Therapeutic Agent For Diseases Associated With Abnormalities In Dystroglycan Sugar Chain Modification And Method For Assaying Associated Enzyme
20200188491 ยท 2020-06-18
Inventors
- Tatsushi Toda (Hyogo, JP)
- Kazuhiro Kobayashi (Hyogo, JP)
- Motoi Kanagawa (Hyogo, JP)
- Tamao Endo (Tokyo, JP)
- Hiroshi Manya (Tokyo, JP)
- Yoshinao Wada (Osaka, JP)
- Michiko Tajiri (Osaka, JP)
Cpc classification
G01N33/50
PHYSICS
A61P21/00
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
G01N2400/38
PHYSICS
International classification
Abstract
Provided is a therapeutic agent that effectively acts on a disease associated with abnormal glycosylation of dystroglycan. Also provided is a testing method for diseases associated with abnormal glycosylation of dystroglycan. Specifically, provided is a therapeutic agent for diseases associated with abnormal glycosylation of dystroglycan, containing CDP-ribitol as an active ingredient. Ribitol-phosphate is important in the glycan structure of dystroglycan. In order for ribitol-phosphate to be incorporated into a dystroglycan glycan, a material therefor (sugar donor) is required. In the present invention, it has been found for the first time that CDP-ribitol serves as the sugar donor. It has been confirmed that the glycan of ISPD-deficient cells can be restored by administering CDP-ribitol. Thus, the present invention, which allows CDP-ribitol to be utilized for supplementation therapy, has been completed.
Claims
1. A therapeutic agent for diseases associated with abnormal glycosylation of dystroglycan, comprising CDP-ribitol as an active ingredient.
2. The therapeutic agent according to claim 1, wherein the disease associated with abnormal glycosylation of dystroglycan comprises a disease that occurs in association with an abnormality in any one gene selected from ISPD, FKRP, fukutin, POMT1, POMT2, DAG1, LARGE, DPM1, DPM2, DPM3, B3GALNT2, GMPPB, TMEM5, POMK, DOLK, POMGNT1, POMGNT2, and B4GAT1.
3. The therapeutic agent according to claim 1, wherein the abnormal glycosylation of dystroglycan comprises an abnormality in ribitol-phosphate in a dystroglycan glycan.
4. The therapeutic agent according to claim 1, wherein the disease associated with abnormal glycosylation of dystroglycan comprises -dystroglycanopathy.
5. The therapeutic agent according to claim 4, wherein the -dystroglycanopathy comprises any one selected from Fukuyama muscular dystrophy, Walker-Warburg syndrome, muscle-eye-brain disease (MEB), limb-girdle muscular dystrophy type 2I, limb-girdle muscular dystrophy type 2M, and cardiomyopathy.
6. The therapeutic agent according to claim 2, wherein the disease associated with abnormal glycosylation of dystroglycan comprises a disease that causes an abnormality in biosynthesis of a laminin-binding glycan in association with an abnormality in an ISPD gene.
7. (canceled)
8. (canceled)
9. (canceled)
10. (canceled)
11. An assay method for FKRP activity, comprising the following steps: 1) a step of performing a reaction by adding a specimen to a system including GalNAc1-3GlcNAc having added thereto one molecule of ribitol-phosphate as a substrate and CDP-ribitol as a sugar donor; and 2) a step of assaying GalNAc1-3GlcNAc containing two molecules of ribitol-phosphate serving as a reaction product.
12. (canceled)
13. (canceled)
14. (canceled)
15. (canceled)
16. (canceled)
17. (canceled)
18. (canceled)
19. (canceled)
20. (canceled)
21. A method for treating a patient having a disease associated with abnormal glycosylation of dystroglycan, said method comprising administering a formulation that comprises CDP-ribitol to said patient.
22. The method of claim 21, wherein the disease occurs in association with an abnormality in any one gene selected from ISPD, FKRP, fukutin, POMT1, POMT2, DAG1, LARGE, DPM1, DPM2, DPM3, B3GALNT2, GMPPB, TMEM5, POMK, DOLK, POMGNT1, POMGNT2, and B4GAT1.
23. The method of claim 21, wherein the abnormal glycosylation of dystroglycan comprises an abnormality in ribitol-phosphate in a dystroglycan glycan.
24. The method of claim 21, wherein the disease associated with abnormal glycosylation of dystroglycan comprises -dystroglycanopathy.
25. The method of claim 24, wherein the -dystroglycanopathy comprises any one selected from Fukuyama muscular dystrophy, Walker-Warburg syndrome, muscle-eye-brain disease (MEB), limb-girdle muscular dystrophy type 2I, limb-girdle muscular dystrophy type 2M, and cardiomyopathy.
26. The method of claim 21, wherein the disease associated with abnormal glycosylation of dystroglycan comprises a disease that causes an abnormality in biosynthesis of a laminin-binding glycan in association with an abnormality in an ISPD gene.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
DESCRIPTION OF EMBODIMENTS
[0060] The present invention relates to a therapeutic agent that effectively acts on a disease associated with abnormal glycosylation of dystroglycan. As such therapeutic agent, CDP-ribitol is contained as an active ingredient.
[0061] As used herein, the term abnormal glycosylation of dystroglycan refers to a quantitative abnormality as well as a structural abnormality in a dystroglycan glycan. As sugars serving as constituent components of a dystroglycan glycan, there are given, for example, glucuronic acid, xylose, ribitol-phosphate, galactosamine, glucosamine, and mannose phosphate. In particular, ribitol-phosphate is important. In order for ribitol-phosphate to be incorporated into the dystroglycan glycan, a material therefor (sugar donor) is required. In the present invention, it has been confirmed for the first time that CDP-ribitol serves as the sugar donor, and that ISPD is a mammalian CDP-ribitol synthase (see
[0062] As used herein, the term disease associated with abnormal glycosylation of dystroglycan refers to, for example, a disease associated with a structural and/or quantitative abnormality in a dystroglycan glycan. Of the -dystroglycan (-DG) and -dystroglycan (-DG) subunits constituting dystroglycan, -DG is subjected to a high degree of glycosylation. -DG plays a role in binding to a ligand, such as laminin, neurexin, or agrin, as an extracellular subunit to connect the basement membrane and the cytoskeleton (see
[0063] As responsible genes for the disease associated with abnormal glycosylation of dystroglycan of the present invention, there are given, for example, ISPD, FKRP, fukutin, POMT1, POMT2, DAG1, LARGE, DPM1, DPM2, DPM3, B3GALNT2, GMPPB, TMEM5, POMK, DOLK, POMGNT1, POMGNT2, and B4GAT1. Preferred examples thereof include ISPD, FKRP, and fukutin. The disease associated with abnormal glycosylation of dystroglycan of the present invention also encompasses a disease that occurs in association with an abnormality caused by, for example, the deletion of any one gene selected from the genes listed above, a mutation therein, or reduced expression thereof due to an epigenetic change. As the disease associated with abnormal glycosylation of dystroglycan, there has been reported, for example, renal cancer. In those diseases and the like, abnormalities in LARGE2 and ISPD have been observed (Miller et al. Molecular Cancer (2015) 14: 141). In addition, muscle weakness or the like due to dilated cardiomyopathy caused by an abnormality in the fukutin gene has also been reported (Non Patent Literature 1). Any disease other than the diseases specifically shown above is also encompassed as the target disease of the present invention as long as the disease occurs in association with an abnormality in any of the genes listed above. In particular, the disease is a disease that causes an abnormality in biosynthesis of a laminin-binding glycan in association with an abnormality in the ISPD gene. In addition, the therapeutic agent containing CDP-ribitol as an active ingredient of the present invention can effectively act in the case of not only an ISPD mutant, but also a fukutin or FKRP mutant, or a mutation in a gene that influences ribitol-phosphate in glycosylation of dystroglycan.
[0064] The therapeutic agent of the present invention contains CDP-ribitol as an active ingredient. Herein, the CDP-ribitol to be contained as the active ingredient may be a compound having a structure represented by the following formula (I), a derivative of the compound, or a pharmaceutically acceptable salt or hydrate of the compound or the derivative of the compound.
##STR00001##
[0065] The therapeutic agent of the present invention contains CDP-ribitol as an active ingredient, and may be formulated by appropriately blending a pharmaceutically acceptable carrier or additive. The blending ratio of the carrier or the additive only needs to be appropriately set on the basis of a range that is generally adopted in the field of pharmaceuticals. The carrier or the additive that may be blended is not particularly limited, and examples thereof include: various carriers, such as water, physiological saline, other aqueous solvents, and an aqueous or oily base; and various non-toxic additives, such as an excipient, a binder, a pH adjusting agent, a disintegrant, an absorption promoter, a lubricant, a colorant, a flavoring substance, a perfume, an antiseptic, a tonicity agent, a stabilizer, a dispersant, an antioxidant, and a buffer. Examples of the non-toxic additive include starch, gelatin, glucose, lactose, fructose, maltose, magnesium carbonate, talc, magnesium stearate, methyl cellulose, carboxymethyl cellulose, gum arabic, polyethylene glycol, propylene glycol, petrolatum, glycerin, ethanol, syrup, sodium chloride, sodium sulfite, sodium phosphate, citric acid, and polyvinylpyrrolidone.
[0066] The therapeutic agent of the present invention may be used by being administered to a patient with the disease associated with abnormal glycosylation of dystroglycan described above to treat the disease and/or alleviate symptoms associated with the disease. An administration route is not particularly limited, but may be oral administration or parenteral administration.
[0067] The therapeutic agent of the present invention only needs to be formulated into a dosage form suitable for each administration method. As a formulation form for the oral administration, there are given, for example, a tablet, a capsule, a granule, a powder, a fine granule, a pill, a troche, a sublingual tablet, a suppository, an ointment, an emulsion, a suspension, and a syrup. For the parenteral administration, there are given an injection and a transdermal formulation. The injection may be, for example, intravenously administered, subcutaneously administered, or intramuscularly administered, and the transdermal formulation may be locally administered by, for example, transdermal administration or transmucosal administration. Another drug may be incorporated into the formulation in order to reinforce or enhance the usefulness of the present invention.
[0068] The dose of the therapeutic agent of the present invention varies depending on the severity of the target disease, a therapeutic purpose, and the like, and also varies depending on the dosage form, the administration route, and the age and body weight of the patient. For example, when administered as an injection, the therapeutic agent may be administered at from about 0.01 mg to about 60 g, preferably from about 0.1 mg to about 24 g, more preferably from about 0.1 mg to about 6 g per day. An administration interval may be set to an interval of from 1 time to several times per day, or from 1 day to 2 weeks.
[0069] The therapeutic agent of the present invention may be used for a patient with the disease associated with abnormal glycosylation of dystroglycan described above simultaneously with, or before or after a drug that acts by a different action mechanism, such as an antisense nucleic acid disclosed in Patent Literature 1 (JP 2015-91229 A) (antisense nucleic acid containing a sequence complementary to the base sequence of pre-mRNA for an insertion mutant fukutin gene, for treatment).
[0070] The present invention also encompasses a testing method for muscular dystrophy, including detecting an abnormality in ribitol-phosphate in a dystroglycan glycan. Examples of the muscular dystrophy include FCMD, dystrophinopathy (Duchenne/Becker muscular dystrophy), limb-girdle muscular dystrophy, facioscapulohumeral muscular dystrophy, Emery-Dreifuss muscular dystrophy, oculopharyngeal CDP-ribitol type muscular dystrophy, and myotonic dystrophy. Some muscular dystrophies are due to causes different from the abnormal glycosylation of dystroglycan. When the disease type of the muscular dystrophy is determined through the detection of an abnormality in ribitol-phosphate in the dystroglycan glycan in a patient with muscular dystrophy, a more appropriate therapeutic method can be selected.
[0071] Further, the present invention also encompasses an assay method for fukutin activity or FKRP activity. In the present invention, the activity of each of fukutin and FKRP has been confirmed, and as a result, it is considered that fukutin and FKRP each have ribitol transferase activity, and specifically, are each a transferase that binds Rbo5P into a glycan using Rbo5P from CDP-ribitol to synthesize a glycan. Fukutin has enzymatic activity shown in
[0072] The enzymatic activity of fukutin may be assayed by, for example, a method including the following steps 1) and 2). Core M3 is part of the glycans constituting the dystroglycan glycan, and contains GalNAc1-3GlcNAc as a glycan.
1) A step of performing a reaction by adding a specimen to a system including GalNAc1-3GlcNAc as a substrate and CDP-ribitol as a sugar donor; and
2) a step of assaying GalNAc1-3GlcNAc containing one molecule of ribitol-phosphate serving as a reaction product.
[0073] 1) A step of performing a reaction by adding a specimen to a system including a phosphorylated Core M3-modified peptide as a substrate and CDP-ribitol as a sugar donor; and
[0074] 2) a step of assaying a phosphorylated Core M3-modified peptide containing one molecule of ribitol-phosphate serving as a reaction product.
[0075] An example of the peptide sequence of the phosphorylated Core M3-modified peptide in the step 1) is Ac-AT(Man)PAPVAAIGPK-NH.sub.2 (SEQ ID NO: 2).
[0076] Through the utilization of the assay method for fukutin activity, a compound that influences the activity of fukutin may be selected by allowing fukutin and a candidate compound to act. This may be performed by, for example, a method including the following steps 1) and 2).
[0077] 1) A step of performing a reaction by adding secretion-type fukutin and a candidate compound to a system including GalNAc1-3GlcNAc as a substrate and CDP-ribitol as a sugar donor; and
[0078] 2) a step of assaying GalNAc1-3GlcNAc containing one molecule of ribitol-phosphate serving as a reaction product.
[0079] 1) A step of performing a reaction by adding secretion-type fukutin and a candidate compound to a system including a phosphorylated Core M3-modified peptide as a substrate and CDP-ribitol as a sugar donor; and
2) a step of assaying a phosphorylated Core M3-modified peptide containing one molecule of ribitol-phosphate serving as a reaction product.
[0080] An example of the peptide sequence of the phosphorylated Core M3-modified peptide in the step 1) is Ac-AT (Man) PAPVAAIGPK-NH.sub.2 (SEQ ID NO: 2). In the above-mentioned steps 1) and 2), a system including no candidate compound in the step 1) may be assayed as a control. When the candidate compound has an action of enhancing the activity of fukutin, the reaction product shows a higher value than the control, and when the candidate compound has an action of reducing the activity of fukutin, the reaction product shows a lower value than the control.
[0081] For example, gene information on human fukutin is disclosed in GenBank RefSeq: NM_006731 (SEQ ID NO: 3), and its amino acid sequence is identified by the following SEQ ID NO: 4. Secretion-type fukutin is fukutin without a transmembrane domain, and is also extracellular secretion-type fukutin. Secretion-type fukutin may be generated by being expressed as a secretion-type recombinant obtained by removing the transmembrane domain of fukutin. Secretion-type fukutin has, for example, a structure containing the sequence from Tyr28 to the stop codon in the amino acid sequence set forth in SEQ ID NO: 4. To its N-terminus, an amino acid sequence set forth in SEQ ID NO: 5 may be added. The sequence set forth in SEQ ID NO: 5 is the signal sequence of Gaussia luciferase, His/myc tags, restriction enzyme site.
TABLE-US-00003 AminoAcidSequenceofHumanFukutin (SEQIDNO:4) MSRINKNVVLALLTLTSSAFLLFQLYYYKHYLSTKNGAGLSKSKGSRIGF DSTQWRAVKKFIMLTSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTSQ CKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGI DSLSGTEIPLHYICKLATHAIHLVVFHERSGNYLWHGHLRLKEHIDRKFV PFRKLQFGRYPGAFDRPELQQVTVDGLEVLIPKDPMHFVEEVPHSRFIEC RYKEARAFFQQYLDDNTVEAVAFRKSAKELLQLAAKTLNKLGVPFWLSSG TCLGWYRQCNIIPYSKDVDLGIFIQDYKSDIILAFQDAGLPLKHKFGKVE DSLELSFQGKDDVKLDVFFFYEETDHMWNGGTQAKTGKKFKYLFPKFTLC WTEFVDMKVHVPCETLEYIEANYGKTWKIPVKTWDWKRSPPNVQPNGIWP ISEWDEVIQLY AdditionalSequence (SEQIDNO:5) MGVKVLFALICIAVAEAKPTHHHHHHEQKLISEEDLRNS
[0082] The enzymatic activity of FKRP may be assayed by, for example, a method including the following steps 1) and 2) as with the enzymatic activity of fukutin described above.
1) A step of performing a reaction by adding a specimen to a system including GalNAc1-3GlcNAc having added thereto one molecule of ribitol-phosphate as a substrate and CDP-ribitol as a sugar donor; and
2) a step of assaying GalNAc1-3GlcNAc containing two molecules of ribitol-phosphate serving as a reaction product.
[0083] 1) A step of performing a reaction by adding a specimen to a system including a phosphorylated Core M3-modified peptide having added thereto one molecule of ribitol-phosphate as a substrate and CDP-ribitol as a sugar donor; and
[0084] 2) a step of assaying a phosphorylated Core M3-modified peptide containing two molecules of ribitol-phosphate serving as a reaction product.
[0085] An example of the peptide sequence of the phosphorylated Core M3-modified peptide in the step 1) is Ac-AT(Man)PAPVAAIGPK-NH.sub.2 (SEQ ID NO: 2).
[0086] Through the utilization of the assay method for FKRP activity, a compound that influences the activity of FKRP may be selected by allowing FKRP and a candidate compound to act. This may be performed by, for example, a method including the following steps 1) and 2).
[0087] 1) A step of performing a reaction by adding secretion-type FKRP and a candidate compound to a system including GalNAc1-3GlcNAc having added thereto one molecule of ribitol-phosphate as a substrate, and CDP-ribitol as a sugar donor; and
[0088] 2) a step of assaying GalNAc1-3GlcNAc containing two molecules of ribitol-phosphate serving as a reaction product.
[0089] 1) A step of performing a reaction by adding secretion-type FKRP and a candidate compound to a system including a phosphorylated Core M3-modified peptide having added thereto one molecule of ribitol-phosphate as a substrate, and CDP-ribitol as a sugar donor; and
[0090] 2) a step of assaying a phosphorylated Core M3-modified peptide containing two molecules of ribitol-phosphate serving as a reaction product.
[0091] An example of the peptide sequence of the phosphorylated Core M3-modified peptide in the step 1) is Ac-AT (Man) PAPVAAIGPK-NH.sub.2 (SEQ ID NO: 2). In the above-mentioned steps 1) and 2), a system including no candidate compound in the step 1) is assayed as a control. When the candidate compound has an action of enhancing the activity of FKRP, the reaction product shows a higher value than the control, and when the candidate compound has an action of reducing the activity of FKRP, the reaction product shows a lower value than the control.
[0092] For example, gene information on human FKRP is disclosed in GenBank RefSeq: NM_024301 (SEQ ID NO: 6), and its amino acid sequence is identified by the following SEQ ID NO: 7. Secretion-type FKRP is FKRP without a transmembrane domain, and is also extracellular secretion-type FKRP. Secretion-type FKRP may be generated by being expressed as a secretion-type recombinant obtained by removing the transmembrane domain of FKRP. Secretion-type FKRP has, for example, a structure containing the sequence from Asn33 to the stop codon in the amino acid sequence set forth in SEQ ID NO: 7. To its N-terminus, an amino acid sequence set forth in SEQ ID NO: 8 may be added. The sequence set forth in SEQ ID NO: 8 is the signal sequence of murine preprotrypsin, His/myc tags.
TABLE-US-00004 AminoAcidSequenceofHumanFKRP (SEQIDNO:7) MRLTRCQAALAAAITLNLLVLFYVSWLQHQPRNSRARGPRRASAAGPRVT VLVREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPRIPNVR LALLQPALDRPAAASRPETYVATEFVALVPDGARAEAPGLLERMVEALRA GSARLVAAPVATANPARCLALNVSLREWTARYGAAPAAPRCDALDGDAVV LLRARDLFNLSAPLARPVGTSLFLQTALRGWAVQLLDLTFAAARQPPLAT AHARWKAEREGRARRAALLRALGIRLVSWEGGRLEWFGCNKETTRCFGTV VGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGSLLGA ARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEG DFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQPLV PLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSLTGSG AdditionalSequence (SEQIDNO:8) MSALLILALVGAAVADYKHHHHHHEQKLISEEDLR
[0093] The enzymatic reaction of fukutin or FKRP is achieved by, for example, performing the reaction under the temperature condition of 371 C. for from 5 minutes to 48 hours, preferably from 1 hour to 24 hours. Fukutin specifically has enzymatic activity shown in
[0094] The reaction product obtained by the enzymatic reaction of fukutin or FKRP, such as the phosphorylated Core M3 containing one molecule of ribitol-phosphate or the phosphorylated Core M3-modified peptide containing two molecules of ribitol-phosphate, may be assayed by a method known per se, such as HPLC, mass spectrometry, LC/MS, or radioisotope-labeled CDP-ribitol, or any method to be developed in the future.
[0095] The present invention also encompasses the secretion-type fukutin or secretion-type FKRP described above. A reagent containing secretion-type fukutin (hereinafter referred to as secretion-type fukutin reagent) or a reagent containing secretion-type FKRP (hereinafter referred to as secretion-type FKRP reagent) may be effectively used in an assay system for the enzymatic reaction of fukutin or FKRP, and may be used for, for example, screening of compounds. The secretion-type fukutin reagent or secretion-type FKRP reagent that may be used for such assay system may also be used as a respective authentic enzyme sample for assay.
[0096] The present invention further encompasses a kit for fukutin activity assay and a kit for FKRP assay. Each of those kits for activity assay includes at least a reagent for a substrate as a component, and may include, as a component, a reagent containing a sugar donor and/or a reagent containing an enzyme source.
[0097] The kit for fukutin activity assay may include the following as components. As the reagent for a substrate, any one of a reagent containing GalNAc1-3GlcNAc (hereinafter referred to as GalNAc1-3GlcNAc reagent) or a reagent containing a phosphorylated Core M3-modified peptide (hereinafter referred to as phosphorylated Core M3-modified peptide reagent) may be selected. An example of the peptide sequence of the phosphorylated Core M3-modified peptide is Ac-AT (Man) PAPVAAIGPK-NH.sub.2 (SEQ ID NO: 2). An example of the reagent containing a sugar donor is a reagent containing CDP-ribitol (hereinafter referred to as CDP-ribitol reagent). As the reagent containing an enzyme source, a reagent containing secretion-type fukutin (hereinafter referred to as secretion-type fukutin reagent) may be used. For example, when only fukutin activity in a specimen is to be assayed, the secretion-type fukutin reagent may not be used. In addition, in, for example, the case of confirming the activity of a compound that influences the activity of fukutin, the secretion-type fukutin reagent may be used. The secretion-type fukutin reagent may also be used as an authentic enzyme sample for fukutin.
[0098] The kit for FKRP activity assay may include the following as components. As the reagent for a substrate, any one of a reagent containing GalNAc1-3GlcNAc having added thereto one molecule of ribitol-phosphate (hereinafter referred to as ribitol-phosphate 1 GalNAc1-3GlcNAc reagent) or a reagent containing a phosphorylated Core M3-modified peptide having added thereto one molecule of ribitol-phosphate (hereinafter referred to as ribitol-phosphate 1 phosphorylated Core M3-modified peptide reagent) may be selected. An example of the peptide sequence of the phosphorylated Core M3-modified peptide is Ac-AT(Man)PAPVAAIGPK-NH.sub.2 (SEQ ID NO: 2). An example of the reagent containing a sugar donor is a reagent containing CDP-ribitol (hereinafter referred to as CDP-ribitol reagent). As the reagent containing an enzyme source, a reagent containing secretion-type FKRP (hereinafter referred to as secretion-type FKRP reagent) may be used. For example, when only FKRP activity in a specimen is to be assayed, the secretion-type FKRP reagent may not be used. In addition, in, for example, the case of confirming the activity of a compound that influences the activity of FKRP, the secretion-type FKRP reagent may be used. The secretion-type FKRP reagent may also be used as an authentic enzyme sample for FKRP.
[0099] The dystroglycan glycan may be analyzed using cells deficient or mutated in a gene for any one of ISPD, fukutin, and FKRP. The cells deficient or mutated in a gene for any one of ISPD, fukutin, and FKRP may be generated by a technique such as genome editing. Cells deficient in the gene or cells mutated in the gene may be generated. In addition, in place of the cells deficient or mutated in a gene for any one of ISPD, fukutin, and FKRP, cells derived from a patient accompanied by abnormal glycosylation of dystroglycan may also be used. The glycan state of dystroglycan may be confirmed by adding CDP-ribitol (alone, or a mixture with a nucleic acid transfection reagent) to the cells deficient or mutated in a gene for any one of ISPD, fukutin, and FKRP, or the cells derived from a patient accompanied by abnormal glycosylation of dystroglycan, culturing the cells, and then collecting the cells. When a candidate compound considered to have an effect on the formation of the glycan of dystroglycan is allowed to act on such assay system, the effect of the candidate compound may be tested using the glycan state of dystroglycan as an indicator. The glycan state of dystroglycan may be confirmed by applying a method known per se, such as a western blot method or an immunostaining method, or by applying a method to be developed in the future.
EXAMPLES
[0100] The present invention is described in detail below by way of Reference Examples and Examples for a better understanding of the present invention. However, the present invention is by no means limited to these Examples.
Reference Example 1
[0101] In this Reference Example, the details of the structural analysis of a dystroglycan glycan, which has led to the completion of the present invention, and the preparation of dystroglycan for mass spectrometry for the analysis of the glycan structure are described.
[0102] For the purpose of the structural analysis of the dystroglycan glycan, it was difficult to secure a sample amount required for the analysis from a biological tissue. Meanwhile, with regard to a recombinant capable of securing a large sample amount, there were also problems in that: even when cultured cells were caused to express recombinant dystroglycan, the efficiency with which the recombinant dystroglycan was modified with a glycan having physiological activity similar to that of dystroglycan in a biological tissue was extremely low; and the recombinant dystroglycan had a glycan structure different from that in a living body. Further, another factor making the glycan analysis difficult was that dystroglycan had about 40 sites of serine/threonine residues at which glycosylation could occur, and had high nonuniformity in glycosylation.
[0103] In view of the foregoing, first, a search was made for a cell line capable of modifying recombinant dystroglycan with a physiological glycan similar to that of dystroglycan in a biological tissue. As a result, it was found that, in NIH3T3 cells, recombinant dystroglycan was modified with a physiological glycan with high efficiency.
[0104] On the basis of the foregoing, a recombination operation was employed to design wild-type (WT) dystroglycan limited to an N-terminal globular domain (amino acid No. 1 to 313) of dystroglycan and 20 amino acids (amino acid No. 314 to 333 of dystroglycan) including a total of five serine and threonine residues at glycosylation positions (present in a mucin domain subsequent to the N-terminal globular domain). In the maturation process of dystroglycan, the N-terminal globular domain is subjected to cleavage processing at amino acid 310, and hence is not present in mature dystroglycan used in the analysis. That is, the dystroglycan used for analysis is constituted of amino acid No. 311 to 333. Separately, a mutant (T190M) in which amino acid 190 in the N-terminal globular domain of dystroglycan was mutated from threonine to methionine was also created. The mutation site at position 190 is not included in the glycosylation domain, but the mutant mutated at position 190 is not modified with part of the physiological glycan, specifically, a repeating structure (Xyl-GlcA repeat) containing a disaccharide of xylose (Xyl) and glucuronic acid (GlcA) as a unit. Further, a mutant (T320K) capable of being more fragmented by lysine-cleaving enzymatic treatment, in which amino acid 320 was mutated from threonine to lysine by introducing a lysine residue into the sequence of 20 amino acids, was also created. Recombinant dystroglycan not particularly limited to, for example, the wild type or a mutant type is hereinafter referred to simply as rDG, the wild-type dystroglycan whose glycosylation positions are limited to 20 amino acids (amino acid No. 314 to 333 of dystroglycan) is hereinafter referred to as DG.sup.WT, and each mutant dystroglycan is hereinafter referred to as DG.sup.T190M or DG.sup.T320K. Those recombinant dystroglycans including an Fc tag serving as a PreScission cleavage sequence at the C-terminus are respectively referred to as DGFc, DGFc.sup.WT, DGFc.sup.T190M, and DGFc.sup.T320K.
[0105] An NIH3T3 stable expression cell line expressing rDG was established. As a result, DG.sup.WT and DG.sup.T320K were each confirmed to be modified with a physiological glycan, but DG.sup.T190M did not undergo physiological glycosylation.
[0106] The rDG stable expression NIH3T3 cells were cultured in a BelloCell culture apparatus for 1 week, and the culture supernatant was collected. DGFc was collected from the culture supernatant using Protein A-beads. Then, the Fc tag portion was cleaved by PreScission enzyme treatment, the Fc tag portion was removed with Protein A-beads, and PreScission Protease was removed with glutathione-beads. The rDG also contains glycans other than the glycan having physiological activity. However, sialic acids and O-GalNAc-type glycans were removed by O-glycosidase treatment and 2,3,6,8,9-neuraminidase treatment. Further, the rDG was fractionated by ammonium acetate elution (stepwise elution of 0.1 M, 0.25 M, 0.5 M, and 0.75 M) through an ion-exchange column, and was used as a sample for glycan structure analysis.
[0107] The glycan structure analysis was performed by mass spectrometry using MALDI-TOF. As a mass spectrometer, a MALDI-TOF mass spectrometer (Applied Biosystems) was used. For DG.sup.WT, signals at an interval corresponding to a mass of 308, representing modification with the Xyl-GlcA repeat, were detected in a high-concentration ammonium acetate elution fraction, and hence it was revealed that DG.sup.WT was modified with a physiological glycan. Meanwhile, for DG.sup.T190M, the Xyl-GlcA repeat was not found, but instead, a peak representing a mass of 6,138 was obtained. The glycopeptide having a mass of 6,138 is one not modified with only the Xyl-GlcA repeat structure. The physiologically active glycan is supposed to be bound to a core glycan via a phosphodiester linkage. When the DG.sup.WT glycopeptide was treated with hydrogen fluoride for chemically cleaving the phosphodiester linkage, a glycopeptide having a mass of 5,402 was obtained. That is, the presence of a glycan having a mass of 736 obtained as the difference of 6,138-5,402 was found.
[0108] The constituent components of the glycan having a mass of 736 were analyzed using a hybrid mass spectrometry system including two analyzers, i.e., a linear ion trap (LTQ) and an electric field-type Fourier transform mass spectrometry mechanism (Orbitrap) (LTQ XL ion trap mass spectrometer, Thermo Fisher Scientific), and as a result, it was revealed that one Xyl-GlcA unit, and two units having masses of 134 and 80 were present. Precise mass spectrometry of the components having masses of 134 and 80 found that 134 corresponded to a molecule having the chemical formula C.sub.5H.sub.12O.sub.5, and 80 corresponded to phosphate. The compound of C.sub.5H.sub.12O.sub.5 is any one of ribitol, xylitol, and arabitol. Accordingly, the monosaccharide composition of rDG was analyzed using each of the compounds as a standard substance, and as a result, it was revealed that the dystroglycan contained ribitol.
[0109] Thus, it was revealed that the structure having a mass of 736 connecting the core glycan and the Xyl-GlcA repeat was ribitol-phosphate-ribitol-phosphate-Xyl-GlcA. In addition, it was confirmed that DG.sup.T320K also contained ribitol-phosphate. The presence of ribitol-phosphate had been found only in a very few bacteria and a plant (relative of Adonis ramosa), and ribitol-phosphate had not been found in mammals. In view of this, through the following Examples, responsible genes for diseases associated with abnormal glycosylation of dystroglycan and the mechanism for the incorporation of ribitol-phosphate into a glycan were analyzed.
(Example 1) Action of ISPD
[0110] In this Example, with regard to ISPD serving as one of the responsible genes for muscular dystrophy, its function in glycosylation of dystroglycan was confirmed.
[0111] 1. Reaction with Normal ISPD
[0112] In bacteria, CDP-ribitol is synthesized by a reaction between ribitol-phosphate (ribitol 5-phosphate: Rbo5P) and CTP. In this Example, the action of ISPD was investigated as to whether it was possible to synthesize CDP-ribitol from ribitol-phosphate using CTP as a substrate. His-tagged human ISPD was generated by a recombination operation, and used as an enzyme source. Gene information on human ISPD is disclosed in RefSeq: NM_001101426. The generated human ISPD was mixed with ribitol-phosphate and CTP to cause an enzymatic reaction, and the enzymatic reaction product was analyzed by HPLC. The enzymatic reaction was performed under the following conditions: human ISPD was subjected to a reaction in a total of 40 l of a reaction solution containing 100 mM MOPS-NaOH (pH 7.4), 10 mM MgCl.sub.2, 1 mM CTP, and 2 mM Rbo5P at 37 C. for 2 hours. HPLC was performed using a 4.6150 mm COSMOSIL PBr column (Nacalai Tesque) under the conditions of isocratic elution with 3% methanol/97% triethylamine acetate (pH 7.3) at 30 C., and the enzymatic reaction product was detected at an absorbance of 254 nm. A peak found before the enzymatic reaction was CTP serving as the substrate, whereas after the enzymatic reaction, the peak of CTP decreased and CDP-ribitol was found as a new peak (left of
[0113] 2. Reaction with Mutant ISPD
[0114] For mutant ISPD according to ISPD-mutated patients (p.D156N, p.M213R, and p.T238I), each recombinant ISPD was generated and an enzymatic reaction was performed in the same manner as in the section 1. The amount of CDP-ribitol serving as the enzymatic reaction product was confirmed. As a result, a peak value representing CDP-ribitol was low as compared to that in the case where the reaction was performed with normal ISPD. It was confirmed that mutant ISPD provided a low synthesis amount of CDP-ribitol (right of
[0115] CDP-ribitol is important as a sugar donor substrate for ribitol-phosphate to be incorporated into a glycan. The results of this Example suggested that, while ISPD allowed the biosynthesis of CDP-ribitol, mutant ISPD caused a problem in the biosynthesis of CDP-ribitol, leading to a disease.
(Example 2) Action of Fukutin
[0116] In this Example, with regard to fukutin serving as one of the responsible genes for muscular dystrophy, its function in glycosylation of dystroglycan was confirmed.
[0117] 1. Reaction with Normal Fukutin
[0118] The action of fukutin on the synthesis of a dystroglycan glycan was investigated. Human fukutin was generated by a recombination operation. Gene information on human fukutin is disclosed in RefSeq: NM 006731. Fukutin was expressed as a secretion-type recombinant by removing the transmembrane domain. CDP-ribitol serving as a sugar donor substrate (donor for ribitol-phosphate) and a phosphorylated Core M3-modified peptide serving as a sugar acceptor substrate were mixed with the generated secretion-type human fukutin to cause an enzymatic reaction, and the enzymatic reaction product was analyzed by HPLC. The enzymatic reaction was performed under the following conditions: 25 l of human fukutin bound to agarose beads was subjected to a reaction in a total of 50 l of a reaction solution containing 100 mM MES (pH 6.5), 0.5 mM CDP-Rbo, 0.1 mM phosphorylated Core M3-modified peptide, 10 mM MnCl.sub.2, 10 mM MgCl.sub.2, and 0.5% Triton X-100 at 37 C. for 16 hours. The enzymatic reaction product was separated by reversed-phase HPLC using a 5250 mm Mightysil RP-18GP Aqua column (Kanto Chemical). With the use of 0.1% trifluoroacetic acid (TFA)-containing distilled water as solvent A and 0.1% TFA-containing acetonitrile as solvent B, the enzymatic reaction product was eluted under the conditions of a flow rate of 1 ml/min and a linear concentration gradient of 0%-40% solvent B. The eluate was detected at an absorbance of 214 nm. Herein, Core M3 refers to part of the glycans constituting the dystroglycan glycan, and is formed of GalNAc1-3GlcNAc1-4Man(see
[0119] The structure of the Product 1 was analyzed by mass spectrometry, and as a result, it was confirmed that Product 1 was a phosphorylated Core M3-modified peptide containing one molecule of ribitol-phosphate (second from the top left of
[0120] 2. Reaction with Mutant Fukutin
[0121] For mutant fukutin according to fukutin-mutated patients (p.M133T and p.R307Q), secretion-type recombinant fukutin was generated in the same manner as in the section 1, and an enzymatic reaction was performed in the same manner. In the case of p.M133T mutant fukutin, a peak amount representing Product 1 as the enzymatic reaction product was low as compared to that in the case of normal fukutin (third from the top left of
[0122] The enzymatic reaction product was analyzed by nuclear magnetic resonance (NMR) to identify a position to which ribitol-phosphate was bound. The analysis was performed by one-dimensional .sup.1H-.sup.13C (HSQC) and two-dimensional .sup.1H-.sup.31P (HMBC). The results suggested that fukutin was a transferase for transferring Rbo5P from CDP-ribitol to the GalNAc-3 position in a glycan to synthesize a glycan (GalNAc-3 Rbo5P transferase).
(Example 3) Action of FKRP
[0123] In this Example, with regard to FKRP serving as one of the responsible genes for muscular dystrophy, its function in glycosylation of dystroglycan was confirmed.
[0124] 1. Reaction with Normal FKRP
[0125] The action of FKRP on the synthesis of a dystroglycan glycan was investigated. Human FKRP was generated by a recombination operation. Gene information on human FKRP is disclosed in RefSeq: NM 024301. In the same manner as in Example 2, FKRP was expressed as a secretion-type recombinant by removing the transmembrane domain. In the same manner as in Example 2, CDP-ribitol serving as a sugar donor substrate (donor for ribitol-phosphate), and the glycopeptide containing one molecule of ribitol-phosphate (Product 1) generated in Example 2 serving as a sugar acceptor substrate were mixed with the generated secretion-type human FKRP to cause an enzymatic reaction, and the enzymatic reaction product was analyzed by HPLC (
[0126] Before the reaction, only the peak of Product 1 was found (left figure of
[0127] 2. Reaction with Mutant FKRP
[0128] For p.Y307N mutant FKRP according to an FKRP-mutated patient, secretion-type recombinant FKRP was generated and an enzymatic reaction was performed in the same manner as in the section 1. In the case of mutant FKRP, a peak amount representing Product 2 as the enzymatic reaction product was low as compared to that in the case of normal FKRP, and the peak of Product 1 remained (third from the top left of
(Example 4) Ribitol-Phosphate Modification in Patient Model Cells
[0129] In this Example, modification with ribitol-phosphate in cells deficient in any one of ISPD, fukutin, or FKRP was confirmed. HAP1 cells deficient in each gene were generated using a CRISPR/CAS9 genome editing method, and were used as patient model cells. The deficiency mutation was confirmed by DNA sequencing. The kind of mutation is different from that of an actual patient, but the cells may be called model cells because of the same deficiency in gene function.
[0130] In each of the cells in the upper part of
(Example 5) Amelioration of Abnormal Glycosylation by CDP-Ribitol Administration
[0131] The results of Examples 1 and 4 have revealed that ISPD-deficient patients cannot biosynthesize CDP-ribitol in cells, and the abnormality in in vivo ribitol-phosphate modification results in the development of the disease associated with abnormal glycosylation of dystroglycan. In this Example, for HAP1 cells and HEK cells, cells deficient in ISPD were generated using a CRISPR/CAS9 genome editing method. The HAP1 cells are a haploid cell line derived from cultured human leukemia cells (KBM7), and are cells capable of being subjected to genome editing with high efficiency.
[0132] For the HAP1 cells and HEK cells of
INDUSTRIAL APPLICABILITY
[0133] As described in detail above, the therapeutic agent for diseases associated with abnormal glycosylation of dystroglycan, containing CDP-ribitol as an active ingredient, ameliorates the abnormal glycosylation, and as a result, effectively acts on the treatment of the disease and/or the amelioration of symptoms associated with the disease. The actions of the causative genes for the disease associated with abnormal glycosylation of dystroglycan have been confirmed, and the cause of the development of the disease has been elucidated. Thus, a contribution can be made to the development of a more effective therapeutic method for the target disease.
[0134] In the case of a patient with a mutation in fukutin or FKRP, it is considered that the enzymatic activity of fukutin or FKRP does not become zero owing to the mutation, and a little activity remains (when the activity becomes zero, the patient cannot survive, and hence is not born). In the case where even a little activity of fukutin or FKRP remains, when CDP-ribitol serving as a material for the enzymatic reaction of fukutin or FKRP is present in a large amount, the transfer and incorporation of ribitol-phosphate into the dystroglycan glycan is considered to proceed through the utilization of the remaining enzymatic activity. That is, CDP-ribitol supplementation therapy can be expected to exhibit an effect on not only the abnormality in the ISPD gene, but also the abnormality in the fukutin gene or the abnormality in the FKRP gene. In addition, even in the case of a gene other than ISPD, fukutin, and FKRP, as long as the gene influences ribitol-phosphate in glycosylation of dystroglycan, the therapeutic agent containing CDP-ribitol as an active ingredient of the present invention can effectively act also on a disease associated with abnormal glycosylation of dystroglycan caused by an abnormality in such gene.