NANONETS AND SPHERICAL PARTICLES
20200190148 ยท 2020-06-18
Inventors
- Andrew John Love (Dundee Tayside, GB)
- Mikhail Emmanuilovich Talianski (Dundee Tayside, GB)
- Kara McGeachy (Dundee Tayside, GB)
Cpc classification
C12N2770/00042
CHEMISTRY; METALLURGY
C07K2319/20
CHEMISTRY; METALLURGY
C12N2770/00022
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K2319/735
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to macromolecular complexes comprising micron-scale networks which include binding motifs thereon which allow the covalent bonding of the micron-scale networks to particles which provide nanoscale display surfaces. In particular the present invention relates to micron-scale networks of TMV coat proteins comprising a peptide tag (e.g. SpyTag) and particles providing a nanoscale display surface comprising GFP and a corresponding binding protein (e.g. SpyCatcher) wherein the peptide tag and binding protein pair are capable of spontaneously forming a covalent bond.
Claims
1. A macromolecular complex comprising a first and second complex wherein a) the first complex comprises a virus derived self-assembled micron scale structure which surface displays a motif for one of a peptide tag and binding protein pair that can spontaneously form covalent linkages with the second complex, and b) the second complex comprises a particle which surface displays a motif interacting partner encoding one of the corresponding peptide tag and binding protein pair.
2. The macromolecular complex as claimed in claim 1 comprising a) a first complex of a virus derived self-assembled micron scale structure comprising a motif for at least one peptide tag of the i) SpyCatcher/SpyTag, ii) SnoopCatcher/SnoopTag, iii) Steptococcus pyogenes split pilin N-terminal isopeptide tag/the Steptococcus pyogenes split pilin C-terminal isopeptide tag systems, and b) a second complex comprising a fluorescent particle comprising at least one binding protein of the i) SpyCatcher/SpyTag, ii) SnoopCatcher/SnoopTag, iii) the Steptococcus pyogenes split pilin N-terminal isopeptide tag/the Steptococcus pyogenes split pilin C-terminal isopeptide tag systems wherein the first complex is covalently linked to the second complex.
3. The macromolecular complex as claimed in claim 1 comprising a) a first complex of a virus derived self-assembled micron scale structure comprising a motif for at least one binding protein of the SpyCatcher/SpyTag, SnoopCatcher/SnoopTag, the Steptococcus pyogenes split pilin N-terminal isopeptide tag/the Steptococcus pyogenes split pilin C-terminal isopeptide tag systems, and b) a second complex comprising a fluorescent particle comprising at least one peptide tag of the SpyCatcher/SpyTag, SnoopCatcher/SnoopTag, the Steptococcus pyogenes split pilin N-terminal isopeptide tag/the Steptococcus pyogenes split pilin C-terminal isopeptide tag systems wherein the first complex is covalently linked to the second complex.
4. The macromolecular complex as claimed in any one of claims 1 to claim 3 wherein the first complex comprising a virus derived self-assembled micron scale structure is formed from virus protein aggregates.
5. The macromolecular complex as claimed in any one of claims 1 to 3 wherein the first complex comprising a virus derived self-assembled micron scale structure is formed from Virus Like Particles (VLP).
6. The macromolecular complex as claimed in any one of claims 1 to 5 wherein the virus derived self-assembled micron scale structure forms a self-assembled macromolecular network structure independently of the binding interaction between the peptide tag and binding protein.
7. The macromolecular complex as claimed in any one of claims 1 to 6 wherein the first complex of a virus derived micron scale structure comprises SpyTag and the second complex comprises green fluorescent particle (GFP) comprising SpyCatcher wherein the first complex is covalently linked to the second complex.
8. The macromolecular complex of claim 7 wherein the second complex comprises SpyCatcher wherein the SpyCatcher comprises the amino acid sequence TABLE-US-00002 (SEQIDNO:1) MSYYHHHHHHDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSAT HIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFV ETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI.
9. The macromolecular complex of any one of claims 1 to 8 wherein the second complex comprising GFP and SpyCatcher is at least around 50-100 nanometres in size.
10. The macromolecular complex comprising a first complex comprising a SpyTag decorated micron scale virus derived structure covalently linked to second complex comprising GFP and SpyCatcher wherein the SpyTag is capable of interacting with SpyCatcher in the temperatures range from 4 C. to 37 C. at a pH range 5 to 8.
11. The macromolecular complex as claimed in any preceding claim comprising a SpyTag decorated virus derived self-assembled micron scale structure covalently linked to a second complex comprising GFP comprising SpyCatcher wherein the SpyTag is provided to the N-terminus of a virus of the virus derived self-assembled micron scale structure.
12. The macromolecular complex as claimed in any preceding claim comprising a first complex comprising a SpyTag decorated virus derived self-assembled micron scale structure covalently linked to a second complex comprising GFP comprising SpyCatcher wherein the SpyTag is provided at the C-terminus of a virus of the virus derived self-assembled micron scale structure.
13. The macromolecular complex as claimed in any preceding claim comprising a first complex comprising a SpyTag decorated virus derived self-assembled micron scale structure covalently linked to a second complex comprising GFP comprising SpyCatcher wherein the SpyTag is provided intermediate to the N and C-terminus of a virus of the virus derived self-assembled micron scale structure.
14. The macromolecular complex as claimed in any preceding claim wherein the virus derived self-assembled micron scale structure comprises TMV, potato virus Y, potato virus X, tobacco rattle virus, or bacteriophage coat proteins.
15. The macromolecular complex as claimed in any preceding claim wherein the virus derived self-assembled micron scale structure is derived from TMV coat protein.
16. The macromolecular complex as claimed in any preceding claim wherein the virus derived self-assembled micron scale structure is rod-shaped.
17. The macromolecular complex as claimed in any preceding claims wherein the virus derived self-assembled micron scale structure comprises a SpyTag at the C-terminal end of a TMV coat protein.
18. The macromolecular complex as claimed in any preceding claims wherein the virus derived self-assembled micron scale structure comprises TMV wherein the TMV includes a modified coat protein E550Q and D77N.
19. The macromolecular complex as claimed in any preceding claim wherein the SpyTag comprises the amino acid sequence AHIVMVDAYKPTK (SEQ ID NO:3).
20. A nanoscale surface display system capable of binding to a first complex comprising a virus derived self-assembled micron scale structure wherein the virus derived self-assembled micron scale structure comprises a first member of a covalently reactive peptide tag and binding protein pair wherein the peptide tag and binding protein pair are capable of spontaneously forming a covalent bond, the nanoscale display surface comprising a second member of a covalently reactive peptide tag and binding protein pair that is capable of binding the first member to spontaneously form a covalent bond.
21. The nanoscale surface display system of claim 20 capable of binding to a first complex comprising SpyTag the nanoscale surface display system comprising green fluorescent protein and further comprising SpyCatcher.
22. The nanoscale surface display system of claim 20 capable of binding to a first complex comprising SpyCatcher the nanoscale surface display system comprising green fluorescent protein and further comprising SpyTag.
23. A nanoscale surface display system of claim 21 wherein the SpyCatcher comprises the amino acid sequence TABLE-US-00003 (SEQIDNO:1) MSYYHHHHHHDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSAT HIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFV ETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI.
24. A virus derived self-assembled micron scale structure capable of binding to a second complex comprising a nanoscale display surface, the nanoscale display surface comprising a second member of a covalently reactive peptide tag and binding protein pair, wherein the micron-scale structure comprises a first member of a covalently reactive peptide tag and binding protein pair wherein the peptide tag and binding protein pair are capable of spontaneously forming a covalent bond.
25. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of claim 24 wherein the micronscale structure comprises self assembled virus coat proteins comprising SpyTag.
26. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of claim 24 or 25 wherein the SpyTag comprises the amino acid sequence AHIVMVDAYKPTK (SEQ ID NO:2).
27. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of any one of claims 24 to 26 wherein the virus derived self-assembled micron scale structure comprises TMV, potato virus Y, potato virus X, tobacco rattle virus, or bacteriophage coat proteins.
28. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of any one of claims 24 to 26 wherein the virus derived self-assembled micron scale structure is TMV.
29. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of any one of claims 24 to 28 wherein the virus derived self-assembled micron scale is rod-shaped.
30. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of any one of claims 24 to 26 wherein the virus derived self-assembled micron scale structure is TMV wherein the TMV-derived structure comprises a SpyTag at the C-terminal end of the TMV coat protein.
31. The virus derived self-assembled micron scale structure capable of binding to a nanoscale surface display surface of any one of claims 24 to 26 wherein the virus derived self-assembled micron scale structure is TMV wherein the TMV includes a modified coat protein E550Q and D77N.
32. A method of providing a macromolecular complex comprising a first and second complex wherein the first complex is a virus self-assembled micron scale structure and the second complex is a nanoscale display surface and the virus self-assembled micron scale structure is covalently linked to a nanoscale display surface comprising the steps of mixing a first and second complex wherein the first complex comprises a virus self-assembled micron scale structure derived from virus components which surface displays a motif for one of a peptide tag and binding protein pair that can spontaneously form covalent linkages with the second complex, wherein the second complex comprises a particle which surface displays a motif interacting partner encoding one of the corresponding peptide tag and binding protein pair.
33. A method as claimed in claim 32 wherein the first and second complex comprises a first complex of a virus self-assembled micron scale structure comprising a motif for at least one peptide tag of the SpyCatcher/SpyTag, SnoopCatcher/SnoopTag, the Steptococcus pyogenes split pilin N-terminal isopeptide tag/the Steptococcus pyogenes split pilin C-terminal isopeptide tag systems and the second complex comprises a fluorescent particle comprising at least one binding protein of the SpyCatcher/SpyTag, SnoopCatcher/SnoopTag, the Steptococcus pyogenes split pilin N-terminal isopeptide tag/the Steptococcus pyogenes split pilin C-terminal isopeptide tag systems wherein the first complex is covalently linked to the second complex.
34. A kit comprising vectors or cells transformed with vectors which encode (i) a virus self-assembled micron scale structure comprising a first member of a covalently reactive peptide tag and binding protein pair wherein the peptide tag and binding protein pair are capable of spontaneously forming a covalent bond, and (ii) a nanoscale display surface comprising a second member of a covalently reactive peptide tag and binding protein pair that is capable of binding the first member of (i) to spontaneously form a covalent bond.
Description
[0062] Embodiments of the invention will now be described by way of example only, with reference to the accompanying figures.
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
DETAILED DESCRIPTION
[0073] Bacteria which expressed either TMVc (TMV CP with the modified E50Q and D77N groups), TMVc* (TMVc into which a SpyTag was fused to the C-terminal end for surface display after assembly) or GFP+ (SpyCatcher fused to the N-terminus of GFP) were lysed and the lysates were mixed and then purified via a 20% sucrose cushion, prior to western blot analysis with GFP and TMV specific antibodies. Western blots probed with the TMV antibody (
[0074] In summary, TMVc and TMVc* are present in their respective lysates, during incubation and also after the sucrose cushion purification.
[0075] Prior to incubation of the lysates it was found that the GFP+ reacted strongly with the GFP antibody (
[0076] No reactivity was observed in the lysates derived from bacteria which expressed TMVc* or TMVc only, indicating specificity of the antibody. After incubation of the TMVc lysate with the GFP+, the GFP+ band size and pattern did not change relative to the GFP+ only control (
[0077] Expressed SpyTag-TMV coat proteins exist as networks and SpyCatcher-GFP forms spherical nanoparticles, which can interact to produce macroscale structures
[0078] Samples of the TMVc*, TMVc and GFP+ after lysis, mixing and incubating and centrifugation were taken and assessed using transmission electron microscopy (TEM). Analysis of the TMVc bacterial lysates revealed rods which were 18 nm in diameter with a variable length which ranged from 40 nm to several microns (
[0079] In contrast, the TMVc* lysates contained network-like structures (
[0080] The GFP+ lysates formed spherical particles which ranged in size from 50-100 nm in diameter (
[0081] TMVc/GFP+ and TMVc*/GFP+ lysates were incubated and then purified using ultracentrifugation on sucrose cushions as described previously. The obtained structures were obtained using TEM with immunogold labelling with GFP antibodies. It was determined the GFP+ only particles were predominantly lost after ultracentrifugation on sucrose cushions (TEM image not shown) which is confirmatory to the data in
[0082] Structural associations were confirmed using immunotrapping TEM analysis. GFP+, TMVc or TMVc* were incubated separately with GFP antibody coated TEM grids. It was found that the GFP+ particles became immunotrapped (
[0083] The TMV derived networks and GFP containing SpyCatcher or SpyTag can form covalent links with proteins containing the interacting partner, which may promote protein stability without abolishing protein activity.
[0084] To demonstrate the potential utility of the platforms, their capacity to interact with proteins of interest which were fused to either SpyTag or SpyCatcher were tested. In one such embodiment the interaction of GFP+ with a SpyTag fused to the N-terminal of Uridine 5-diphosphogalactose 4-epimerase (GalEst), an economically important enzyme which can convert UDP-galactose into UDP-glucose, was tested. GalEst was expressed and purified from bacteria as discussed. In one embodiment nickel column isolated GFP+ was incubated with equimolar amounts of nickel column purified GalEst for different periods of time (5 minutes-16 hours).The formation of covalent bonds between the GalEst and GFP+ was assessed using denaturing coomassie stained SDS-PAGES. The isolated and unmixed GalEst and GFP+ samples gave distinct bands of the appropriate size (see
[0085] In order to test that the Gal Est-GFP+ complexes were still enzymatically active, these structures were tested in their capacity to convert UDP-galactose into UDP-glucose by using a coupled assay with which the level of conversion is stoichiometrically linked to changes in NADH, which can be detected by measuring absorbance at 340 nm (
[0086] In another embodiment we produced a variant of the TMVc* in which a linker sequence (3x repeat of GGGGS) is positioned between the C-terminal of the TMV CP and the SpyCatcher-6x his sequence (TMV CP-GGGGS-SpyCatcher His) or a SpyTag-6x his sequence (TMV CP-GGGGS-SpyTag His). These constructs were designed to give the additional utility of potential nickel column isolation of the complexes and also to investigate whether inclusion of additional sequences can influence the expected formation of the network structures. The bacterially expressed constructs gave the correct size on western blots probed with a 6x His antibody (
[0087] In summary, fusion of the SpyTag to the C-terminal of the E50Q and D77N modified TMV CP leads to formation of network like structures when expressed in bacteria. Moreover insertion of linker sequences (3x repeat of GGGGS), a 6x his tag and/or replacement of SpyTag with SpyCatcher in the TMV derived constructs does not compromise this network formation; indicating plasticity of the networks to support significant sequence alteration. In addition these can covalently bind GFP or an 11-20 sequence derived from a P. ovis antigen sequence fused to SpyCatcher, the interacting partner of the SpyTag. It is considered this can provide simplified production of large networks functionalized with proteins and/or enzymes, which do not involve crosslinker chemistries or multiple complex clean up steps. This work also indicates that GFP-Spycatcher spherical particles could have utility as a surface presentation platform.
[0088] Using methods as disclosed herein GFP particles of at least 500 nm in size can be provided. Fusing the SpyCatcher sequence to the N-terminal end of GFP without other modifications at the C-terminus led to production of smaller particles around 50-150 nm. Without wishing to be bound by theory, it is considered this size difference is likely a consequence of the shorter period of induction of expression in bacteria (typically less than 24 hours); however, the size difference may be influenced by the nature of the SpyCatcher protein fused to the GFP. The GFP particles still reacted with the GFP antibody, indicating that the presence of the SpyCatcher does not completely mask the GFP surface. The SpyCatcher-GFP also interacted with the SpyTag on the surface of the TMV coat protein derived networks to form covalent interactions. It is considered the GFP-SpyCatcher particles produced could act as a fluorescent novel surface display system which may be decorated with any protein or enzyme which is fused to a SpyTag at its C-terminus; as was exemplified by the capacity of the GFP-SpyCatcher particles to bind and stabilize a uridine 5-diphosphogalactose 4-epimerase, which retained its activity. Such interactions may also occur with proteins that have a SpyTag inserted into the central region or fused to the N-terminus. Although the GFP particles can act as a nanoscale surface display platform, it also has the advantage that it can covalently integrate into larger 3d structures (substrates/scaffolds). Suitably the integration of the GFP particles onto a larger 3d substrate/scaffold can be monitored by exploiting the fluorescence of the particles. Suitably the GFP particles may have multiple available SpyCatcher motifs which may not be fully utilized/occupied upon binding 3d macroscale scaffolds. These free Spycatcher sites can permit the further attachment of proteins of interest; effectively producing complexes with multifunctional decoration which may be controlled by GFP particles.
[0089] It is considered SpyTag can react with its interacting partner even under a wide range of temperatures (at least 4-37 C.), pH (at least 5-8), cation concentrations and non-ionic detergent conditions.
EXAMPLES
Example 1Sequences and Plasmids
[0090] For the SpyTag-TMV (TMVc*), the TMV E50Q and D77N group modified coat protein sequence (TMVc; Brown et al., 2013) was fused at its C-terminal end to the SpyTag sequence (Long et al., 2013). For the SpyCatcher-GFP sequence (GFP+), SpyCatcher (Long et al., 2013) was fused to the N-terminal end of the eGFP sequence (GenBank: AAG27429.1). For the GalEst, this consisted of a UDP-glucose 4-epimerase sequence (GenBank: EIE36183.1) to which a 6 His and SpyTag sequence was attached at its N-terminal end. For the TMV CP-GGGGS SpyCatcher His, the TMVc* sequence had a 3x GGGGS linker-6 His-SpyCatcher fused to its C-terminal end. For the TMV CP-GGGGS-SpyTag His, a 3x GGGGS linker-SpyTag-6 His, was fused to the C-terminal end of the TMVc*. For the 11-20 SpyCatcher (SEQ ID NO: 13), a small Psoroptes ovis peptidic sequence was fused to the C-terminal of the SpyCatcher. These were codon optimized for bacterial expression and cloned into a pET-21a(+) vector by Genscript (Piscataway, USA). The TMV-VLP (TMVc) control (with no tags) was produced in a similar manner. Plasmids were transformed into BL21(DES)pLysS (ThermoFisher Scientific, Paisley, UK) or Lemo 21 (New England Biolabs, Hitchin, UK) competent cells by following the manufacturers recommendations.
Example 2Expression in Bacteria and Isolation of Proteins or Virus Structures
[0091] Bacteria containing the plasmids were grown at 37 C. with shaking at 200 rpm in LB media supplemented with 100 g/ml ampicillin and 34 g/ml chloramphenicol. Once cultures reached an OD 600 of 0.5, IPTG was added to a final concentration of 0.1 mM, and induction proceeded overnight at 20 C. with shaking at 200 rpm. Bacteria were pelleted by centrifugation at 4000 g for 15 minutes, the supernatant was removed and the cells were lysed by freeze-thawing 3 times using liquid nitrogen and a 37 C. water bath, before proceeding with protein extraction using the B-PER Complete reagent (ThermoFisher Scientific, Paisley, UK). Lysates obtained with the B-PER Complete reagent were centrifuged at 10,000 g for 20 minutes to remove debris. The lysates were combined (TMVc* or TMVc were mixed with GFP+) in equal volume and incubated at room temperature for 1 hour prior to centrifugation on a 20% sucrose cushion, after which the pellet was resuspended in water for western blot analysis. Alternatively, the lysates were kept separate and more rigorously purified for future electron microscope analysis.
[0092] For isolation of TMV CP-GGGGS-SpyCatcher His, TMV CP-GGGGS-SpyTag His, and 11-20 SpyCatcher, B-PER complete cell lysates were obtained and further purification was carried out using standard nickel columns according to manufacturers protocols (Qiagen, Manchester, UK). The TMV CP-GGGGS-SpyCatcher His and TMV CP-GGGGS-SpyTag His were subsequently analyzed using TEM as described below, or were mixed with 11-20 SpyCatcher and observed on His antibody probed western blots.
[0093] Material for the enzymatic assays (GalEst and GFP+) was isolated from bacterial lysates using generic nickel column and anion exchange purification procedures.
Example 3TMVc* and TMVc Purification and Buffer Exchange of GFP+ Prior to Transmission Electron Microscopy
[0094] To the centrifuged TMV structure lysates, PEG 8000 and NaCl were added to a final concentration of 2% and 1% respectively, and the solutions were incubated at 4 C. overnight to ensure precipitation. These were centrifuged at 10000 g at 4 C. for 20 minutes to pellet the virus structures. The pellets were resuspended in 25 mM tris-HCl (pH 7.8), centrifuged at 10000 g to clarify and the supernatants were collected. Another two rounds of resuspension and centrifugation was carried out to obtain maximal virus structure yields, while minimizing debris. The clarified supernatants were then loaded onto 2 ml 20% sucrose 25 mM Tris-HCl (pH 7.8) cushions, which was then centrifuged in swing out rotors (SW41 Beckman Coulter; Beckman Coulter, California, USA) at 32000 rpm for 2 hours at 4 C. Pellets were resuspended in 0.01 M Tris-HCl (pH 7.8), ultracentrifuged at 32000 rpm for 2 hours at 4 C. in a SW41 rotor, with the pellet resuspended in water. Virus structures were retained for future electron microscopic analysis.
Example 4Transmission Electron Microscopy (TEM) and TEM Immunotrapping
[0095] TMVc*, TMVc, GFP+, TMVc/GFP or TMVc*/GFP, or TMV CP-GGGGS-SpyCatcher His and TMV CP-GGGGS-SpyTag His, were diluted in sterile filtered distilled water, and 30 l was placed onto carbon-coated copper grids for 1 minute, wicked off and stained with 2% uranyl acetate, washed twice with 20 l water, dried and examined in a JEOL 1400 transmission electron microscope (TEM) at 80 kV, or were used for GFP antibody work where appropriate. For detection of GFP+ in the prepared GFP+, TMVc/GFP+ or TMVc*/GFP+ grids, 50 l of blocking buffer (1% BSA, 0.05% tween, 1x PBS) was applied for 0.5 hours prior to a 1 hour room temperature incubation with a rabbit GFP antibody (Abcam, Cambridge, UK; ab6556) diluted 1/50 in blocking buffer. This was followed by three 50 l washes in washing buffer (0.25% BSA, 0.05% tween, 1x PBS) before incubation for 1 hour with 50 l of a goat anti-rabbit 5 nm gold conjugated antibody (ab27235; abcam, Cambridge, UK) diluted 1/50 in blocking buffer. Grids were then washed by rinsing with 50 l washing buffer 3 times, followed by a single 50 l wash in water prior to drying and then observation under TEM.
[0096] For immunotrapping experiments, mouse GFP antibodies (ab1218; abcam, Cambridge, UK) were diluted 1/1000 in 1x PBS and 30 l was applied to carbon coated grids and incubated for 1.5 hours at 37 C. These grids were subsequently washed twice in 1x PBS by incubating them each time for 10 minutes on a rotating table. Grids were then floated on GFP+ (in 1x PBS) or purified TMVc or TMVc* for 2 hours at room temperature prior to washing in 1x PBS, staining in 2% uranyl acetate, washed twice in water and viewing under EM.
[0097] Grids onto which GFP+ had been immunotrapped (prepared as above but not uranyl acetate treated), were floated on dilutions of TMVc or TMVc* for 1.5 hours in 1x PBS at room temperature. After washing in washing buffer (on a rotating table as before), the grids were floated on TMV rabbit antisera which was diluted 1/200 in blocking buffer and incubated for 1 hour at room temperature. This was followed by washing in washing buffer, and then a 1 hour incubation with a goat anti-rabbit 5 nm gold conjugated antibody diluted 1/50 in blocking buffer. Grids were then washed by rinsing with 50 l washing buffer 3 times, followed by a single 50 l wash in water prior to drying and then observation under TEM.
Example 5GalEst and GalEst-GFP+ Enzyme Assays
[0098] The following reagents were combined per 1 ml reaction: 0.125 M Bicinate pH 8.5, 1.25 mM NAD+, 2 g UDP-glucose dehydrogenase (UGDH-729H: Creative Biomart, USA), 1-10 g GalEst or GalEst-GFP+. These were equilibriated for 5 minutes at 27 C. prior to addition of 0.8 mM UDP-galactose substrate. The reaction kinetics were determined over a 10 minute period by measuring the 4 prior.
Example 6SDS PAGEs and Western Blot Detection
[0099] Protein samples were mixed 1:4 parts with 4x Laemmli loading buffer and then boiled for 10 minutes to denature the proteins. Twenty microliters of each of these samples were loaded onto 15% SDS-PAGE gels, along with 15 l of PageRuler Plus prestained ladder (ThermoFisher Scientific, Paisley, UK). Gels were either coomassie stained using established methods or were electroblotted onto Immobilon-P membrane (Millipore, Watford, UK) by following the manufacturer's recommendations. The Immobilon-P membrane was blocked by incubating in 1x PBS, 1% BSA and 0.05% Tween, for 1 hour. Anti-TMV or anti-GFP (abcam, Cambridge, UK; ab6556) antibodies raised in rabbits, or anti-his antibodies raised in mouse (H1029-0.2 ml; Sigma Dorset) were added to the membranes in blocking solution at either 1/10000 or 1/5000 dilutions and incubated with shaking at room temperature for 1 h. After washing, an anti-rabbit IgG alkaline phosphatase conjugate (A8025-1 ML; Sigma, Dorset, UK) or anti-mouse IgG alkaline phosphatase conjugate (A9316-0.25 ml) was added to the blots at a concentration of 1/1000 in blocking buffer. After incubation at room temperature under shaking conditions the blots were washed and covered with BCIP/NBT (B1911; Sigma, Dorset, UK). The blots were left to develop for 10 min, after which banding was visible. The developed blots were scanned and saved as jpeg images.
[0100] Although the invention has been particularly shown and described with reference to particular examples, it will be understood by those skilled in the art that various changes in the form and details may be made therein without departing from the scope of the present invention.
REFERENCES
[0101] Marsian, J., Lomonossoff, G. P., Molecular pharmingVLPs made in plants. Curr. Op. Biotech. 2016, 37, 201-206. [0102] Koch, C., Eber, F. J., Azucena, C., Forste, A. et al., Novel roles for well-known players: from tobacco mosaic virus pests to enzymatically active assemblies. Beilstein J. Nanotech. 2016, 7. DOI: 10.3762/bjnano.7.54. [0103] Thuenemann, E. C., Lenzi, P., Love, A. J. et al., The Use of Transient Expression Systems for the Rapid Production of Virus-like Particles in Plants. Curr. Pharm. Des. 2013, 19, 5564-5573. [0104] Love, A. J., Makarov, V., Yaminsky, I., Kalinina, N. O. et al., The use of tobacco mosaic virus and cowpea mosaic virus for the production of novel metal nanomaterials. Virology, 2014, 449, 133-139. [0105] Cuenca, S., Mansilla, C., Aguado, M., Yuste-Calvo, C., Sanchez, F., Sanchez-Montero, J. M., Ponz, F., Nanonets derived from the Turnip mosaic virus as scaffolds for increased enzymatic activity of immobilized Candida Antarctica Lipase B. Front. Plant Sci. 2016, 7, 464. [0106] Chatterji, A., Ochoa, W., Shamieh, L., Salakian, S. P., Wong, S. M. et al., Chemical conjugation of heterologous proteins on the surface of Cowpea mosaic virus. Bioconjug. Chem. 2004, 15, 807-813. [0107] Aljabali, A. A., Barclay, J. E., Steinmetz, N. F., Lomonossoff, G. P., Evans, D. J., Controlled immobilization of active enzymes on the cowpea mosaic virus capsid. Nanoscale, 2013, 5640-5645. [0108] Stubbs, G., Molecular structures of viruses from the tobacco mosaic virus group. Semin. Virol. 1990, 1, 405-412. [0109] Brown, A. D., Naves, L., Wang, X., Ghodssi, R., Culver, J. N., Carboxylate-directed in vivo assembly of virus-like nanorods and tubes for the display of functional peptides and residues. Biomacromol. 2013, 14, 3123-3129. [0110] Bendahmane, M., Chen, I., Asurmendi, S., Bazzini, A. A., Szecsi, J., Beachy, R. N., Coat protein-mediated resistance to TMV infection of Nicotiana tabacum involves multiple modes of interference by coat protein. Virology, 2007, 366, 107-116. [0111] Bruckman, A. M., Steinmetz, N. F., Chemical modification of the inner and outer surfaces of tobacco mosaic virus (TMV). Methods Mol. Biol. 2014, 1108, 173-185. [0112] Aljabali, A. A. A., Barclay, J. E., Butt, N. J., Lomonossoff, G. P., Evans, D. J., Redox-active ferrocene-modified Cowpea mosaic virus nanoparticles. Dalton Trans. 2010, 39, 7569-7574. [0113] Tinazzi, E., Merlin, M., Bason, C., Beri, R., Zampieri, R., et al., Plant-derived chimeric virus particles for the diagnosis of primary Sjogren syndrome. Front. Plant. Sci. 2015, 6, 1080. [0114] Besong-Ndika, J., Wahlsten, M., Cardinale, D., Pille, J., Walter, J., et al., Toward the reconstitution of a two enzyme cascade for resveratrol synthesis on potvirus particles. Front. Plant. Sci. 2016, 7, 89. [0115] Zackeri, B., Fierer, J. O., Celik, E., Chittock, E. C. et al., Peptide tag forming a rapid covalent bond to a protein, through engineering a bacterial adhesion. Proc. Nat. Acad. Sci. USA. 2012, 109, 690-697. [0116] Long, L., Fierer, J. O., Rapoport, T. A., Howarth, M., Structural analysis and optimization of the covalent association between SpyCatcher and a peptide tag. J. Mol. Biol. 2014, 426, 309-317. [0117] Thrane, S., Janitzek, C. M., Matondo, S., Resende, M. et al., Bacterial superglue enables easy development of efficient virus-like particle based vaccines. J. Nanobiotech. 2016, 14, 30. [0118] Brune, K. D., Leneghan, D. B., Brian, I. J., Ishizuka, A. S., Plug and display: decoration of virus-like particles via isopeptide bonds for modular immunization. Sci. Reports, 2016, 6, 19234. [0119] Reddington, S. C., Howarth, M., Secrets of a covalent interaction for biomaterials and biotechnology: SpyTag and SpyCatcher. Curr. Op. Chem. Biol. 2015, 29, 94-99. [0120] Zakeri, B., Fierer, J. O., Celik, E., Chittock, E. C., Schwarz-Linek, U., Moy, V. T., Howarth, M., Peptide tag forming a rapid covalent bond to a protein, through engineering a bacterial adhesion. Proc. Natl. Acad. Sci. 2012, 109, 690-697. [0121] Yenning-Slater, M., Hooks, D. O., Rehm, H. A., In vivo self-assembly of stable green fluorescent protein fusion particles and their uses in enzyme immobilization. App. Environ. Micro. 2014, 80, 10. [0122] Jahns, A. C., Maspolim, Y., Chen, S., Guthrie, J. M., Blackwell. L. F., Rehm, B. H. A., In vivo self assembly of fluorescent protein microparticles displaying specific binding domains. Bioconj. Chem. 2013, 24, 1314-1323. [0123] Love A., Makarov V., Sinitsyna O., Shaw J., Yaminsky I., Kalinina N., Taliansky M., A genetically modified tobacco mosaic virus that can produce gold nanoparticles from a metal salt precursor. Frontiers in Plant Science, 2015, 6, 984
TABLE-US-00001 SpyCatchersequence(AFD50637.1) (SEQIDNO:1) MSYYHHHHHHDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSAT HIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFV ETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI 6HishighlightedinBold TEVcleavagesequenceunderlined SpyTag (SEQIDNO:2) AHIVMVDAYKPTK SpyTagtruncated (SEQIDNO:3) AHIVMVDA TMVCP(modifiedforselfassemblyinbacteria) (SEQIDNO:4) MSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQARTVVQRQFSQ VWKPSPQVTVRFPDSDFKVYRYNAVLNPLVTALLGAFDTRNRIIEVENQAN PTTAETLDATRRVDDATVAIRSAINNLIVELIRGTGSYNRSSFESSSGLVW TSGPAT ModificationsitetointroducePmllindicatedin boldandunderlined TMVCPwithC-terminalSpyTag (SEQIDNO:5) MSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQARTVVQRQFSQ VWKPSPQVTVRFPDSDFKVYRYNAVLNPLVTALLGAFDTRNRIIEVENQAN PTTAETLDATRRVDDATVAIRSAINNLIVELIRGTGSYNRSSFESSSGLVW TSGPATAHIVMVDAYKPTK ModificationsitetointroducePmllindicatedin boldandunderlined GFPsequence(ADQ48006.1) (SEQIDNO:6) MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFK DDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYI MADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLST QSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLRSRAQASNSAVDG TAGPGSTGSR SpyCatcher-GFP (SEQIDNO:7) MSYYHHHHHHDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSAT HIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFV ETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHIATCMVSKGEELFTG VVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLV TTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEV KFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEK RDHMVLLEFVTAAGITLGMDELYKSGLRSRAQASNSAVDGTAGPGSTGSR Linkersequenceshowninboldandunderlined NCBIEntrezCodeAAK33238 (SEQIDNO:8) MKLRHLLLTGAALTSFAATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTD FTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSE VTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYI VGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYY KASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYV VTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKD FEVPTGVAMTVAPYIALGIVAVGGALYFVKKKNA NCBIEntrezAccessioncodeNP_814829 (SEQIDNO:9) MTKSVKFLVLLLVMILPIAGALLIGPISFGAELSKSSIVDKVELDHTTLYQ GEMTSIKVSFSDKENQKIKPGDTITLTLPDALVGMTENDSSPRKINLNGLG EVFIYKDHVVATFNEKVESLHNVNGHFSFGIKTLITNSSQPNVIETDFGTA TATQRLTIEGVTNTETGQIERDYPFFYKVGDLAGESNQVRWFLNVNLNKSD VTEDISIADRQGSGQQLNKESFTFDIVNDKETKYISLAEFEQQGYGKIDFV TDNDFNLRFYRDKARFTSFIVRYTSTITEAGQHQATFENSYDINYQLNNQD ATNEKNTSQVKNVFVEGEASGNQNVEMPTEESLDIPLETIDEWEPKTPTSE QATETSEKTDTTETAESSQPEVHVSPTEEENPDEGETLGTIEPIIPEKPSV TTEENGTTETAESSQPEVHVSPTEEENPDESETLGTIEPIIPEKPSVTTEE NGTTETAESSQPEVHVSPAEEENPDESETLGTILPILPEKPSVTTEENGTT ETAESSQPEVHVSPTEEENPDESETLGTIAPIIPEKPSVTTEENGITETAE SSQPEVHVSPTKEITTTEKKQPSTETTVEKNKNVTSKNQPQILNAPLNTLK NEGSPQLAPQLLSEPIQKLNEANGQRELPKTGTTKTPFMLIAGILASTFAV LGVSYLQIRKN GalEst (SEQIDNO:10) MHHHHHHAHIVMVDAYKPTK MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKH PTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVN GTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSK LMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYI AQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPG VHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKA DRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD 6HisandSpyTagsequenceshowninboldandunder- lined.ItalicizedsequencecorrespondstoGenBank: EIE36183.1. TMVCP-GGGGS-SpyCatcherHis (SEQIDNO:11) MSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQARTVVQRQFSQ VWKPSPQVTVRFPDSDFKVYRYNAVLNPLVTALLGAFDTRNRIIEVENQAN PTTAETLDATRRVDDATVAIRSAINNLIVELIRGTGSYNRSSFESSSGLVW TSGPATGGGGSGGGGSGGGGSMSYYHHHHHHDYDIPTTENLYFQGAMVDTL SGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATMELRDSSGKTIS TWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKA TKGDAHI 3xGGGGSlinkerand6Hissequencesshowninbold andunderlined TMVCP-GGGGS-SpyTagHis (SEQIDNO:12) MSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQARTVVQRQFSQ VWKPSPQVTVRFPDSDFKVYRYNAVLNPLVTALLGAFDTRNRIIEVENQAN PTTAETLDATRRVDDATVAIRSAINNLIVELIRGTGSYNRSSFESSSGLVW TSGPATGGGGSGGGGSGGGGSAHIVMVDAYKPTKHHHHHH 3xGGGGSlinkerand6Hissequencesshowninbold andunderlined 11-20SpyCatcher (SEQIDNO:13) MSYYHHHHHHDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSAT HIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFV ETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHILDIVADINGVQIEV PILPTTKAKIIAKIIG TheP.ovispeptidicsequenceisshowninboldand underlined.