aggregating tags and compound tags. Different tag types are selected according to different purification methods to be adopted. Tags are also in various forms, including short peptides, antigenic epitopes, folded protein domains and the like. These tags are expressed together with the molecule of interest, so that the molecule of interest can be selectively captured and/or purified rapidly through a certain method. For example, the affinity tags achieve the capture and/or purification by affinity resins which can specifically bind thereto. The aggregating tags have self-aggregatable property or induced aggregatable property, which achieve the capture and/or purification by centrifugation. Many tags also have other functions in addition to purification, such as promoting dissolution or making the molecule of interest easy to detect.

    [0043] In a preferred embodiment, the purification tag is an affinity tag. In another preferred embodiment, the purification tag is an aggregating tag. In another specific embodiment, the aggregating tag is an amphipathic self-assembling short peptide.

    [0044] As used herein, the term self-assembling short peptide refers to a small peptide with amphipathic (hydrophilic and hydrophobic) properties, which is composed of hydrophilic (polar) amino acids and hydrophobic (nonpolar) amino acids arranged according to a certain rule. Amphipathic peptides are divided into two categories. One category contains other organic molecules in addition to amino acid residues, such as fatty acid chains; and the other category is composed of natural amino acids only. The latter can be divided into three categories according to different secondary structures: -helix, -sheet and random coil. In one embodiment, the amphipathic self-assembling short peptide of the present invention is selected from: 18A (DWLKAFYDKVAEKLKEAF) (SEQ ID NO:45), ELK16 (LELELKLKLELELKLK) (SEQ ID NO:46), L.sub.6KD (LLLLLLKD) (SEQ ID NO:47), EFR8 (FEFRFEFR) (SEQ ID NO:48) and EFK8 (FEFKFEFK) (SEQ ID NO:49). In a specific embodiment, the amphipathic self-assembling short peptide of the present invention is L.sub.6KD (LLLLLLKD) (SEQ ID NO:47).

    [0045] As used herein, the term spacer refers to a polypeptide in a certain length consisting of amino acids with low hydrophobicity and low charge effect, which allows the connected parts to be fully expanded and fully folded into their respective natural conformations without interference when co-existed in a fusion protein. Spacers commonly used in the art include, for example, flexible GS-type linker rich in glycine (G) and serine (5), and rigid PT-type linker rich in proline (P) and threonine (T). In some embodiments, the purification tag is attached to the N terminus of the polypeptide through a spacer. In a preferred embodiment, the spacer is a PT-type linker. In some specific embodiments, the spacer comprises the sequence PTPPTTPTPPTTPTPT (SEQ ID NO:10).

    [0046] In one embodiment, the molecule of interest is a peptide segment. In a preferred embodiment, the peptide segment is 20, 50, 70, 100, 150, 200, 250, 300, 350, 400, 450 or 500 amino acid residues in length, or any length in between any two lengths stated above.

    [0047] In another aspect, the present invention relates to an isolated polynucleotide comprising a nucleotide sequence encoding the isolated polypeptide in the embodiments of the first aspect.

    [0048] Polynucleotide sequences encoding the Mtu I-CM intein can be obtained from sequence databases available in the art. For example, polynucleotide sequences encoding the Mtu RecA maxi-intein can be obtained according to the amino acid sequence of the Mtu RecA maxi-intein in the NCBI database and by introducing mutations made by the Wood group (David W. Wood et al., A genetic system yields self-cleaving inteins for bioseparations (1999)).

    [0049] In one embodiment, the isolated polynucleotide of the present invention comprises the nucleotide sequence selected from a group consisting of: the nucleotide sequence set forth in SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17 or SEQ ID NO:18. In a preferred embodiment, the isolated polynucleotide of the present invention consists of the nucleotide sequence set forth in SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17 or SEQ ID NO:18. In one embodiment, the isolated polynucleotide of the present invention comprises a nucleotide sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity comparing with the nucleotide sequence set forth in SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17 or SEQ ID NO:18. In one embodiment, the isolated polynucleotide of the present invention comprises a polynucleotide sequence which hybridizes under stringent conditions with the nucleotide sequence set forth in SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17 or SEQ ID NO:18. In the above embodiments, the polynucleotide of the present invention encodes the polypeptide which still retains the biological activity of the Mtu I-CM intein, and compared with the Mtu I-CM intein, the polypeptide has reduced cleavage efficiency at the first pH value but similar or increased cleavage efficiency at the second pH value.

    [0050] As used herein, the term hybridization under stringent conditions refers to annealing of polynucleotide molecules and target nucleic acid molecules through complementary base pairing. Those skilled in the art are familiar with parameters affecting specific hybridization, such as the length and composition of specific molecules. Parameters particularly relevant to hybridization also include, for example, annealing and washing temperatures, buffer composition and salt concentration. In one embodiment, hybridization under stringent conditions refers to hybridization under high stringency conditions, i.e., 0.1SSPE, 0.1% SDS, 65 C. In one embodiment, hybridization under stringent conditions refers to hybridization under moderate stringency conditions, i.e., 0.2SSPE, 0.1% SDS, 50 C. In one embodiment, hybridization under stringent conditions refers to hybridization under low stringency conditions, i.e., 0.2SSPE, 0.1% SDS, 40 C. Equivalent stringent conditions are known in the art. Those skilled in the art can adjust the parameters affecting hybridization to accomplish hybridization of polynucleotide molecules and target nucleic acid molecules under low, moderate or high stringency conditions.

    [0051] In another aspect, the present invention also relates to an isolated polynucleotide comprising a nucleotide sequence encoding the fusion protein according to any one of the preceding embodiments.

    [0052] In another aspect, the present invention also relates to a recombinant vector comprising a polynucleotide encoding the aforementioned polypeptide or fusion protein. In one embodiment, the sequence of the polynucleotide encoding the fusion protein is operably linked to an expression control sequence to perform desired transcription and ultimately produce the fusion protein. Suitable expression control sequences include, but not limited to, promoters, enhancers, ribosome interaction sites such as ribosome binding sites, polyadenylation sites, transcription splicing sequences, transcription termination sequences, sequences that stabilize mRNA, and the like.

    [0053] In one embodiment, vectors used to construct the recombinant vector of the present invention include, but not limited to, vectors that autonomously replicate in host cells, such as plasmid vectors; and vectors can be integrated into host cell DNA and replicated together with the host cell DNA. In one embodiment, the vectors are commercially available vectors. In a specific embodiment, an expression vector of the present invention is derived from pET30a(+) from Novagen Inc.

    [0054] In another aspect, the present invention relates to a host cell comprising the isolated polynucleotide according to any of the preceding embodiments or the recombinant vector according to any of the preceding embodiments. In one embodiment, the recombinant vector enters the host cell by transformation. In one embodiment, the host cell expresses the fusion protein of the present invention.

    [0055] As used herein, the term transformation means that one, two or more copies of the isolated polynucleotide or recombinant vector of the present invention are transferred into the host cell. Methods for introducing exogenous polynucleotides or vectors into host cells are known to those skilled in the art, including but not limited to: microinjection (Capechi et al., 1980, Cell, 22:479), Ca.sub.2(PO.sub.4).sub.3 mediated transfection (Chen et al., 1987, Mol. Cell Biol., 7:2745), DEAE dextran mediated transfection, electroporation (Chu et al., 1987, Nucleic Acid Res., 15: 1311), liposome transfection/liposome fusion (Feigner et al., 1987, Proc. Natl. Acad. Sci., USA 84:7413), particle bombardment (Yang et al., 1990, Proc. Natl. Acad. Sci., USA 87:9568) and gene gun.

    [0056] The term expression generally refers to the process of producing a polypeptide by transcription and translation of a polynucleotide. As used herein, the term expression can be understood as heterologous expression, that is, expression of polypeptides encoded by heterologous nucleic acids in vivo in host cells or in vitro.

    [0057] In another aspect, the present invention also provides a method for producing a molecule of interest, which comprises the following steps: cultivating a host cell comprising a polynucleotide encoding the fusion protein according to any of the preceding embodiments to express the fusion protein; disrupting the host cell and recovering insoluble precipitate at the first pH value; cleaving the insoluble precipitate at the second pH value to release the molecule of interest; and recovering the molecule of interest, wherein the insoluble precipitate is an aggregate of insoluble active fusion proteins.

    [0058] In one embodiment, the first pH value refers to the pH value in the host cell or close to the pH value in the host cell, which is neutral to weakly basic. In a preferred embodiment, the first pH value is 7.2-8.5. In a preferred embodiment, the first pH value is 7.4-7.8. In the most preferred embodiment, the first pH value is 7.5. In one embodiment, the second pH value is weakly acidic. In a preferred embodiment, the second pH value is 5.5-6.8. In a preferred embodiment, the first pH value is 5.5-6.5. In the most preferred embodiment, the second pH value is 6.0.

    [0059] In a specific embodiment, the host cell is cultivated under physiological conditions (e.g., normal temperature 18-37 C., neutral pH 7.4-7.8) to express the fusion protein of the present invention, and the fusion protein can directly from the insoluble precipitate in an inclusion body. Compared with protein expression in a soluble state, the formation of the insoluble precipitate can prevent the fusion protein from being degraded in the cell and thus greatly increase the stability of the fusion protein or the molecule of interest. Meanwhile, since expression is carried out in the host cell cultivated under normal physiological conditions, the extension of the cultivation period of the host cell is avoided, and the production amount and production rate of the fusion protein can be improved by adopting suitable culture conditions.

    [0060] The term disrupting the host cell refers to the use of certain methods to lyse the host cell and release substances in cytoplasm. Methods for disrupting the host cell which can be used in the present invention include, but not limited to the following treatments: ultrasonication, homogenizing, high-pressure (e.g., in a French press), osmolysis, detergent, lyase, organic solvent, or combinations thereof. In one embodiment, the disrupting step lyses the cell membrane and inclusion body of the host cell, releasing the insoluble precipitate from the inclusion body and maintaining its insoluble state. In one embodiment, the insoluble precipitate released in the disrupting step is recovered through centrifugation. Therefore, the step of obtaining the precipitated fusion protein by changing environmental conditions (e.g., temperature, ion concentration, pH value and the like) is omitted, and the influence of severe environmental condition changes on the stability and activity of the protein is also avoided.

    [0061] In one embodiment, resuspending the obtained insoluble precipitate at the second pH value and recovering the supernatant containing the molecule of interest. Therefore, subsequent purification treatment can be directly carried out without high salt concentration, and thus avoiding ion residues, reducing operation times and reducing cost.

    [0062] In another aspect, the present invention relates to a method for purifying a molecule of interest from a sample, comprising the steps of: (a) providing a sample containing the fusion protein according to any of the preceding embodiments; (b) collecting the fusion protein by means of a purification tag; (c) adjusting pH value such that the molecule of interest is cleaved from the fusion protein; and (d) recovering the molecule of interest. In one embodiment, the step (c) comprises a step of adjusting pH value of a solution containing the fusion protein collected from step (b) such that the molecule of interest is cleaved from the fusion protein.

    [0063] In one embodiment, the purification tag is an affinity tag, and the collecting the fusion protein according to step (b) is completed by affinity chromatography, and the recovering the molecule of interest according to step (d) is completed by an elution chromatography column. In one embodiment, the purification tag is an aggregating tag, collecting the fusion protein according to step (b) is completed by centrifuging the insoluble precipitate formed by aggregation of the aggregating tag, and the step (d) separates the molecule of interest dissolved in the supernatant from the insoluble precipitate by centrifuging. In a specific embodiment, the aggregating tag is an amphipathic self-assembling short peptide. In one embodiment, the self-assembling short peptide of the present invention is selected from: 18A (DWLKAFYDKVAEKLKEAF) (SEQ ID NO:45), ELK16 (LELELKLKLELELKLK) (SEQ ID NO:46), L.sub.6KD (LLLLLLKD) (SEQ ID NO:47), EFR8 (FEFRFEFR) (SEQ ID NO:48) and EFK8 (FEFKFEFK) (SEQ ID NO:49). In a specific embodiment, the self-assembling short peptide of the present invention is L.sub.6KD (LLLLLLKD) (SEQ ID NO:47).

    [0064] In one embodiment, adjusting pH value in step (c) comprises adjusting the pH from the first pH value to the second pH value. In one embodiment, the first pH value is neutral to weakly basic. In a specific embodiment, the first pH value is 7.2-8.5. In a preferred embodiment, the first pH value is 7.4-7.8. In a more preferred embodiment, the first pH value is 7.4-7.6. In the most preferred embodiment, the first pH value is 7.5. In one embodiment, the second pH value refers to a pH value which is weakly acidic. In a preferred embodiment, the second pH value is 5.5-6.8, and preferably 5.5-6.5. In the most preferred embodiment, the second pH value is 6.0.

    [0065] In another aspect, the present invention also relates to a method for screening a polypeptide for producing or purifying a molecule of interest, comprising the following steps: (a) preparing a fusion protein comprising a variant of the Mtu I-CM intein set forth in SEQ ID NO:1 or a biologically active fragment of the variant, and the molecule of interest attached to the C terminus thereof; and (b) under the condition that the fusion protein has biological activity, screening the polypeptide with reduced C-terminal cleavage efficiency at pH 7.2-8.5 and similar or increased C-terminal cleavage efficiency at pH 5.5-6.8 as compared with the Mtu I-CM intein set forth in SEQ ID NO:1, wherein the N-terminal cleavage activity of the variant or biologically active fragment of the variant is silenced. In one embodiment, the fusion protein in step (a) further comprises a tag protein located at the N terminus. In a preferred embodiment, the tag protein is a fluorescent protein.

    [0066] In one embodiment, the variant or the biologically active fragment of the variant comprises one or more mutations as compared with the Mtu I-CM intein set forth in SEQ ID NO:1. In a preferred embodiment, the mutations are one or more amino acid substitutions at sites corresponding to the sites within the range of 5 around H157 and H167 of the sequence set forth in SEQ ID NO:1.

    [0067] Unless otherwise defined, scientific and technical terms used in connection with the present invention shall have the meanings commonly understood by those of ordinary skill in the art. Unless otherwise defined, the methods and techniques of the present invention are generally performed according to methods known and conventional in the art. Unless otherwise defined, when the term a or an is used herein, they mean at least one or one or more. In addition, unless otherwise defined, singular terms and their corresponding plural forms are used interchangeably herein. Except for examples or otherwise stated, all numbers describing amounts of ingredients, reaction conditions and the like used in this specification and claims should be interpreted to be modified by the term about in all cases. Therefore, unless indicated to the contrary, the numerical parameters described in the specification and claims are approximations. All publications cited herein are incorporated herein by reference in their entirety.

    EXAMPLES

    [0068] In order to make the embodiments and advantages of the present invention clearer, the executive mode of the present invention will be described in further details below through working examples. It should be understood that the working examples should not be construed as limiting, and those skilled in the art can further adjust the examples based on the principles of the present invention.

    [0069] Methods used in the following working examples are conventional methods unless otherwise specified. For specific steps, see, for example, Molecular Cloning: A Laboratory Manual (Sambrook, J., Russell, David W., Molecular Cloning: A Laboratory Manual, 3rd edition, 2001, NY, Cold Spring Harbor). All the primers were synthesized by Invitrogen.

    Example 1: Construction of Expression Vector for CFP-Mtu l-CM-YFP Screening System

    [0070] As shown in FIG. 1, based on the work of Amitai et al. (Amitai et al., Proc. Natl. Acad. Sci., USA, 106: 11005(2009)), a high throughput screening method based on 96-well plates and fluorescence resonance energy transfer (FRET) was established by the inventors. The N terminus and the C terminus of an Mtu I-CM intein are connected with cyan fluorescent protein (CFP) and yellow fluorescent protein (YFP) respectively. FRET will occur when the distance between CFP and YFP is less than 100 . It was found that the distance between A1 at the N terminus of Mtu I-CM and N168 at the C terminus of Mtu I-CM is 9 , and thus FRET should occur in this construction.

    [0071] In the present example, a CFP-Mtu I-CM-YFP (C-I-Y) positive control system and a CFP-Mtu I-CM (N168A)-YFP (C-Ia-Y) negative control system are constructed. In the positive control system, a Mtu I-CM intein with C-terminal cleavage activity was used, while in the negative control system, a Mtu I-CM intein (N168A) with silenced C-terminal cleavage activity was used. Premature cleavage of the positive control intein in vivo would lead to a decrease in FRET intensity, while in the negative control intein, no cleavage occurred in vivo, so FRET intensity was stronger, as shown in FIG. 1. The specific construction method is described as follows.

    [0072] The amino acid sequence encoding Mtu I-CM intein was obtained from the NCBI database, and mutations (C1A, V67L and D150G) made by the Wood group were introduced into its amino acid sequence (168 aa) to obtain the Mtu I-CM intein amino acid sequence. The gene of the Mtu I-CM intein was synthesized by Nanjing GenScript Biotech Corp. after codon optimization according to codon bias of Escherichia coli, and then was inserted into a pUC18 plasmid.

    [0073] CFP-YFP genes were synthesized by Nanjing GenScript Biotech Corp. after codon optimization according to codon bias of Escherichia coli, and were inserted between NdeI and XhoI sites of a pET30(a) plasmid, which results in pET30(a)-CFP-YFP. There is a gene sequence of GSGGS-EcoRI-HindIIIa-GSGGS between CFP and YFP genes, in which the Mtu I-CM intein is inserted between the EcoRI and HindIII restriction sites.

    [0074] Primers shown in Table 3 were designed and synthesized using Oligo 7 software. Using pUC18-Mtu I-CM plasmid constructed by Nanjing GenScript Biotech Corp. as the template, N-Mtu in Table 3 as the forward primer, Mtu-down-positive-FRET or Mtu-down-negative-FRET as the reverse primer, PCR amplification was carried out according to conventional methods to obtain Mtu I-CM and Mtu I-CM (N168A) polynucleotide fragments with EcoRI and HindIII restriction sites located upstream and downstream respectively. The PCR reaction system and reaction program are shown in Table 4. After the reaction was completed, PCR amplification products were analyzed using 1% agarose gel electrophoresis, and the results showed that PCR amplified the correct bands as expected.

    TABLE-US-00003 TABLE3 SequencesofPrimersUsedinthePresentExample SEQ ID Primer NO: Name Sequence.sup.a Description 19 N-Mtu 5-CCGGAATTCGCGCTGGCTGAAG positive GCACCGCATTT-3(EcoRI) control 20 Mtu-down- 5-CCCAAGCTTGTTATGAACCACAA primerto positive- CGCCTTCCGCAACCAG-3 amplify FRET (HindIII) MtuI-CM gene 21 Mtu-down- 5-CCCAAGCTTGGCATGAACCACA negative negative- ACGCCTTCCGCAACCAG-3 control FRET (HindIII) primer, using No.19 asthe forward primerto amplify MtuI-CM (N168A) gene .sup.a The underlined nucleotides in the sequence represent the corresponding restriction enzyme recognition sites stated in brackets. If no special explanation, the same below.

    TABLE-US-00004 TABLE 4 Reaction System and Program for Amplifying Mtu I-CM Intein Reagents Volume (L) 5 Q5 buffer 20 dNTPs (2.5 mM) 8 Template DNA(1 ng/L) 2 forward primer (20 M) 2.5 reverse primer (20 M) 2.5 Q5 high fidelity DNA polymerase 1 sterilized distilled water Add up to 100 Reaction program 1. 98 C. 30 s 2. 98 C. 10 s 3.sup.a. 68 C. 30 s 4.sup.a. 72 C. 44 s 5. return to 2, repeat 34 cycles 6. 72 C. 5 min .sup.aThe annealing temperature is Tm of forward and reverse primers plus 5 C., and the extension time is 30 s/Kb.

    [0075] The two gene fragments were subjected to double enzyme digestion by EcoRI and HindIII enzymes, and ligated with the vector pET30(a)-CFP-YFP digested by the same endonucleases, and then, the ligation product was transformed into Escherichia coli BL21 (DE3) (Novagen) competent cells, and the transformed cells were spread on LB plates containing 50 g/mL Kanamycin for positive clones screening. Then the plasmids of the positive colonies were extracted and sequenced. The sequencing results showed that the sequences of the constructs pET30a(+)-C-I-Y and pET30a(+)-C-Ia-Y were correct.

    Example 2: Expression of Screening System in 96-well Plates and FRET Determination Method in Vitro and in Vivo

    [0076] Recombinant bacteria E. coli BL21(DE3)/pET30a(+)-C-I-Y and E. coli BL21(DE3)/pET30a(+)-C-Ia-Y were inoculated on LB plates containing Kanamycin (50 g/mL) and cultivated overnight at 37 C. The C-I-Y mutant strains and the positive and negative control strains were inoculated into a 96-well plate containing 200 L of LB medium (50 g/mL Kanamycin), and the plate was placed in a shaker (250 rpm) and cultivated overnight at 37 C. 10 L of each culture was transferred to a new 96 deep-well plate containing 500 L of LB (50 g/mL Kanamycin). When the OD600 reached 0.4-0.6 absorbance units (AU), a final concentration of 0.2 mM IPTG (isopropyl -D-1-thiogalactopyranoside) was added to initiate protein expression. The cultures of C-I-Y mutant strains and control strains were then continued for expression for 26 h at 30 C. (250 rpm).

    [0077] After the expression is completed, the method for determination FRET in vivo in a 96-well plate is as follows: the culture was diluted with an equal volume of LB medium and transferred to a black flat-bottomed 96-well assay plate. The samples were screened for cleavage activity by excitation of the liquid cultures at 390 nm and monitoring the fluorescence emission in the range 460-555 nm with an Infinite M200 microplate reader (TECAN, Zurich, Switzerland). A method for determining FRET in vitro via a 96-well plate is as follows: after expressed by the above method, cells were first harvested by centrifugation at 4 C. 3,000g for 10 min. The pellets were subjected to three freeze-thawing cycles, and then the proteins were extracted by treating the pellets with 30 L of B-PER-II for every 500 L of liquid culture. The samples were then incubated at room temperature for 15 min, during which the cells were disrupted for protein extraction. Then the samples were centrifuged at 15,000g for 10 min at 4 C. to separate the supernatant and the precipitate. For each analysis, 10 L of supernatant containing the C-I-Y fusion protein was added to 190 L of intein cleavage buffer (buffer B4, 50 mM Na.sub.2HPO.sub.4NaH.sub.2PO.sub.4, pH 6.0) in each well of the black flat-bottomed 96-well assay plates, to initiate the cleavage of interns of C-I-Y fusion proteins. The intein cleavage reaction was performed by incubating the samples at 25 C. for 3 h, and continued at 4 C. overnight, with shaking (250 rpm). The in vitro FRET emission was determined by an Infinite M200 microplate reader (TECAN, Zurich, Switzerland) using the same method as described for the in vivo FRET assay.

    [0078] In vivo and in vitro FRET spectra of the positive control and the negative control are shown in FIG. 2 (each selected 5 colonies respectively), and there are obvious differences between positive and negative controls both in vivo and in vitro.

    Example 3: Semi-Rational Design of Mtu I-CM Intein

    [0079] The invention utilizes a semi-rational design method to carry out site selection on the Mtu I-CM intein.

    [0080] The inventors speculate that four conservative amino acids play a key role in C-terminus cleavage of Mtu I-CM, namely, D422 in the F-block of the original Mtu RecA maxi-intein (mutated into Gly by Wood et al., which cuts off the link between C-terminal cleavage and N-terminal cleavage and facilitates C-terminal cleavage, corresponding to G150 in SEQ ID NO:1), H429 in the F-block (corresponding to H157 in SEQ ID NO:1), H439 in the G-block (corresponding to H167 in SEQ ID NO:1) and N440 (corresponding to N168 in SEQ ID NO:1).

    [0081] According to the possible cleavage mechanism, the inventors speculate that the pKa values of H157 and H167 residues may affect the pH-inducible cleavage of the Mtu I-CM intein at the C-terminus. Since hydrogen bonds, charge interactions, solvation effects, etc. can affect the pKa values of amino acids, especially charge effects and hydrogen bonds, the inventors therefore envisage to change the pKa values of H157 and H167 residues by changing the amino acids around H157 and H167, and thereby obtaining a Mtu I-CM mutant strain with reduced cleavage efficiency in E. coli cells (pH 7.4-7.8), but still capable of efficient cleavage at pH 6.0 in vitro. In this example, amino acids within the range of 5 around H157 and H167 were selected for site-specific saturated mutations, mainly aiming at amino acids which may form hydrogen bonds or have a charge effect. It was found that there are 9 amino acids within the range of 5 around H157, namely E152, V153, E154, E155, L156, T158, L159, V166 and H167; and there are 10 amino acids within the range of 5 around H167, namely L2, H73, K74, V75, W81, H157, T158, L159, V165 and V166. The inventors first selected the polar amino acid E152, E154, E155, T158, H73 and K74 for mutation.

    Example 4: Construction of Site-Directed Saturated Mutagenesis Library

    [0082] By using the Mtu I-CM intein as a template and with an NNK degenerate codon (N represents a mixture of 4 bases: A, G, C and T, and K represents a mixture of 2 bases: G and T), 20 amino acids were introduced into the 6 sites described in Example 3 to establish a site-directed saturation mutagenesis (SDSM) library at each site. The primers used are shown in Table 5. Taking the SDSM library at T158 and H73 as an example, the process of establishing the library is illustrated as follows.

    TABLE-US-00005 TABLE5 SequencesofPrimersUsedinConstructionof Site-directedSaturatedMutationLibrary SEQ ID Primer NO: Name Sequence.sup.a Description 22 Mtu- 5- reverse down- CCCAAGCTTGTTATGAACCACAA primerfor E152 CGCCTTCCGCAACCAGGGTATGCA thecon- GTTCTTCCACMNNCAGACCAAACG struction TGCG-3(HindIII) ofmutation library atE152 23 Mtu- 5- reverse down- CCCAAGCTTGTTATGAACCACAA primerfor E154 CGCCTTCCGCAACCAGGGTATGCA thecon- GTTCMNNCACTTCCAGACC-3 struction (HindIII) ofmutation library atE154 24 Mtu- 5- reverse down- CCCAAGCTTGTTATGAACCACAA primerfor E155 CGCCTTCCGCAACCAGGGTATGCA thecon- GMNNTTCCACTTCCAGACC-3 struction (HindIII) ofmutation library atE155 25 Mtu- 5- reverse down- CCCAAGCTTGTTATGAACCACAA primerfor T158 CGCCTTCCGCAACCAGMNNATGCA thecon- GTTCTTCCA-3 struction (HindIII) ofmutation library atT158 26 Mtu- 5- overlapping up- GGCAACCCCGGATNNKAAAGTG PCRprimers H73 CTGACGGAATATG-3 forthe 27 Mtu- 5- con- down- TCCGTCAGCACTTTMNNATCCG struction H73 GGGTTGCCCACAGAATTGCAC-3 ofmutation library atH73 28 Mtu- 5- overlapping up- GGCAACCCCGGATCATNNKGTG PCRprimers K74 CTGACGGAATATGGCTGGCGTG- forthe 3 con- 29 Mtu- 5- struction down- TATTCCGTCAGCACMNNATGATC ofmutation K74 CGGGGTTGCCCACAGAATTG-3 library atK74 30 C-Mtu 5- reverse CCCAAGCTTGTTATGAACCACAA primerfor CGCCTTCCGCAACCAG-3 thecon- (HindIII) struction ofmutation libraries ofH73and K74 .sup.a Nucleotides bolded in the sequence are degenerate codons NNK and MNN. NNK was used in forward primers for site-directed saturated mutations; and MNN was used in reverse primers for site-directed saturated mutations, wherein M represents a mixture of two bases: C and A.

    [0083] For the construction of T158 library, using pUC18-Mtu I-CM plasmid as the template and N-Mtu and Mtu-down-T158 in Table 5 as forward and reverse primers, a Mtu I-CM gene fragment with saturated mutations at T158 was obtained through amplification. The PCR reaction system and reaction program are shown in Table 6. After the reaction was completed, PCR amplification products were analyzed using 1% agarose gel electrophoresis, and the results showed that correct bands were amplified as expected. The expected amplified fragments harbored the EcoRI and HindIII recognition sites at the upstream and downstream, respectively. After purifying the fragments by DNA gel recovery, the gene fragment was double digested with EcoRI and HindIII enzymes, then was ligated to the vector pET30(a)-CFP-YFP that was double digested by the same endonuclease and dephosphorylated, and meanwhile, a ligation reaction without adding the digested gene fragment was used as a negative control (for vector self-ligation). The target and control ligation products were transformed into E. coli BL21(DE3) to obtain a SDSM library of Mtu I-CM at T158. On the LB plate, the number of colonies of the SDSM library at T158 was about 700, while the number of colonies of the negative control was only 7, which indicated that the SDSM library was constructed at a high efficiency of cloning and can be used for further screening. The construction of SDSM libraries at E152, E154 and E155 was the same as that for T158.

    TABLE-US-00006 TABLE 6 Reaction System and Program for Amplifying Mtu I-CM Mutant Strain at T158 Reagents volume (L) 5 Q5 buffer 20 dNTPs (2.5 mM) 8 Template DNA (1 ng/L) 2 forward primer (20M) 2.5 reverse primer (20 M) 2.5 Q5 high fidelity DNA polymerase 1 sterilized distilled water Add up to 100 Reaction Program 1. 98 C. 30 s 2. 98 C. 10 s 3.sup.a. 68 C. 30 s 4.sup.a. 72 C. 44 s 5. return to 2, repeat 34 cycles 6. 72 C. 5 min .sup.aThe annealing temperature is Tm of forward and reverse primers plus 5 C., and the extension time is 30 s/Kb.

    [0084] For the construction of H73 library, also chose pUC18-Mtu I-CM plasmid as the template, according to the PCR system and program shown in Table 6, chose N-Mtu and Mtu-down-H73 in Table 5 as forward and reverse primers to amplify the upstream fragment carrying H73 mutations, and chose Mtu-up-H73 and C-Mtu as forward and reverse primers respectively to amplify the downstream fragment harboring H73 mutations. Used equimolar mixed two fragments solution as the template, overlap-extended the full-length gene. After 19 cycles of reaction without primer addition, primers N-Mtu and C-Mtu were added to continue the reaction for 34 cycles. The specific reaction system and program are shown in Table 7. The full-length Mtu I-CM gene with saturated mutation at H73 was obtained. The remaining steps are the same as those for T158. The construction of SDSM library at K74 is the same as that for H73. Six SDSM libraries were established above for further screening.

    TABLE-US-00007 TABLE 7 Reaction System and Program of Overlapping PCR for Amplifying Mtu I-CM Mutant Strain at H73 Reagents Volume (L) 5 Q5 buffer 20 dNTPs (2.5 mM) 8 upstream fragment 40 ng downstream fragment 60 ng forward primer (20 M) .sup.a reverse primer (20 M) .sup.a Q5 high fidelity DNA polymerase 1 sterilized distilled water Add up to 100 Reaction program step 1 Reaction program step 2 1. 98 C. 30 s 1. 98 C. 30 s 2. 98 C. 10 s 2. 98 C. 10 s 3. 68 C. 30 s 3. 68 C. 30 s 4. 72 C. 20 s 4. 72 C. 20 s 5. return to 2, repeat 19 cycles 5. return to 2, repeat 34 cycles 6. 72 C. 5 min 6. 72 C. 5 min .sup.a After step 1 is completed, add the forward and reverse primers to the reaction system, and then perform step 2.

    Example 5: Screening of Site-Directed Saturated Mutagenesis Library

    [0085] Using the screening method established in Example 2, six saturated libraries were screened by an Infinite M200 microplate reader (TECAN, Zurich, Switzerland), and 180 colonies (two 96-well plates) were selected from each library with a mutation coverage rate of 99%. The screening procedure is as follows: firstly, preliminary screening was carried out on a 96-well plate. Single colony in the SDSM library were first streaked on LB plates (containing 50 g/mL Kanamycin) for backup, and then inoculated into the 96-well plate containing 200 L LB medium (containing 50 g/mL Kanamycin), and at the same time two mocks (only LB medium), two positive controls and two negative controls were inoculated, and cultivated overnight at 37 C. with shaking (250 rpm). 10 L of each culture from each well was transferred to a new 96 deep-well plate containing 500 L of LB per well. When the OD600 reached 0.4-0.6 AU, a final concentration of 0.2 mM IPTG was added to the cultures. The cultures were then continued for further cultivation for 26 h at 30 C. with shaking (250 rpm) to induce C-I-Y mutant expression. After expression, FRET was determined in vivo and in vitro respectively according to the method described in Example 2. The results of FRET determination in vivo and in vitro were compared and analyzed. Mutant strains with obvious FRET in vivo (comparable to the negative control) but obsolete FRET in vitro (comparable to the positive control) were selected. Re-screened 96-well plate in triplicate, and the screening procedure was the same as the initial screening procedure. The mutant strains obtained by re-screening the 96-well plate were sequenced to identify the genotype alteration. After excluded variants with the same genotype, the resulting variants were then further confirmed in test tube in triplicate.

    [0086] According to the screening procedure in Example 2, each library was first subjected to 96-well plate preliminary screening. As shown in FIG. 3, the preliminary screening result of the first 96-well plate at site H73 was characterized by the value of YFP/CFP, wherein C3 and F10 show the positive controls, D6 and H12 show the negative controls, and the remaining gray markers show the mutant strains obtained by preliminary screening. It was found that there were indeed some mutant strains with reduced cleavage efficiency in vivo (YFP/CFP value close to the negative control), but maintain high cleavage efficiency in vitro (YFP/CFP value close to the positive control), such as mutant strain 12-G. After re-screened the mutant strains obtained by preliminary screening in triplicate, sequenced and excluded the variants with the same genotype, and verified the resulting variants in test tube in triplicate, 5 mutant strains were finally obtained with better performance, namely H73Y, H73V, K74N, E154S and T158S. These five mutations occur at four different sites, of which two are at the site 73.

    Example 6: Verification of Single Site Mutant Strain in L.SUB.6.KD-1-LipA Protein Purification System

    [0087] The Mtu I-CM mutant strains screened in Example 5 were first constructed into the L.sub.6KD-1-LipA system (LipA is of 191aa, the amino acid sequence of which is set forth in SEQ ID NO:50, and the nucleotide sequence of which is set forth in SEQ ID NO:52) for verification. The construction map is shown in FIG. 4. The primers used for construction are shown in Table 8. The plasmids pET30a-C-I(mutant)-Y in the selected mutant strains in Example 5 were extracted, and then were used as the template to amplify the upstream fragment I(mutant) of I(mutant)-LipA by using N-Mtu and Mtu-LipA-down in Table 8 as forward and reverse primers according to the PCR reaction system and program shown in Table 4. Meanwhile, pET30a-L.sub.6KD-1-LipA plasmids were used as the template to amplify the downstream fragment LipA of I(mutant)-LipA by using Mtu-LipA-up and C-LipA as forward and reverse primers. According to the overlapping PCR reaction system and program shown in Table 9, the complete I(mutant)-LipA gene were amplified. The fragments were subjected to double enzyme digestion with EcoRI and XhoI enzymes, and ligated to the vector pET30a-L.sub.6KD-1-LipA digested by the same endonucleases, the ligation product was transformed into Escherichia coli. Then the clones were identified by colony PCR and sequencing. In addition, the recombinant plasmid pET30(a)-L.sub.6KD-I(N168A)-LipA was constructed by the same method in this study as a negative control for subsequent characterization.

    TABLE-US-00008 TABLE8 SequencesofPrimersforAmplificationof I(mutant)-LipA SEQ ID Primer NO: Name Sequence Description 31 Mtu- 5- overlapping LipA- TTGTGGTTCATAACCACCA PCRprimers up TCACCATCACCACCCCAC- forthe 3 con- 32 Mtu- 5- struction LipA- GATGGTGATGGTGGTTAT ofI down GAACCACAACGCCTTCCGC (mutant)- AA-3 LipA 33 Mtu- 5- overlapping LipA- TTGTGGTTCATGCCCACC PCRprimers nega- ATCACCATCACCACCCCAC- forthe tive- 3 con- up struction 34 Mtu- 5- of LipA- GTGATGGTGATGGTGGG negative nega- CATGAACCACAACGCCTTCC controlI tive- GCAA-3 (N168A)- down LipA 35 C- 5- reverse LipA AGTCTACTCGAGTCAATT primers CGTATTCTGGCCCCCGCCG forthe TTC-3(XhoI) con- struction ofL.sub.6KD-I (mutant)- LipAand negative control system

    TABLE-US-00009 TABLE 9 Overlapping PCR Reaction System and Program for Amplifying I(mutant)-LipA Reagents volume (L) 5 Q5 buffer 20 dNTPs (2.5 mM) 8 upstream fragment 40 ng downstream fragment 60 ng forward primer (20 M) .sup.a reverse primer (20 M) .sup.a Q5 high fidelity DNA polymerase 1 sterilized distilled water Add up to 100 Reaction program step 1 Reaction program step 2 1. 98 C. 30 s 1. 98 C. 30 s 2. 98 C. 10 s 2. 98 C. 10 s 3. 68 C. 30 s 3. 68 C. 30 s 4. 72 C. 40 s 4. 72 C. 40 s 5. return to 2, repeat 19 cycles 5. return to 2, repeat 34 cycles 6. 72 C. 5 min 6. 72 C. 5 min .sup.a After step 1 is completed, add the forward and reverse primers to the reaction system, and then perform step 2.

    [0088] Escherichia coli strains with pET30(a)-L.sub.6KD-I(mutant)-LipA and control strains were inoculated into LB medium containing 50 g/mL Kanamycin, and cultivated overnight at 37 C. with shaking (250 rpm). The culture was transferred to LB medium containing 50 g/mL Kanamycin at a ratio of 1:50, and the expression of recombinant proteins in E. coli was induced by 0.2 mM IPTG when the OD.sub.600 reached 0.4-0.6 (log phase), and IPTG with a final concentration of 0.2 mM was added to induce Escherichia coli to express the recombinant protein at 18 C. for 24 h. After expression, measured OD 600 of the bacterial solution under the final concentration, conducted centrifugation at 4 C. 6,000g for 10 min, and harvested cell pellets and stored in 80 C. refrigerator.

    [0089] The harvested cell pellets were resuspended in buffer B1 (20 mM Tris-HCl, 500 mM NaCl, 1 mM EDTA, pH 8.5). The cell pellets were placed in an ice-water mixture bath, and followed by sonication to disrupt the cells. For 1 mL 20 OD.sub.600/mL sample, the disrupting conditions are: 2 ultrasonic probe, ultrasonic time 2s, interval time 2s, 99 times of cycling, power 100 W (2s2s99 times). The supernatant fractions were isolated from the pellets by centrifugation at 15,000g for 20 min at 4 C. The pellets were washed twice with equal volume of buffer B1 to remove soluble impurities in the pellets as much as possible. A certain amount of cell lysate supernatant and pellets sample after wash and resuspension were reserved for subsequent analysis and detection. The pellets obtained above were resuspended with intein cleavage inducing Buffer B2 (50 mM Na.sub.2HPO.sub.4NaH.sub.2PO.sub.4 buffer, 500 mM NaCl, pH 6.0) in equal volume, and cleaved at 25 C. for 3 h, and then continued at 4 C. overnight. After cleavage, conducted centrifugation at 4 C. 15,000g for 20 min to separate the supernatant and pellets, and resuspended the pellets with equal volume of Buffer B1, and then the resuspended pellets together with the supernatant were used for subsequent detection.

    [0090] FIG. 8 shows SDS-PAGE detection results of H73Y, H73V, T158S, K74N and E154S mutant strains in the L.sub.6KD-I-LipA system respectively. The quantitative results are shown in Table 10.

    TABLE-US-00010 TABLE 10 Quantification of Variants with Single Mutation in L.sub.6KD-I-LipA System Percentage Aggregate Yield .sup.b in vitro Target Yield .sup.b of in vivo (g/mg wet Cleavage (g/mg wet Variants cleavage .sup.a cell pellet) Efficiency .sup.c cell wet pellet) Advantage .sup.d H73Y 32% 43.3 92% 7.9 65% H73V 39% 32.6 81% 7.2 50% T158S 30% 40.7 75% 7.7 60% K74N 51% 37.1 80% 7.6 58% E154S 65% 22.7 86% 6.0 25% Mtu I-CM 87% 9.7 85% 4.8 template .sup.a Percentage of in vivo cleavage, i.e., premature cleavage efficiency of intein, was defined as the mass ratio of the cleaved fusion protein aggregates in vivo over the theoretical value of the fusion protein aggregates. .sup.b Calculation was based on when the concentration of bacterial solution at OD.sub.600 is 2, the wet cell weight is 2.66 0.99 mg/ml in LB medium. .sup.c Cleavage efficiency was defined as the mass ratio of the cleaved fusion protein aggregates in vitro over the fusion protein aggregates actually obtained. .sup.d Advantage was defined as (the yield of protein of interest from mutant strain the yield of protein of interest from Mtu I-CM)/the yield of protein of interest from Mtu I-CM 100%.

    [0091] When the 5 mutant strains were applied to the L.sub.6KD-I-LipA system, the in vivo premature cleavage efficiency was indeed reduced, and meanwhile the in vitro cleavage efficiency was still maintained, which resulted in the increasing of the yield of LipA protein. Compared with the template Mtu I-CM system, the in vivo cleavage ratio of the fusion protein was decreased from 87% to 30%-65%, and the final LipA yield was increased by 25%-65%, to 6.0-7.9 g/mg cell wet weight, wherein the in vivo cleavage ratio of the fusion protein in the mutant strain containing H73Y was reduced from 87% to 32%, increasing LipA yield by 65%; the in vivo cleavage ratio of the fusion protein in the mutant strain containing H73V was reduced from 87% to 39%, increasing LipA yield by 50%; and the in vivo cleavage ratio of the fusion protein in the mutant strain containing T158S was decreased from 87% to 30%, increasing LipA yield by 60%, but the in vitro cleavage efficiency of the mutant strain was slightly decreased (from 84% to 75%).

    Example 7: Verification of Single Site Mutant Strain in L.SUB.6.KD-I-GLP1 Protein Purification System

    [0092] In this example, the selected 5 single site mutant strains were constructed into the L.sub.6KD-I-GLP1 system (GLP1 is of 31aa, the amino acid sequence of which is set forth in SEQ ID NO:51, and the nucleotide sequence of which is set forth in SEQ ID NO:53) to verify if they can also be used for polypeptide preparation efficiently. Refer to the construction of the L.sub.6KD-I(mutant)-LipA system in Example 6 for construction method, and the primers used are shown in Table 11.

    TABLE-US-00011 TABLE11 SequencesofPrimersforAmplificationofI (mutant)-GLP1 SEQ ID Primer NO: Name Sequence Description 36 Mtu- 5- overlapping GLP1 GTTGTGGTTCATAACCATGCAG PCRprimers -up AAGGCACCTTTACCA-3 forthe 37 Mtu- 5- con- GLP1- GTGCCTTCTGCATGGTTATGAA struction down CCACAACGCCTTCCGCAACC- ofI 3 (mutant)- GLP1 38 Mtu- 5- overlapping GLP1- GCGTTGTGGTTCATGCCCATGC PCRprimers nega- AGAAGGCACCTTTACCA-3 forthe tive- con- up struction 39 Mtu- 5- ofthe GLP1- GTGCCTTCTGCATGGGCATGAA negative nega- CCACAACGCCTTCCGCAACC- controlI tive- 3 (N168A)- down GLP1 40 C-GLP1 5- reverse ATCTGACTCGAGTCAACCACGA primers CCTTTAACCAGCC-3 forthe (XhoI) con- struction ofL.sub.6KD-I (mutant)- GLP1and thenega- tive control system

    [0093] Escherichia coli with recombinant plasmid pET30(a)-L.sub.6KD-I(mutant)-GLP1 and a control strain were expressed and purified according to the method in Example 6, the obtained samples were analyzed by SDS-PAGE, and the detection results are shown in FIG. 6. Since the supernatant after cleavage (lane 3) contained a GLP-1 band, and the molecular weight of GLP-1 was only 3355.7 Da, which cannot be detected by conventional 12% SDS-PAGE and needed to be detected by 4-12% Bis-Tris SDS-PAGE (FIG. 6 (c)). The quantitative results are shown in Table 12.

    [0094] Similarly, when the 5 mutant strains were applied to the L.sub.6KD-I-GLP1 system, the in vivo premature cleavage efficiency was reduced to different degrees, and the in vitro cleavage efficiency was still maintained in a high level and thus the yield of GLP-1 increased. As shown in Table 12, compared with the original Mtu I-CM system, the application of the mutant strains reduced the in vivo cleavage ratio of the fusion protein in the L.sub.6KD-I-GLP1 system from 68% to 31%-54%, and the yield of GLP-1 was increased by 50%-3.3 times, to 1.34-3.92 g/mg cell wet weight, wherein the in vivo cleavage ratio of the fusion protein in the mutant strain containing T158S was reduced from 68% to 31%, increasing GLP-1 yield by 2.3-fold; the in vivo cleavage ratio of the fusion protein in the mutant strain containing H73V was reduced from 68% to 42%, increasing GLP-1 yield by 1.4-fold; and the in vivo cleavage ratio of the fusion protein in the mutant strain containing H73Y was reduced from 68% to 35%, increasing GLP-1 yield by 3.3-fold. Taken together of the application results of the 5 mutant strains in L.sub.6KD-I-LipA system and L.sub.6KD-I-GLP1 system, it is found that mutant strains H73Y, H73V and T158S are of better performance.

    TABLE-US-00012 TABLE 12 Quantification of Single Site Mutation Strain in L.sub.6KD-I-GLP1 System Protein of in vivo Aggregate Yield in vitro Interest Yield Cleavage (g/mg cell Cleavage (g/mg cell Variants Ratio.sup.a wet weight).sup.b Efficiency .sup.c wet weight).sup.b Advantage .sup.d T158S 31% 56.6 83% 2.99 230% H73V 42% 43.9 85% 2.2 140% H73Y 35% 58.2 89% 3.92 330% K74N 54% 31.9 82% 1.57 70% E154S 53% 38.7 86% 1.34 50% Mtu I-CM 68% 24.4 85% 0.91 template .sup.aPercentage of in vivo cleavage, i.e., premature cleavage efficiency of intein, was defined as the mass ratio of the cleaved fusion protein aggregates in vivo over the theoretical value of the fusion protein aggregates. .sup.bCalculation was based on when the concentration of bacterial solution at OD.sub.600 is 2, the wet cell weight is 2.66 0.99 mg/ml in LB medium. .sup.c Cleavage efficiency was defined as the mass ratio of the cleaved fusion protein aggregates in vitro over the fusion protein aggregates actually obtained. .sup.d Advantage was defined as (the yield of protein of interest from mutant strain the yield of protein of interest from Mtu I-CM)/the yield of protein of interest from Mtu I-CM 100%.

    Example 8: Construction and Screening of Combinatorial Active-Site Saturation Testing Library

    [0095] The mutant strains at site H73 and T158 have good performance in the cSAT method. This example combines the two sites 73 and 158, hoping to further improve the performance of the Mtu I-CM intein. Since the distance between H73 and T158 is 8.3 , the inventors speculate that there may be a synergistic effect between them. Therefore, used the combinatorial active-site saturation testing (CASTing) method developed by Reetz et al. on the basis of the SDSM method to build a combined library of H73 and T158.

    [0096] By using the Mtu I-CM intein as the template and with the NDT degeneracy codon, 12 amino acids were simultaneously introduced at H73 and T158 to establish a CASTing library. Used pUC18-Mtu I-CM plasmid as the template, and Mtu-up-73-158 and CAST-Mtu-down-73 in Table 13 as forward and reverse primers, and amplified the upstream fragment of the mutation site H73; and meanwhile, used CAST-Mtu-up-73 and Mtu-down-73-158 as forward and reverse primers, and amplified the downstream fragment of the mutation site H73, and the reverse primer Mtu-down-73-158 also introduced mutation into T158. Took an equimolar mixed two fragments as the template, and conducted overlap PCR to amplify a full-length gene. After 19 cycles of reaction without primer addition, primers Mtu-up-73-158 and Mtu-down-73-158 were added to continue the reaction for 34 cycles. The reaction system and program were the same as those in Table 7. The Mtu I-CM full-length genes with saturated mutations at both H73 and T158 were obtained, upstream and downstream of which were respectively provided with EcoRI and HindIII enzyme recognition sites. The gene was subjected to DNA gel purification, EcoRI and HindIII enzymes were used for double enzyme digestion, then the gene was ligated to the vector pET30(a)-CFP-YFP after double enzyme digestion by the same endonuclease and dephosphorylation, and meanwhile, a ligation reaction without adding double digested genes was used as a negative control (control of vector self-ligation) to obtain target and control ligation products. The ligation products were transformed into E. coli BL21(DE3) to obtain a CASTing library of Mtu I-CM at H73 and T158.

    TABLE-US-00013 TABLE13 SequencesofPrimersUsedinthisExample SEQ ID Primer NO: Name Sequence.sup.a Description 41 Mtu- 5- forward up- CCGGAATTCGCGCTGGCTGA primers 73- AGGCACG-3(EcoRI) forthe 158 con- struction ofcom- bined library 42 CAST- 5- overlapping Mtu- GGCAACCCCGGATNDTAAAGT PCR up-73 GCTGACGGAATATG-3 primers 43 CAST- 5- introdu- Mtu- TCCGTCAGCACTTTAHNATCC cing12 down- GGGGTTGCCCACAGAATTGCAC- amino 73 3 acidsat H73 44 Mtu- 5- reverse down- CCCAAGCTTGTTATGAACCAC primers 73- AACGCCTTCCGCAACCAGAHNA forthe 158 TGCAGTTCTTCCACTTCCA-3 con- (HindIII) struction ofcombi- natorial library, introdu- cing12 amino acidsat T158 .sup.a Nucleotides bolded in the sequence are degenerate codons NDT and AHN. NDT, a degenerate codon used in the forward primers for combinatorial active-site saturated mutation, wherein D represents a mixture of three bases: A, T and G; AHN, a degenerate codon used in the reverse primers for combinatorial active-site saturated mutation, wherein H represents a mixture of three bases: C, A and T.

    [0097] The combinatorial library of H73 and T158 was screened by an Infinite M200 microplate reader (TECAN, Zurich, Switzerland) using the screening procedure described in Example 5, and 540 colonies (six 96-well plates) were selected with a mutation coverage rate of 98%. Finally, obtained 6 combinatorial site mutant strains with reduced in vivo cleavage efficiency in the C-I-Y system but still capable of effective in vitro cleavage, namely, H73Y/T158V, H73V/T158S, H73V/T158C, H73V/T158N, H73S/T158N and H73C/T158S, wherein the mutant strain H73V/T158S is a combination of two single mutant strains (H73V and T158S) with better performance obtained by site-directed saturated mutation.

    Example 9: Characterization of Combinatorial Site Mutant Strain in L.SUB.6.KD-I-LipA System

    [0098] In this example, the selected 6 combinatorial site mutant strains were constructed into the L.sub.6KD-I-LipA system to verify if they can also be used for polypeptide preparation efficiently. Refer to the construction of the L.sub.6KD-I(mutant)-LipA system in Example 6 for construction method, and the primers used are shown in Table 8.

    [0099] Escherichia coli with recombinant plasmid pET30(a)-L.sub.6KD-I(mutant)-GLP1 and a control strain were expressed and purified according to the method in Example 6, the obtained samples were analyzed by SDS-PAGE, and the detection results are shown in FIG. 7, and the quantitative results are shown in Table 14.

    TABLE-US-00014 TABLE 14 Quantification of of Combinatorial Site Mutant Strain in L.sub.6KD-I-LipA System Percentage Aggregate Yield .sup.b in vitro Aggregate Yield .sup.b of in vivo (g/mg cell Cleavage (g/mg cell Variants Cleavage .sup.a wet weight) Efficiency .sup.c wet weight) Advantage .sup.d H73Y/T158V 27% 57.7 71% 9.3 94% H73V/T158S 36% 36.5 74% 8.2 71% H73V/T158C 45% 41.5 84% 8.2 71% Mtu I-CM 87% 9.7 85% 4.8 template .sup.a Percentage of in vivo cleavage, i.e., premature cleavage efficiency of intein, was defined as the mass ratio of the cleaved fusion protein aggregates in vivo over the theoretical value of the fusion protein aggregates. .sup.b Calculation was based on when the concentration of bacterial solution at OD.sub.600 is 2, the wet cell weight is 2.66 0.99 mg/ml in LB medium. .sup.c Cleavage efficiency was defined as the mass ratio of the cleaved fusion protein aggregates in vitro over the fusion protein aggregates actually obtained. .sup.d Advantage was defined as (the yield of protein of interest from mutant strain the yield of protein of interest from Mtu I-CM)/the yield of protein of interest from Mtu I-CM 100%.

    [0100] The in vivo cleavage ratio of the fusion protein of mutant strain H73Y/T158V was reduced from 87% to 27%, which was the lowest among all obtained mutant strains, resulting in a 94% increase in LipA yield; and the in vivo cleavage ratio of the fusion protein of the mutant strain H73V/T158S was reduced from 87% to 36%, increasing LipA yield by 71%. However, the in vitro cleavage efficiency of the two mutant strains was slightly decreased. The in vivo cleavage ratio of the fusion protein of the mutant strain H73V/T158C was reduced from 87% to 45%, increasing LipA yield by 71%. The other 3 mutant strains were not as effective as the previous single site mutant strains, so they will not be constructed into the L.sub.6KD-I-GLP1 system for verification.

    Embodiment 10: Characterization of Combinatorial Site Mutant Strain in L.SUB.6.KD-I-GLP1 System

    [0101] In this example, the selected 3 combinatorial site mutant strains were constructed into the L.sub.6KD-I-GLP1 system to verify if they can also be used for polypeptide preparation efficiently. Refer to the construction of the L.sub.6KD-I(mutant)-LipA system in Example 6 for construction method, and the primers used are shown in Table 11.

    [0102] Escherichia coli with recombinant plasmid pET30(a)-L.sub.6KD-I(mutant)-GLP1 and a control strain were expressed and purified according to the method in Example 6, the obtained samples were analyzed by SDS-PAGE, and the detection results are shown in FIG. 8. The quantitative results are shown in Table 15.

    [0103] Similarly, the three combinatorial site mutant strains can also reduce the in vivo cleavage ratio of the L.sub.6KD-I-GLP1 system to various degrees and improve the GLP-1 yield. The in vivo cleavage ratio of the fusion protein of mutant strain H73Y/T158V was reduced from 68% to 18%, but the in vitro cleavage efficiency was greatly reduced from 85% to 48%, thus the yield of GLP-1 was only increased by 41% compared with the original system. However, the in vitro cleavage efficiency of the mutant strain in the L.sub.6KD-I-LipA system was only slightly decreased (as shown in Table 15). The in vivo cleavage ratio of the fusion protein of the mutant strain H73V/T158S was reduced from 68% to 21%, increasing GLP-1 yield by 3.8-fold. The in vivo cleavage ratio of the fusion protein of the mutant strain H73V/T158C was reduced from 68% to 25%, increasing GLP-1 yield by 3.4-fold. Although the in vitro cleavage efficiency of mutant strain H73Y/T158V was decreased in this system, like in the L.sub.6KD-I-LipA system, the in vivo cleavage efficiency of mutant strain H73Y/T158V was the lowest among all the obtained mutants, which was lower than that of the combinatorial mutant strain H73V/T158S of two selected mutant strains with better efficiency obtained by site-specific saturated mutation, indicating that there was indeed a certain degree of synergy effect between 73 and 158 sites, and showing the effectiveness of site combination using the combinatorial active-site saturation testing method.

    TABLE-US-00015 TABLE 15 Quantification of Single Site Mutant Strain in L.sub.6KD-I-GLP1 System Target Percentage Aggregate Yield in vitro Protein Yield of in vivo (g/mg wet Cleavage (g/mg wet Variants cleavage .sup.a cell weight).sup.b Efficiency .sup.c cell weight).sup.b Advantage .sup.d H73Y/T158V 18% 64.1 48% 1.28 41% H73V/T158S 21% 61.2 80% 4.38 380% H73V/T158C 25% 59.1 85% 4.03 340% Mtu I-CM 68% 24.4 85% 0.91 template .sup.a Percentage of in vivo cleavage, i.e., premature cleavage efficiency of intein, was defined as the mass ratio of the cleaved fusion protein aggregates in vivo over the theoretical value of the fusion protein aggregates. .sup.bCalculation was based on when the concentration of bacterial solution at OD.sub.600 is 2, the wet cell weight is 2.66 0.99 mg/ml in LB medium. .sup.c Cleavage efficiency was defined as the mass ratio of the cleaved fusion protein aggregates in vitro over the fusion protein aggregates actually obtained. .sup.d Advantage was defined as (the yield of protein of interest from mutant strain the yield of protein of interest from Mtu I-CM)/the yield of protein of interest from Mtu I-CM 100%.

    [0104] Those skilled in the art will understand that variations and modifications of the invention described herein other than those explicitly described are permissible. It should be understood that the present invention includes all such variations and modifications. The present invention also includes all steps, features, compositions and compounds mentioned or indicated individually or jointly in the specification, as well as any and all combinations, or any two or more of said steps or features.

    TABLE-US-00016 SequenceListing MtuI-CMintein SEQIDNO:1 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHTLVAEGVVVHN MtuI-CMinteinvariantH73Y SEQIDNO:2 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDYKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHTLVAEGVVVHN MtuI-CMinteinvariantH73V SEQIDNO:3 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDVKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHTLVAEGVVVHN MtuI-CMinteinvariantK74N SEQIDNO:4 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDHNVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHTLVAEGVVVHN MtuI-CMinteinvariantE154S SEQIDNO:5 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVSELHTLVAEGVVVHN MtuI-CMinteinvariantT158S SEQIDNO:6 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHSLVAEGVVVHN MtuI-CMinteinvariantH73YandT158V SEQIDNO:7 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDYKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHVLVAEGVVVHN MtuI-CMinteinvariantH73VandT158S SEQIDNO:8 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDVKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHSLVAEGVVVHN MtuI-CMinteinvariantH73VandT158C SEQIDNO:9 ALAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVI GLRIAGGAILWATPDVKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPARV QALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFGLEVEELHCLVAEGVVVHN PTlinkeraminoacidsequence SEQIDNO:10 PTPPTTPTPPTTPTPTP MtuI-CMinteinvariantH73Ynucleotidesequence SEQIDNO:11 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATTATAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATACCCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantH73Vnucleotidesequence SEQIDNO:12 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATGTGAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATACCCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantK74Nnucleotidesequence SEQIDNO:13 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATCATAATGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATACCCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantE1545nucleotidesequence SEQIDNO:14 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATCATAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGAGTGAACTGCATACCCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantT158Snucleotidesequence SEQIDNO:15 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATCATAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATTCTCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantH73YandT158Vnucleotidesequence SEQIDNO:16 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATTATAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATGTTCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantH73VandT158Snucleotidesequence SEQIDNO:17 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATGTTAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATAGTCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC MtuI-CMinteinvariantH73VandT158Cnucleotidesequence SEQIDNO:18 1GCGCTGGCTGAAGGCACGCGCATTTTTGATCCGGTCACGGGCACGACGCACCGCATTGAA 61GATGTTGTTGATGGCCGCAAGCCGATTCATGTGGTTGCGGCCGCAAAAGATGGCACCCTG 121CACGCCCGTCCGGTCGTGAGTTGGTTTGATCAGGGTACGCGTGACGTCATTGGTCTGCGT 181ATCGCGGGCGGTGCAATTCTGTGGGCAACCCCGGATGTTAAAGTGCTGACGGAATATGGC 241TGGCGTGCTGCGGGTGAACTGCGTAAGGGTGACCGTGTTGCACAGCCGCGTCGCTTTGAT 301GGCTTCGGTGACAGCGCACCGATTCCGGCTCGCGTTCAAGCCCTGGCAGATGCTCTGGAT 361GACAAGTTCCTGCACGACATGCTGGCGGAAGAACTGCGTTACTCTGTTATCCGCGAAGTC 421CTGCCGACCCGTCGCGCCCGCACGTTTGGTCTGGAAGTGGAAGAACTGCATTGTCTGGTT 481GCGGAAGGCGTTGTGGTTCATAAC primerN-Mtu SEQIDNO:19 5-CCGGAATTCGCGCTGGCTGAAGGCACGCGCATTT-3 primerMtu-down-positive-FRET SEQIDNO:20 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAG-3 primerMtu-down-negative-FRET SEQIDNO:21 5-CCCAAGCTTGGCATGAACCACAACGCCTTCCGCAACCAG-3 primerMtu-down-E152 SEQIDNO:22 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAGGGTATGCAGTTCT TCCACMNNCAGACCAAACGTGCG-3 primerMtu-down-E154 SEQIDNO:23 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAGGGTATGCAGTTCM NNCACTTCCAGACC-3 primerMtu-down-E155 SEQIDNO:24 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAGGGTATGCAGMNNT TCCACTTCCAGACC-3 primerMtu-down-T158 SEQIDNO:25 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAGMNNATGCAGTTCT TCCA-3 primerMtu-up-H73 SEQIDNO:26 5-GGCAACCCCGGATNNKAAAGTGCTGACGGAATATG-3 primerMtu-down-H73 SEQIDNO:27 5-TCCGTCAGCACTTTMNNATCCGGGGTTGCCCACAGAATTGCAC-3 primerMtu-up-K74 SEQIDNO:28 5-GGCAACCCCGGATCATNNKGTGCTGACGGAATATGGCTGGCGTG-3 primerMtu-down-K74 SEQIDNO:29 5-TATTCCGTCAGCACMNNATGATCCGGGGTTGCCCACAGAATTG-3 primerC-Mtu SEQIDNO:30 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAG-3 primerMtu-LipA-up SEQIDNO:31 5-TTGTGGTTCATAACCACCATCACCATCACCACCCCAC-3 primerMtu-LipA-down SEQIDNO:32 5-GATGGTGATGGTGGTTATGAACCACAACGCCTTCCGCAA-3 primerMtu-LipA-negative-up SEQIDNO:33 5-TTGTGGTTCATGCCCACCATCACCATCACCACCCCAC-3 primerMtu-LipA-negative-down SEQIDNO:34 5-GTGATGGTGATGGTGGGCATGAACCACAACGCCTTCCGCAA-3 primerC-LipA SEQIDNO:35 5-AGTCTACTCGAGTCAATTCGTATTCTGGCCCCCGCCGTTC-3 primerMtu-GLP1-up SEQIDNO:36 5-GTTGTGGTTCATAACCATGCAGAAGGCACCTTTACCA-3 primerMtu-GLP1-down SEQIDNO:37 5-GTGCCTTCTGCATGGTTATGAACCACAACGCCTTCCGCAACC-3 primerMtu-GLP1-negative-up SEQIDNO:38 5-GCGTTGTGGTTCATGCCCATGCAGAAGGCACCTTTACCA-3 primerMtu-GLP1-negative-down SEQIDNO:39 5-GTGCCTTCTGCATGGGCATGAACCACAACGCCTTCCGCAACC-3 primerC-GLP1 SEQIDNO:40 5-ATCTGACTCGAGTCAACCACGACCTTTAACCAGCC-3 primerMtu-up-73-158 SEQIDNO:41 5-CCGGAATTCGCGCTGGCTGAAGGCACG-3 primerCAST-Mtu-up-73 SEQIDNO:42 5-GGCAACCCCGGATNDTAAAGTGCTGACGGAATATG-3 primerCAST-Mtu-down-73 SEQIDNO:43 5-TCCGTCAGCACTTTAHNATCCGGGGTTGCCCACAGAATTGCAC-3 primerMtu-down-73-158 SEQIDNO:44 5-CCCAAGCTTGTTATGAACCACAACGCCTTCCGCAACCAGAHNATGCAGTTCTT CCACTTCCA-3 18Aaminoacidsequence SEQIDNO:45 DWLKAFYDKVAEKLKEAF ELK16aminoacidsequence SEQIDNO:46 LELELKLKLELELKLK L.sub.6KDaminoacidsequence SEQIDNO:47 LLLLLLKD EFR8aminoacidsequence SEQIDNO:48 FEFRFEFR EFK8aminoacidsequence SEQIDNO:49 FEFKFEFK lipaseLipAaminoacidsequence SEQIDNO:50 HHHHHHPTPMAEHNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKT GTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVT LGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGL LYSSQVNSLIKEGLNGGGQNTN GLP1aminoacidsequence SEQIDNO:51 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG lipaseLipAnucleotidesequence SEQIDNO:52 CACCATCACCATCACCACCCCACCCCTATGGCTGAACACAATCCAGTCGTTATGG TTCACGGTATTGGAGGGGCATCATTCAATTTTGCGGGAATTAAGAGCTATCTCGTA TCTCAGGGCTGGTCGCGGGACAAGCTGTATGCAGTTGATTTTTGGGACAAGACA GGCACAAATTATAACAATGGACCGGTATTATCACGATTTGTGCAAAAGGTTTTAGA TGAAACGGGTGCGAAAAAAGTGGATATTGTCGCTCACAGCATGGGGGGCGCGA ACACACTTTACTACATAAAAAATCTGGACGGCGGAAATAAAGTTGCAAACGTCGT GACGCTTGGCGGCGCGAACCGTTTGACGACAGGCAAGGCGCTTCCGGGAACA GATCCAAATCAAAAGATTTTATACACATCCATTTACAGCAGTGCCGATATGATTGTC ATGAATTACTTATCAAGATTAGATGGTGCTAGAAACGTTCAAATCCATGGCGTTGG ACACATCGGCCTTCTGTACAGCAGCCAAGTCAACAGCCTGATTAAAGAAGGGCT GAACGGCGGGGGCCAGAATACGAAT GLP1nucleotidesequence SEQIDNO:53 CATGCAGAAGGCACCTTTACCAGCGATGTTAGCAGCTATCTGGAAGGTCAGGCA GCAAAAGAATTTATTGCATGGCTGGTTAAAGGTCGTGGT