NOVEL NUCLEIC ACID MOLECULES AND THEIR USE IN THERAPY
20200190512 ยท 2020-06-18
Inventors
Cpc classification
C12N15/113
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/113
CHEMISTRY; METALLURGY
Abstract
Disclosed are products and methods for therapy using nucleic acid molecules, and in particular in relation to treatment of alpha-1-antitrypsin deficiency. Also disclosed are pharmaceutical compositions including the nucleic acids and/or delivery vehicles including the nucleic acids, and their use in manufacture of pharmaceutical compositions for use in therapy, such as treatment of alpha-1-antitrypsin deficiency.
Claims
1. A ribonucleic acid molecule consisting of 19, 20, or 21 nucleotides and comprising a sequence selected from SEQ ID NO: 39, 40, 43 and 44.
2. A chemically modified ribonucleic acid consisting of 19, 20, or 21 nucleotides and comprising a sequence selected from SEQ ID NO: 39, and 43.
3. The ribonucleic acid according to claim 2, wherein the chemically modified ribonucleic acid is modified in the phosphodiester backbone, such as by incorporation of phosphorothioate, boranophosphate, or methylphosphonate; or in the sugar backbone such as at the 2-position of the ribose unit, such as by substitution of the 2-OH group for OCH.sub.3, CH.sub.2CH.sub.2OCH.sub.3, or F or by incorporation of 2-thiouridine, 5-methylcytidine or pseudouridine.
4. An RNA molecule consisting of 46-100 nucleotides, comprising two sequences spaced 4-10 nucleotides apart, wherein the two sequences are selected from the sequence pairs: SEQ ID NO: 39 and 40; and SEQ ID NO: 43 and 44.
5. A DNA molecule comprising at least one nucleotide sequence complementary to at least one RNA molecule according to claim 4, such as one or two RNA molecules according to claim 4.
6. The DNA molecule according to claim 5, wherein the nucleotide sequence complementary to an RNA molecule is operably linked to a single RNA polymerase promoter sequence, wherein the RNA molecule consists of 46-100 nucleotides, comprising two sequences spaced 4-10 nucleotides apart, wherein the two sequences are selected from the sequence pairs: SEQ ID NO: 39 and 40; and SEQ ID NO: 43 and 44.
7. A DNA molecule comprising at least one nucleotide sequence complementary to at least one RNA molecule according to claim 4, such as one or two RNA molecules according to claim 4, comprising at least two nucleotide sequences complementary to at least two different RNA molecule according to claim 4, wherein each nucleotide sequence complementary to an RNA molecule according to claim 4 is independently operably linked to an RNA polymerase promoter sequence and wherein the RNA polymerase promoter sequence is the same for each nucleotide sequence complementary to an RNA molecule according to claim 4.
8. A DNA molecule comprising at least one nucleotide sequence complementary to at least one RNA molecule according to claim 4, such as one or two RNA molecules according to claim 4, comprising at least two nucleotide sequences complementary to at least two different RNA molecule according to claim 4, wherein each nucleotide sequence complementary to an RNA molecule according to claim 4 is independently operably linked to an RNA polymerase promoter sequence and wherein the RNA polymerase promoter sequence is different for each nucleotide sequence complementary to an RNA molecule according to claim 4.
9. The DNA molecule according to claim 6, wherein each RNA polymerase promoter sequence is selected from RNA polymerase promoters H1, 7SK, and U1.
10. A DNA molecule comprising a sequence encoding a functional human alpha-1-antitrypsin and having at least 90% identity to SEQ ID NO: 1, wherein said sequence comprises a plurality of point mutations in relation to SEQ ID NO: 1, said point mutations rendering an RNA-transcript of said DNA molecule resistant to gene silencing by RNA interference mediated by an RNA molecule according to claim 1.
11. The DNA molecule according to claim 10, wherein the point mutations in relation to SEQ ID NO: 1 are selected from the group: T919A, C920G, T921C, C924A, A925T, G926C, C927T, T928C, A930G, T933C, T934C, A936C, T984C, A987G, C988T, G990A, C993T, C996T, T999A.
12. The DNA molecule according to claim 10, comprising the following point mutations in relation to SEQ ID NO: 1: T919A, C920G, T921C, C924A, A925T, G926C, C927T, T928C, A930G, T933C, T934C, A936C.
13. The DNA molecule according to claim 10, comprising the following point mutations in relation to SEQ ID NO: 1: T984C, A987G, C988T, G990A, C993T, C996T, T999A.
14. The DNA molecule according to claim 10, comprising the following point mutations in relation to SEQ ID NO: 1: T919A, C920G, T921C, C924A, A925T, G926C, C927T, T928C, A930G, T933C, T934C, A936C, T984C, A987G, C988T, G990A, C993T, C996T, T999A.
15. The DNA molecule according to claim 10, further comprising a point mutation G75A in relation to SEQ ID NO: 1.
16. The DNA molecule according to claim 10, encoding a protein comprising an amino acid sequence according to positions 25-418 of SEQ ID NO: 45.
17. An RNA molecule comprising a nucleotide sequence complementary to a DNA molecule according to claim 5.
18. Virus particle comprising a recombinant viral genome, wherein said genome comprises a DNA molecule comprising the sequence of a DNA molecule according to claim 5.
19. Virus particle comprising a recombinant viral genome, wherein said genome comprises an RNA molecule according to claim 17.
20. A vehicle for delivery of nucleic acid material to a human cell in vivo, wherein said vehicle comprises a DNA molecule comprising the sequence of a DNA molecule according to claim 5.
21. The vehicle according to claim 20, wherein the vehicle is selected from the group plasmid DNA, lipid-based vectors, and polymeric vectors.
22. A nucleic acid molecule according to claim 1, for use in a method for treatment of a subject.
23. The nucleic acid molecule of claim 1 for use in a method for treatment of a subject, wherein a vehicle is delivered to the subject by way of gene gun/ballistic DNA, electroporation, sonoporation, hydroporation, magnetofection, needle injection and/or other methods facilitating the incorporation of DNA or RNA into the cell leading to a modified transcription and expression of target genes, wherein the vehicle is for delivery of nucleic acid material to a human cell in vivo, wherein said vehicle comprises a DNA molecule comprising the sequence of an RNA molecule according to claim 1.
24. The nucleic acid molecule for use according to claim 22, wherein the subject has alpha-1-antitrypsin deficiency.
25. The nucleic acid molecule for use according to claim 22, wherein the subject's genome is heterozygous or homozygous for a G342K mutation in a gene encoding alpha-1-antitrypsin.
26. The nucleic acid molecule for use according to claim 24, wherein the alpha-1-antitrypsin deficiency manifests as liver cirrhosis, pulmonary emphysema, necrotising panniculitis, systemic vasculitis, (intracranial) aneurysms, fibromuscular dysplasia, bleeding disorders, anterior uveitis, systemic necrotizing vasculitis and Wegener granulomatosis.
Description
DESCRIPTION OF THE DRAWINGS
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084] Sequences
[0085] The following sequences are relevant to the present disclosure and included in the appended
SEQUENCE LISTING
[0086]
TABLE-US-00001 Alpha-1-antitrypsinsequences Openreadingframeofnativealpha-1-antitrypsin (M-AAT),NM_000295.4(SEQIDNO:1): ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTG CCTGGTCCCTGTCTCCCTGGCTGAGGATCCCCAGGGAGATGCTGCCCAGA AGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATC ACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACA CCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAG CCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAATC CTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCA TGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGC TCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGCCTGAAGCTA GTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTT CACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATT ACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTT GACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCAA ATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACG TGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATG TTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTGCTGCTGATGAA ATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAAC TACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTG GAAAATGAAGACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCAT TACTGGAACCTATGATCTGAAGAGCGTCCTGGGTCAACTGGGCATCACTA AGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCC CTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGAA AGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCTA TCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGAA CAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCA AAAATAA Openreadingframeofsyntheticalpha-1- antitrypsin(sAAT)(SEQNO:2): ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTG CCTGGTCCCTGTCTCCCTGGCTGA GATCCCCAGGGAGATGCTGCCCAG AAGACCGACACTAGTCATCACGATCAGGATCACCCAACCTTCAACAAGAT CACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCAC ACCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACA GCCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAAT CCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCC ATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAG CTCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGCCTGAAGCT AGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCT TCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGAT TACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCT TGACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCA AATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCAC GTGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAAAGACTTGGTAT GTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTTTTATTGATGA AGTACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAA CTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCT GGAAAATGAAGACAGAAGGAGCGCATCTCTGCACCTCCCCAAACTGTCCA TTACTGGAACCTATGATCTGAAGAGCGTCCTGGGCCAGTTAGGTATTACA AAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACC CCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGA AAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCT ATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGA ACAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCC AAAAATAA
GATCC=BamHIrestrictionsiteofthenative M-AAThasbeendeletedbyintroducingasilent pointmutation(bold)atnucleotide75ofthe M-AATcDNAtranscript(G75A) GACCGACACTAGTCATCAC=Targetsequenceofsilencing RNA/shRNAinM-AAT,resistantinsAATbecauseof pointmutations(bold) Openreadingframeofsyntheticalpha-1- antitrypsin(sAAT2)(SEQIDNO:3): ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTG CCTGGTCCCTGTCTCCCTGGCTGA
GATCCCCAGGGAGATGCTGCCCAG AAGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGAT CACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCAC ACCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACA GCCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAAT CCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCC ATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAG CTCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGCCTGAAGCT AGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCT TCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGAT TACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCT TGACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCA AATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCAC GTGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCAT GTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTTTTATTGATGA AGTACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAA CTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCT GGAAAATGAAGACAGAAGGAGCGCATCTCTGCACCTCCCCAAACTGTCCA TTACTGGAACCTATGATCTGAAGAGCGTCCTGGGCCAGTTAGGTATTACA AAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACC CCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGA AAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCT ATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGA ACAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCC AAAAATAA
GATCC=theBamHIrestrictionsiteofthenative M-AAThasbeendeletedbyintroducingapoint mutation(bold) GACCGACACTAGTCATCACTargetsequenceofsilencing RNA/shRNAinM-AAT,resistantinsAAT2because ofpointmutations(bold) OpenreadingframeofPiZZalpha-1-antitrypsin (Z-AAT)(SEQIDNO:4): ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTG CCTGGTCCCTGTCTCCCTGGCTGAGGATCCCCAGGGAGATGCTGCCCAGA AGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATC ACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACA CCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAG CCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAATC CTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCA TGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGC TCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGCCTGAAGCTA GTGGATAAATTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTT CACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATT ACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTT GACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCAA ATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACG TGGACCAGGCGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATG TTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTGCTGCTGATGAA ATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAAC TACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTG GAAAATGAAGACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCAT TACTGGAACCTATGATCTGAAGAGCGTCCTGGGTCAACTGGGCATCACTA AGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCC CTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACAAGAA AGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCTA TCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGAA CAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCA AAAATAA A=pointmutationinZ-AAT
[0087] Interfering RNA Sequences
[0088] Silencing RNA sequences are initially constructed as oligonucleotides that are annealed and cloned into shRNA expressing lentiviral transfer vector pLVTHM. The shRNA is designed as depicted below following the instructions from the original publication (Wiznerowicz and Trono, 2003). The original TTCAAGAGA-loop has been exchanged for an ACTCGAGA-loop. [0089] MluI+linker: CGCGT CCCC [0090] 19-21 nt sense siRNA: [0091] Loop: ACTCGAGA [0092] 19-21 nt anti-sense siRNA [0093] Termination: TTTTT [0094] Linker+ClaI: GGAA AT
[0095] Specific sequences were constructed as follows.
[0096] shRNA ctrl1: 102-120 bp of ORF NM000295.4 (positive control shRNA published in Cruz et al., 2007)
TABLE-US-00002 sensesiRNA: (SEQIDNO:5) GACAGATACATCCCACCAT anti-sensesiRNA: (SEQIDNO:6) GACAGATACATCCCACCAT
[0097] Oligonucleotide for Annealing and Cloning:
TABLE-US-00003 oligo1: (SEQIDNO:7) 5-CGCGTCCCCGACAGATACATCCCACCATACTCGAGA ATGGTGGGATGTATCTGTCTTTTTGGAAAT-3 oligo2: (SEQIDNO:8) 5-CGATTTCCAAAAAGACAGATACATCCCACCATTCTCGAGT ATGGTGGGATGTATCTGTCGGGGA-3
[0098] shRNA ctrl2: 732-752 bp of ORF NM000295.4 (positive control shRNA published in Li et al., 2011)
TABLE-US-00004 sensesiRNA: (SEQIDNO:9) GATGAAGCGTTTAGGCATG anti-sensesiRNA: (SEQIDNO:10) CATGCCTAAACGCTTCATC
[0099] Oligonucleotide for Annealing and Cloning:
TABLE-US-00005 Oligo3: (SEQIDNO:11) 5-CGCGTCCCCGATGAAGCGTTTAGGCATGACTCGAGA CATGCCTAAACGCTTCATCTTTTTGGAAAT-3 Oligo4: (SEQIDNO:12) 5-CGATTTCCAAAAAGATGAAGCGTTTAGGCATGTCTCGAGT CATGCCTAAACGCTTCATCGGGG-3
[0100] shRNA 1: 917 bp-937 bp of ORF NM000295.4
TABLE-US-00006 sensesiRNA: (SEQIDNO:13) GGTCTGCCAGCTTACATTTAC ThecorrespondingRNAsequenceisprovidedas SEQIDNO:39. anti-sensesiRNA: (SEQIDNO:14) GTAAATGTAAGCTGGCAGACC ThecorrespondingRNAsequenceisprovidedas SEQIDNO:40.
[0101] Oligonucleotide for Annealing and Cloning:
TABLE-US-00007 Oligo5: (SEQIDNO:(15) 5-CGCGTCCCCGGTCTGCCAGCTTACATTTACACTCGAGA GTAAATGTAAGCTGGCAGACCTTTTTGGAAAT-3 Oligo6: (SEQIDNO:16) 5-CGATTTCCAAAAAGGTCTGCCAGCTTACATTTACACTCGAGA GTAAATGTAAGCTGGCAGACCGGGGA-3
[0102] shRNA 2 (prior art): 785-803 of ORF NM000295.4
TABLE-US-00008 sensesiRNA: (SEQIDNO:17) GGGTGCTGCTGATGAAATA ThecorrespondingRNAsequenceisprovidedas SEQIDNO:41. anti-sensesiRNA: (SEQIDNO:18) TATTTCATCAGCAGCACCC ThecorrespondingRNAsequenceisprovidedas SEQIDNO:42.
[0103] oligonucleotide for annealing and cloning:
TABLE-US-00009 Oligo7: (SEQIDNO:19) 5-CGCGTCCCCGGGTGCTGCTGATGAAATAACTCGAGA TATTTCATCAGCAGCACCCTTTTTGGAAAT-3 Oligo8: (SEQIDNO:20) 5-CGATTTCCAAAAAGGGTGCTGCTGATGAAATAACTCGAGA TATTTCATCAGCAGCACCCGGGGA-3
[0104] shRNA3: 981-1001 of ORF NM000295.4
TABLE-US-00010 sensesiRNA: (SEQIDNO:21) GGGTCAACTGGGCATCACTAA ThecorrespondingRNAsequenceisprovidedas SEQIDNO:43. anti-sensesiRNA: (SEQIDNO:22) TTAGTGATGCCCAGTTGACCC ThecorrespondingRNAsequenceisprovidedas SEQIDNO:44.
[0105] Oligonucleotide for Annealing and Cloning:
TABLE-US-00011 Oligo9: (SEQIDNO:23) 5-CGCGTCCCCGGGTCAACTGGGCATCACTAAACTCGAGA TTAGTGATGCCCAGTTGACCCTTTTTGGAAAT-3 Oligo10: (SEQIDNO:24) 5-CGATTTCCAAAAAGGGTCAACTGGGCATCACTAAACTCGAGA TTAGTGATGCCCAGTTGACCCGGGG-3
[0106] Scramble shRNA:
TABLE-US-00012 sensesiRNA: (SEQIDNO:25) GTGATCGCGTCAACGACTAGA anti-sensesiRNA: (SEQIDNO:26) TCTAGTCGTTGACGCGATCAC
[0107] Oligonucleotide for Annealing and Cloning:
TABLE-US-00013 Oligo11: (SEQIDNO:27) 5-CGCGTCCCCGTGATCGCGTCAACGACTAGAACTCGAGA TCTAGTCGTTGACGCGATCACTTTTTGGAAAT-3 Oligo12: (SEQIDNO:28) 5-CGATTTCCAAAAAGTGATCGCGTCAACGACTAGAACTCGAGA TCTAGTCGTTGACGCGATCACGGGGA-3
[0108] Primers
[0109] qPCR Primers
TABLE-US-00014 1 SEQIDNO:29 GGGTGCTGCTGATGAAATAC ForwardprimerM- AAT 2 SEQIDNO:30 TTAGTGATGCCCAGTTGACC ReverseprimerM- AAT 3 SEQIDNO:31 GGGTTTTATTGATGAAGTACCTGG Forwardprimer sAAT/sAAT2 4 SEQIDNO:32 TTTGTAATACCTAACTGGCCCA Reverseprimer sAAT/sAAT2 5 SEQIDNO:33 GTCACGACTGTGCAGCAGCGT Forwardprimer MDH 6 SEQIDNO:34 TGGGGTTCCAAACCAGATGTCCCTG Reverseprimer MDH
[0110] Sequencing Primers
TABLE-US-00015 100 SEQID TGATAGAGAAAAGTGAAAGTCGGGG Forwardsequencing NO:35 primeronpLVTHMto checkshRNAinsertionof thecloning olignonucleotide 101 SEQID GACCCAGTACAAGCAAAAAGCAGCA reversesequencing NO:36 primeronpLVTHMto checkshRNAinsertionof thecloning olignonucleotide
[0111] Sequence for Multiple shRNA
TABLE-US-00016 SequenceofinsertforshRNA1x3(SEQIDNO:37): GCGCGAATTCCGTACGCTGCAGTATTTAGCATGCCCCACCCATCTGCAAGG CATTCTGGATAGTGTCAAAACAGCCGGAAATCAAGTCCGTTTATCTCAAACT TTAGCATTTTGGGAATAAATGATATTTGCTATGCTGGTTAAATTAGATTTTAG TTAAATTTCCTGCTGAAGCTCTAGTACGATAAGTAACTTGACCTAAGTGTAA AGTTGAGATTTCCTTCAGGTTTATATAGCTTGTGCGCCGCCTGGGTACCTCC GCGTCCCCGGTCTGCCAGCTTACATTTACACTCGAGAGTAAATGTAAGCTGGCAGACC GGTCTTCACCTGAGGT GCGCGCGCCTAAGGACCAGCTTCTTTGGGAGAGA ACAGACGCAGGGGCGGGAGGGAAAAAGGGAGAGGCAGACGTCACTTCCCCT TGGCGGCTCTGGCAGCAGATTGGTCGGTTGAGTGGCAGAAAGGCAGACGGG GACTGGGCAAGGCACTGTCGGTGACATCACGGACAGGGCGACTTCTATGTA GATGAGGCAGCGCAGAGGCTGCTGCTTCGCCACTTGCTGCTTCACCACGAA GGAGTTCCCGTGCCCTGGGAGCGGGTTCAGGACCGCTGATCGGAAGTGAGA ATCCCAGCTGTGTGTCAGGGCTGGAAAGGGCTCGGGAGTGCGCGGGGCAAG TGACCGTGTGTGTAAAGAGTGAGGCGTATGAGGCTGTGTCGGGGCAGAGGC CCAAGATCTCCGCGTCCCCGGTCTGCCAGCTTACATTTACACTCGAGAGTAAATGTA AGCTGGCAGACCGCAGTCTGGAG
GAATTCGCGC Bold=promoter Bolditalique=promoterterminationsequence Italique=shRNAsenseandanti-sense Underlined=loop =restrictionsite SequenceofinsertforshRNA1x3containingsAAT2(SEQIDNO:38): GCGCGAATTCCGTACGAGCTAGCTGCAGTAACGCCATTTTGCAAGGCATGG AAAAATACCAAACCAAGAATAGAGAAGTTCAGATCAAGGGCGGGTACATGA AAATAGCTAACGTTGGGCCAAACAGGATATCTGCGGTGAGCAGTTTCGGCCC CGGCCCGGGGCCAAGAACAGATGGTCACCGCAGTTTCGGCCCCGGCCCGAG GCCAAGAACAGATGGTCCCCAGATATGGCCCAACCCTCAGCAGTTTCTTAAG ACCCATCAGATGTTTCCAGGCTCCCCCAAGGACCTGAAATGACCCTGCGCCT TATTTGAATTAACCAATCAGCCTGCTTCTCGCTTCTGTTCGCGCGCTTCTGCT TCCCGAGCTCTATAAAAGAGCTCACAACCCCTCACTCGGCGCGCCAGTCCTC CGACAGACTGAGTCGGCCGGTGATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCT GGCAGGCCTGTGCTGCCTGGTCCCTGTCTCCCTGGCTGAAGATCCCCAGGGAGATGC TGCCCAGAAGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATCA CCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACACCAGTCCAA CAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAGCCTTTGCAATGCTCTCCC TGGGGACCAAGGCTGACACTCACGATGAAATCCTGGAGGGCCTGAATTTCAACCTCAC GGAGATTCCGGAGGCTCAGATCCATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAAC CAGCCAGACAGCCAGCTCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGC CTGAAGCTAGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTT CACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATTACGTGGAG AAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTTGACAGAGACACAGTTTT TGCTCTGGTGAATTACATCTTCTTTAAAGGCAAATGGGAGAGACCCTTTGAAGTCAAGG ACACCGAGGAAGAGGACTTCCACGTGGACCAGGTGACCACCGTGAAGGTGCCTATGAT GAAGCGTTTAGGCATGTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTTTTAT TGATGAAGTACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAACT ACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTGGAAAATGAAG ACAGAAGGAGCGCATCTCTGCACCTCCCCAAACTGTCCATTACTGGAACCTATGATCTG AAGAGCGTCCTGGGCCAGTTAGGTATTACAAAGGTCTTCAGCAATGGGGCTGACCTCT CCGGGGTCACAGAGGAGGCACCCCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGC TGACCATCGACGAGAAAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACC CATGTCTATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGAACA AAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCAAAAA
CGT ACGCTGCAGTATTTAGCATGCCCCACCCATCTGCAAGGCATTCTGGATAGTG TCAAAACAGCCGGAAATCAAGTCCGTTTATCTCAAACTTTAGCATTTTGGGA ATAAATGATATTTGCTATGCTGGTTAAATTAGATTTTAGTTAAATTTCCTGCT GAAGCTCTAGTACGATAAGTAACTTGACCTAAGTGTAAAGTTGAGATTTCCT TCAGGTTTATATAGCTTGTGCGCCGCCTGGGTACCTCCGCGTCCCCGGTCTGC CAGCTTACATTTACACTCGAGAGTAAATGTAAGCTGGCAGACCGGTCTTCACCTGAG G
GCGCGCGCCTAAGGACCAGCTTCTTTGGGAGAGAACAGACGCAGGG GCGGGAGGGAAAAAGGGAGAGGCAGACGTCACTTCCCCTTGGCGGCTCTGG CAGCAGATTGGTCGGTTGAGTGGCAGAAAGGCAGACGGGGACTGGGCAAGG CACTGTCGGTGACATCACGGACAGGGCGACTTCTATGTAGATGAGGCAGCG CAGAGGCTGCTGCTTCGCCACTTGCTGCTTCACCACGAAGGAGTTCCCGTGC CCTGGGAGCGGGTTCAGGACCGCTGATCGGAAGTGAGAATCCCAGCTGTGT GTCAGGGCTGGAAAGGGCTCGGGAGTGCGCGGGGCAAGTGACCGTGTGTGT AAAGAGTGAGGCGTATGAGGCTGTGTCGGGGCAGAGGCCCAAGATCTCCGC GTCCCCGGTCTGCCAGCTTACATTTACACTCGAGAGTAAATGTAAGCTGGCAGACCGC AGTCTGGAG
GAATTCGCGC Bold=promoter(5-3order:SFFV,7SK,U1) Bolditalique=promoterterminationsequence Bolditaliaueunderlined=stopcodonofsAAT2 Italique=shRNAsenseandanti-sense Italiqueunderlined=ORFofsAAT2 Underlined=loop =restrictionsite
[0112] The amino acid sequence of human alpha-1-antitrypsin protein is provided as SEQ ID NO: 45:
TABLE-US-00017 MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS 60 LYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGF 120 QELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQ 180 INDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTV 240 KVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL 300 ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKA 360 VLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
[0113] Positions 5281-5760 of pLVTHM.shRNA1 is disclosed in
Abbreviations and Definitions
[0114] The abbreviation AAT means alpha-1-antitrypsin protein. Human AAT protein is the gene product of the gene SERPINAL GenBank accession number NM_000295. It has a wild-type sequence as disclosed in the GenPept database accession number NP_000286. The gene product is a 418 amino acid precursor protein with an amino acid sequence according to SEQ ID NO: 45, comprising a 24 amino acid signal peptide. The mature protein comprises amino acid residues 25-418 of SEQ ID NO: 45. Allelic variants of wild-type AAT that do not confer AAT deficiency are known and include e.g. variants called M1, M1V, M1A, M2, M3, M4, B(Alhambra), F, P(St. Albans), and Christchurch, see e.g. the Online Mendelian Inheritance in Man database, available online at www.omim org, entry 107400. Allelic variants of human AAT that do not confer AAT deficiency when present in a human subject are denoted functional AAT in the context of this description.
DETAILED DESCRIPTION
[0115] In a first aspect, the present invention relates to ribonucleic acid molecules useful as small interfering RNA molecules (siRNAs). Such RNA molecules are useful in therapeutic methods using RNA interference to target and regulate the expression of AAT variants causing or contributing to AAT deficiency. The ribonucleic acid molecules useful as siRNAs according to the invention are typically 19, 20, or 21 nucleotides in length and comprise a sequence selected from SEQ ID NO: 39, 40, 43 and 44.
[0116] The siRNA molecules may be chemically modified in order to improve their therapeutic effect in vivo, i.a. by overcoming immune responses and elimination by endonucleases. Such chemical modifications may be modifications in the phosphodiester backbone, such as by incorporation of phosphorothioate, boranophosphate, or methylphosphonate; or in the sugar backbone such as at the 2-position of the ribose unit, such as by substitution of the 2-OH group for OCH.sub.3, CH.sub.2CH.sub.2OCH.sub.3, or F or by incorporation of 2-thiouridine, 5-methylcytidine or pseudouridine.
[0117] In a further aspect, the present invention relates to ribonucleic acid molecules useful as short hairpin RNA molecules (shRNAs). Such RNA molecules are useful in therapeutic methods using RNA interference to target and regulate the expression of AAT variants causing or contributing to AAT deficiency. The ribonucleic acid molecules useful as shRNAs according to the invention typically consists of 40-100 nucleotides, and comprises two sequences separated by a loop region of 4-10 nucleotides, wherein the two sequences are selected from the sequence pairs: SEQ ID NO: 39 and 40; and SEQ ID NO: 43 and 44.
[0118] The invention also relates to DNA molecules useful in producing shRNAs in vivo or ex vivo. Such DNA molecules comprise at least one nucleotide sequence complementary to at least one shRNA molecule as described above. A DNA molecule suitable for use in producing shRNAs according to the invention may also comprise two or three, or more, sequences complementary to shRNAs according to the invention. The sequences comprised in the DNA molecule may be complementary to one and the same, or different, shRNAs.
[0119] In a preferred embodiment, any nucleotide sequence complementary to a shRNA molecule according to the invention is operably linked to a RNA polymerase promoter sequence. Each nucleotide sequence complementary to a shRNA molecule according to the invention could be operably linked to a separate RNA polymerase promoter sequence. Alternatively, more than one nucleotide sequence complementary to a shRNA molecule according to the invention are operably linked to a single RNA polymerase promoter sequence. In one embodiment, all nucleotide sequences complementary to shRNA molecules according to the invention are operably linked to a single RNA polymerase promoter sequence.
[0120] In one embodiment, the RNA polymerase promoter sequence or RNA polymerase promoter sequences are selected from the group consisting of RNA polymerase promoters H1, 7SK, and U1.
[0121] In one aspect, the invention relates to a DNA molecule comprising a sequence encoding a functional human alpha-1-antitrypsin and having at least 90% identity to SEQ ID NO: 1, wherein said sequence comprises a plurality of point mutations in relation to SEQ ID NO: 1, said point mutations rendering an RNA-transcript of said DNA molecule resistant to gene silencing by RNA interference mediated by an RNA molecule according to the above mentioned aspects of the invention.
[0122] Preferred point mutations and their effect on resistance to gene silencing by RNA interference are disclosed in Table 1.
TABLE-US-00018 TABLE 1 Mutations in synthetic alpha-1-antitrypsin Location of silent point mutation on the M- AAT cDNA transcript sAAT sAAT2 Resistance against shRNA G75A Yes Yes No, only deletes BamHI site A105C Yes No shRNA ctrl 1 T108C Yes No 111T Yes No 112A Yes No 113G Yes No 114T Yes No C117T Yes No T120C Yes No G738A Yes No shRNA ctrl 2 C739A Yes No T741A Yes No T742C Yes No A744T Yes No C747T Yes No G789T Yes Yes shRNA2 (prior art) C790T Yes Yes G792A Yes Yes C793T Yes Yes A801G Yes Yes T919A Yes Yes shRNA1 C920G Yes Yes T921C Yes Yes C924A Yes Yes A925T Yes Yes G926C Yes Yes C927T Yes Yes T928C Yes Yes A930G Yes Yes T933C Yes Yes T934C Yes Yes A936C Yes Yes T984C Yes Yes shRNA3 A987G Yes Yes C988T Yes Yes G990A Yes Yes C993T Yes Yes C996T Yes Yes T999A Yes Yes
[0123] In one embodiment, the DNA molecule comprising a sequence encoding a functional human alpha-1-antitrypsin also comprises the G75A mutation in relation to SEQ ID NO: 1, which mutation renders a BamH1 site in SEQ ID NO: 1 inoperative.
[0124] In a preferred embodiment of the above aspect, the functional human alpha-1-antitrypsin encoded by the DNA molecule comprises or consists of an amino acid sequence according to positions 25-418 of SEQ ID NO: 45. In one embodiment, the functional human alpha-1-antitrypsin encoded by the DNA molecule comprises or consists of an amino acid sequence according to SEQ ID NO: 45.
[0125] In one aspect, the invention relates to an RNA molecule useful as a synthetic retroviral gene for use in a gene delivery based on a retrovirus. Such RNA molecules should comprise sequences that, when used in an appropriate retroviral vector, serves to express the shRNA molecules according to the above mentioned aspects of the invention and/or mRNA for functional alpha-1-antitrypsin, that is resistant to gene silencing by said shRNA molecules or the siRNA molecules according to the invention. Such RNA molecules typically comprise a nucleotide sequence complementary to DNA molecules according to the above mentioned aspects.
[0126] In one aspect, the invention relates to virus particles comprising a recombinant viral genome, wherein said genome comprises a DNA molecule comprising the sequence of a DNA molecule according to the above aspects, encoding shRNA molecules and/or functional human alpha-1-antitrypsin resistant to gene silencing by said shRNA molecules or the siRNA molecules according to the invention.
[0127] In one aspect, the invention relates to virus particles comprising a recombinant viral genome, wherein said genome comprises an RNA molecule comprising the sequence of an RNA molecule according to the above aspects, encoding shRNA molecules and/or functional human alpha-1-antitrypsin resistant to gene silencing by said shRNA molecules or the siRNA molecules according to the invention. Such virus particles are useful as viral delivery vehicles of the nucleic acid materials according to the invention.
[0128] In one aspect, the invention relates to non-viral delivery vehicles for nucleic acid material to a human cell in vivo, wherein said vehicle comprises a DNA molecule according to the above aspects, encoding shRNA molecules and/or functional human alpha-1-antitrypsin resistant to gene silencing by said shRNA molecules or the siRNA molecules according to the invention. Alternatively or additionally, the non-viral delivery vehicle may comprise an RNA molecule according to the above aspects, encoding shRNA molecules and/or functional human alpha-1-antitrypsin resistant to gene silencing by said shRNA molecules or the siRNA molecules according to the invention.
[0129] The non-viral delivery vehicle may be selected from the group plasmid DNA, lipid-based vectors, and polymeric vectors.
[0130] In a further aspect, the invention relates to a method for treatment of a subject comprising administering a nucleic acid molecule according to the invention to a subject in need thereof. In embodiments of this aspect, the nucleic acid material is administered by the viral or non-viral delivery vehicles discussed above. The non-viral delivery vehicles may be administered by e.g. gene gun/ballistic DNA, electroporation, sonoporation, hydroporation, magnetofection, or needle injection.
[0131] In a preferred embodiment, the condition to be treated by the method of treatment is alpha-1-antitrypsin deficiency. In one embodiment, the subject to be treated carries the G342K mutation in a gene encoding alpha-1-antitrypsin, and may be homozygous or heterozygous for this mutation. Thus, in one aspect the method further comprises analysis of the genome of a potential subject to be treated with respect to mutation status of a gene encoding alpha-1-antitrypsin and determination of whether the subject carries the G342K mutation in a gene encoding alpha-1-antitrypsin. A subject carrying the G342K mutation in at least one allele is particularly amenable to treatment with the method according to the invention.
[0132] In one embodiment, the alpha-1-antitrypsin deficiency manifests as liver cirrhosis, pulmonary emphysema, necrotising panniculitis, systemic vasculitis, aneurysms (such as intracranial aneurysms), fibromuscular dysplasia, bleeding disorders, anterior uveitis, systemic necrotizing vasculitis or Wegener granulomatosis.
[0133] In one aspect, the invention relates to the nucleic acids, and viral and non-viral delivery vehicles according to the invention for use in methods for treatment of the human or animal body, preferably the human body, even more preferably in the methods of treatment according to the above mentioned aspects of the invention.
[0134] In one aspect, the invention relates to the use of the nucleic acids, and viral and non-viral delivery vehicles according to the invention for use in the manufacture of a pharmaceutical composition for use in methods for treatment of the human or animal body, preferably the human body, even more preferably in the methods of treatment according to the above mentioned aspects of the invention.
[0135] The various aspects and embodiments of the invention are further explained and described below. Detailed background knowledge and information relevant to the invention are also discussed in the background section of the present disclosure and in the references discussed throughout this disclosure, which are all explicitly incorporated by reference herein.
[0136] Elimination of the Misfolded AAT Protein:
[0137] The technique of RNA interference was used to decrease the synthesis of endogenous and potentially hazardous AAT. RNA interference was mediated by short-hairpin RNA, although the functionality of the specific RNA sequences used for knockdown of the endogenous AAT gene are not limited to shRNA molecules but can also be exploited to other RNA interfering molecules such as siRNA and miRNA.
[0138] In the experiments described in this invention, shRNA expression was mediated by lentiviral vectors that had integrated into the cell genome. Expressional activity was controlled by the RNA polymerase III promoter H1, the RNA polymerase promoter III 7SK, or the RNA polymerase II promoter U1. Expression of shRNA was either unicistronic from one H1 promoter, or multicistronic from multiple RNA polymerase promoters. Unicistronic expression was accomplished by cloning of the shRNA oligonucleotides (SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, scramble SEQ ID NO: 25, scramble SEQ ID NO: 26) into the lentiviral transfer vector pLVTHM using the MluI and ClaI restriction sites as suggested by the original work (
[0139] HEK293T producer cell lines were transfected with lentiviral vectors along with structural plasmids psPAX2 and pMD2.G in order to produce viral particles. Viral particles were used to infect target cells, to release and to integrate the genetic information into the cell genome provided by the transfer vector. Normally, the gene sequence inserted into the target cell genome upon target cell transduction is framed by the 5LTR and the self-inactivating of the transfer vector. In these experiments, variants of pLVTHM were used to integrate single or multiple shRNAs, combined with recombinant protein (sAAT2) or not.
[0140] The insertion order of the following genetic elements is presented in a 5-3 directional manner [0141] (i) For the viral particles produced with transfer vector with unicistronic (expression of one single shRNA from one promoter) shRNA expression, the 5LTR was integrated followed by the psi-packaging signal, the Rev responsive element (RRE), the EF-1 promoter, the (cPPT), the eGFP coding sequence, the Woodchuck Hepatitis Virus (WHP) Posttranscriptional Regulatory Element (WPRE), the tetracycline responsive element (TetO), the EcoRI cloning site, the H1 promoter, the MluI cloning site, the cloned shRNA oligonucleotide, the ClaI restriction site and the self-inactivating 3 LTR (
[0144] It is essential to note that in the mentioned multicistronic transfer vectors, the shRNA sequences are interchangeable, i.e. in one vector shRNA expression is not confined to one type of shRNA (e.g. shRNA1). Each promoter individually controls the expression of its succeeding shRNA, meaning that in the presence of three different promoters there is the possibility to express two different shRNA (shRNA1 plus shRNA 3) using one single lentiviral vector.
[0145] Some publications suggest that using one and the same RNA polymerase promoter in multicistronic shRNA expression has no influence on the efficiency of shRNA expression (Stove et al., 2006). However, it has been demonstrated that recombinational events may occur between homology sequences when using promoters of the same type (ter Brake O et al., 2008). Therefore, distinct RNA polymerase promoters were chosen to mediate individual shRNA expression from one lentiviral vector to achieve highly efficient knock-down of the target gene. In this invention these were the 7SK promoter, the U1 promoter and the H1 promoter already integrated into the pLVTHM transfer vector.
[0146] The interfering RNA sequences were designed by the means of online RNAi design web tools made available by Invitrogen, Thermo Scientific and Invivogen. In this specific application, the described experiments implement the calculated RNA sequences as short-hairpin RNAs expressed with the help of RNA polymerase promoters delivered to target cells by the means of lentiviral delivery. It has to be emphasized that the calculated RNA sequences are not limited to the use as solely shRNAs, but can also be introduced into target cells and tissue by other viral or non-viral delivery systems which use miRNA and siRNA as expression modulators instead of shRNAs. The experiments described in this application are used as examples of RNAi with these specific RNA sequences.
[0147] Three positive control shRNA (shRNA ctrl 1, shRNA ctrl 2 and shRNA2) that had previously published were taken along with experiments. The target sequence of shRNA ctrl 1 is located at 102-120 bp of the ORF of NM_000295.4 (sense strand SEQ ID NO: 5; anti-sense strand SEQ ID NO: 6). The sequences were integrated into the sense and anti-sense cloning oligonucleotides SEQ ID NO: 7 and SEQ ID NO: 8. The target sequence of shRNA ctrl 2 is located at 732-752 bp of ORF of NM_000295.4 (sense strand SEQ ID NO: 9, anti-sense SEQ ID NO: 10). The matching cloning oligonucleotides were SEQ ID NO: 11 and SEQ ID NO: 12. The target sequences for shRNA2 were 785-803 bp of the ORF of NM_000295.4 (sense SEQ ID NO: 17, anti-sense SEQ ID NO: 18; sense oligonucleotide SEQ ID NO: 19 and antisense SEQ ID NO: 20). The sense and anti-sense oligonucleotides were annealed and cloned into the linearized pLVTHM lentiviral transfer vector.
[0148] The target sequences were for shRNA 1 917-937 bp of the ORF of NM_000295.4 (sense SEQ ID NO: 13, anti-sense SEQ ID NO: 14; sense oligonucleotide SEQ ID NO:15 and antisense SEQ ID NO: 16), and for sRNA 3 981-1001 bp of the ORF of NM_000295.4 (sense SEQ ID NO: 21, anti-sense SEQ ID NO: 22; sense oligonucleotide SEQ ID NO: 23 and antisense SEQ ID NO: 24). The sense and anti-sense oligonucleotides were annealed and cloned into the linearized pLVTHM lentiviral transfer vector. In the original pLVTHM lentiviral transfer vector, shRNA expression is mediated by the H1 promoter in a unicistronic manner. In the newly designed multicistronic versions of pLVTHM, shRNAs were expressed each individually controlled by one specific RNA polymerase promoter. Theoretically, one could randomly combine any shRNA in these vectors to create the most the efficient RNAi knock-down tool.
[0149] Rescue Expression of Synthetic AAT (sAAT/sAAT2)
[0150] In this invention, synthetic AAT is expressed by lentiviral vectors to replace the AAT that has been subject to RNA interference mediated by shRNA and to replace defective AAT. However, expression of the synthetic proteins described in this invention is not limited to lentiviral vectors, but can be extended to all kinds of viral and non-viral expression systems. Expression of sAAT and sAAT2 does not have to be combined with the expression of shRNAs, but can be stand alone as well.
[0151] sAAT/sAAT2 were cloned into the lentiviral transfer vector pSFFV.IRES.dTomato in which shRNA and rescue expression of the recombinant sAAT/sAAT2 was not combined. When using this approach, target cells were first transduced with LV-shRNA introducing the essential elements for knock-down of endogenous M-AAT/Z-AAT. Subsequently, target cells were transduced with LV-sAAT to ensure replacement expression of sAAT. Double transduction of target cells is possible and this approach has been widely used to transduce cells with several recombinant proteins at a time. However, risks are lower transduction efficiency and increased cell toxicity.
[0152] The expression of the recombinant protein sAAT and sAAT2 was controlled by the spleen focus forming virus (SFFV) promoter. The SFFV promoter was chosen because of its strong eukaryotic expression ability in various cell types and its safety characteristics. Numerous publications use the SFFV promoter to mediate highly efficient expression of recombinant proteins. The high expressional activity of SSFV may be a crucial prerequisite to overcome the serum level therapeutic threshold of AAT needed to treat AATD related lung emphysema. Other eukaryotic promoters, including hepatocyte derived Albumin promoter may not exhibit expressional activity high enough to secure AAT serum levels above the 11 M threshold.
[0153] The synthetic sAAT and sAAT2 were designed with integrated point mutations compared to wild-type NM_000295.4 to (i) eliminate one BamHI restriction site at position 75 nt of the ORF of NM_000295.4 and (ii) to render the synthetic AAT gene sequence and mRNA resistant against the introduced interfering RNAs. By deletion of the BamHI restriction site the recombinant gene sequence will be flanked by BamHI restriction sites to facilitate restriction analysis patterns and to be able easily excise the whole gene in subsequent cloning strategies. However, the BamHI site is not essential for the invention and does not have implications on expression levels of sAAT/sAAT2 or shRNA knockdown ability.
[0154] In order to test the application and to compare with suitable positive controls one designed sAAT. sAAT does contain the silent point mutations making it resistant to all shRNA described above including the control shRNAs. In contrast, sAAT2 does not contain the silent mutations within the target sequences of shRNA ctrl 1 and shRNA ctrl 2. Thus, sAAT2 equals the naturally occurring M-AAT to higher extent which may have beneficial effects on expression levels and sustainability in the blood stream.
[0155] The target sequences of all shRNAs are presented in the sequence of wild-type M-AAT (NM_000295.4 SEQ ID NO: 1). Z-AAT differs from M-AAT by only one amino acid exchange which is located outside the sequences targeted by the shRNAs. Therefore, in the context of RNA interference mediated by these specific shRNAs, Z-AAT can be considered as being equivalent to M-AAT in this application. Although shRNAs do not target sAAT or sAAT2, the sequences in sAAT/sAAT2 corresponding to the targeted sequences in M-AAT/Z-AAT are highlighted in the sAAT/sAAT2 genes (SEQ ID NO: 2 and SEQ ID NO: 3) for reasons of clarification.
[0156] Primers for Wild Type AAT and Synthetic sAAT
[0157] Knock-down efficiency and rescue expression of sAAT/sAAT2 was monitored mainly by the means of quantitative PCR. In order to distinguish M-AAT/Z-AAT from sAAT/sAAT2, primers were designed to specifically recognize and amplify either M-AAT/Z-AAT or sAAT/sAAT2. In the synthetic version of AAT, silent point mutations were integrated at short-stretched specific locations to render the sAAT/sAAT2 immune against shRNAs. These modified genetic stretches were approximately 19-21 bp long, representing the ideal template for sAAT/sAAT2 specific qPCR primers.
[0158] For M-AAT/Z-AAT detection, the primer pair 1/2 used the forward (sense) target sequence of shRNA 2 (prior art) (785-803 bp) of M-AAT/Z-AAT as a forward qPCR primer template (SEQ ID NO: 29) and the reverse (anti-sense) target sequence of shRNA 3 (981-1001 bp) of M-AAT/Z-AAT as a reverse qPCR primer template (SEQ ID NO: 30).
[0159] For detection of sAAT/sAAT2, the primer pair 3/4 used the forward (sense) sequence of sAAT/sAAT2 replacing the target sequence of shRNA 2 (prior art) (785-803 bp) as a forward qPCR primer template (SEQ ID NO: 31) and the reverse sequence (anti-sense) of sAAT/sAAT2 replacing the reverse target sequence of shRNA 3 (981-1001 bp) as a reverse qPCR primer template (SEQ ID NO: 32). The primer pair exclusively detected DNA template from sAAT/sAAT2, resulting in the amplication of sAAT/sAAT2 fragments only. The discrimination against M-AAT/Z-AAT made it a valuable asset in specifically detecting synthetic AAT.
[0160] In the qPCR experiments, the malate dehydrogenase (MDH) gene was used as reference gene. The MDH specific primers (SEQ ID NO: 33 and SEQ ID NO: 34) were previously published in Riedel et al (2013).
[0161] Sequencing Primers
[0162] In order to detect the insertion of the cloning oligonucleotides in pLVTHM.shRNA1, pLVTHM.shRNA13 or pLVTHM.shRNA1x3.sAAT2, sequencing primers were design to amplify the nucleotide template located between the EcoRI cloning site located upstream of the and the ClaI site at the 3 end of the insertion site. This allowed full length sequence analysis of short shRNA only insertions as well as extenden sAAT-multiple shRNA insertions.
[0163] Methods
[0164] The following section describes methods useful in working the present invention. The methods are exemplary and illustrative, and shall not be considered as limiting the scope of the invention, which is that of the appended claims. The skilled person will appreciate that materials and methods that are common general knowledge in the art may also be used to put the present invention into practice. Such materials and methods are disclosed i.a. in Molecular Cloning: A Laboratory Manual (Sambrook et al., CSH Laboratory Press, NY, USA), Gene Biotechnology (Wu et al., CRC Press) and Bioanalytik, (Lottspeich, 1998, Spektrum Akademischer Verlag, Heidelberg).
[0165] Cell Culture Maintenance
[0166] Lenti- 293T Cell Line (ClonTech #632180) was used for lentiviral production. The cells cultures were thawed according to manufacturer's instructions and maintained in T-175 cm.sup.2 flasks containing Dulbecco's Modified Earl's Medium (DMEM; Lonza # BE12-614F) supplemented with 100E/100E Penicillin/Streptomycin (PenStrep; Lonza #17-602E), 2 mM L-Glutamine (Lonza #17-605E), 1 mM sodium pyruvate (Lonza # BE13-115E) and 10% HyClone Fetal Bovine Serum (FBS; GE # SV30160.03) if not stated otherwise.
[0167] HepG2 cells (Sigma-Aldrich #85011430-1VL) were used for transduction experiments. The cells were thawed according to the manufacturer's instructions and maintained in T-175 cm.sup.2 flasks containing Roswell Park Memorial Institute medium (RPMI; Lonza # BE12-115F) supplemented with Penicillin/Streptomycin and 10% FBS if not stated otherwise.
[0168] For sub-cultivation, cell cultures were washed with Dulbecco's phosphate buffered saline (DPBS, Lonza #17-512F), trypsinised with HyClone Trypsin 0.05% (GE SH40003.01), resuspended in medium and transferred into new cell culture flasks.
[0169] Generation of Lentiviral Transfer Plasmids
[0170] Cloning of Single shRNA into pLVTHM
[0171] siRNA/shRNA sense nucleotide sequences were designed by the web based RNAi software Block-iT RNAi designer by Invitrogen, GeneAssist Custom siRNA Builder by Thermo Scientific and siRNA Wizard by Invivogen. The sense and anti-sense oligonucleotides were designed as described by Wiznerowicz and Trono. The paired sense and anti-sense oligonucleotides contained an overhang 5-MluI restriction site, followed by a CCCC linker element, the 19-21 nucleotide (nt) sense siRNA sequence, the ACTCGAGA hairpin loop, the 19-21 nt anti-sense siRNA sequence, the TTTTT termination signal, a GGAA linker and an overhang 3-ClaI restriction site. The overhang restriction sites were implemented to easily insert the oligonucleotide into the lentiviral transfer vector linearised with ClaI and MluI.
[0172] Sense and anti-sense oligonucleotides were acquired from Eurofins Genomics with high liquid pressure chromatography (HLPC)-purity and diluted to stock solutions with concentration around 2 g/ml (100 M). 2 g of sense and 2 g anti-sense oligonucleotides of one oligonucleotide pair were transferred into a 1.5 ml centrifugation tube and diluted with 48 l annealing buffer (10 mM Tris, 50 mM NaCl, 1 mM EDTA, pH 7.5-8.0). The oligo mixture was incubated at 95 C. and cooled down at RT for >45 min.
[0173] The annealed oligonucleotides were cloned into the pLVTHM (a gift from Didier Trono, Addgene plasmid #12247) shRNA expressing lentiviral transfer plasmid backbone using a standardized cloning protocol. In short, 2 g of pLVTHM was digested with 1 l/10 units MluI (New England Biolabs, NEB R0198S) and 2 l/20 units ClaI (NEB R0197S) in NEB buffer 3.1 at 37 C. for 10 minutes. The restriction enzymes were heat-inactivated at 65 C. for 20 min and the digested plasmid was gel-purified using the Macherey & Nagel (M&N) Gel and PCR Clean-up kit (M&N #740609.250) following the manufacturer's instructions. The annealed oligonucleotides were diluted 1:10 and 1:100. 1 l of diluted oligonucleotides were ligated into 200 ng of the linearised pLVTHM vector using 1 l/400 u T4 ligase (NEB M0202S), 13.5 l distilled water and 2 l 10 ligase buffer (NEB B0202S). The ligation reaction was incubated at room temperature for 30 minutes and the ligase was heat-inactivated at 65 C. for 10 minutes. 1-5 l of the ligation mixture was immediately transformed into One Shot STBL3 chemically competent E. coli (Invitrogen #C737303) following the manufacturer's instructions. Transformed STBL3 E. coli were transferred into LB-Agar plates containing 50 g/ml Ampicillin and incubated overnight at 37 C. Bacterial colonies were transferred into LB-medium containing 50 g/ml Ampicillin and incubated overnight at 37 C. in a rotating shaker. The high copy plasmids from the bacterial overnight cultures were purified in a mini-scale (NucleoSpin Plasmid, M&N #740588.250), medium-scale (NucleoBond PC 100, M&N #740573) or large-scale (NucleoBond PC 2000, M&N #740576) format following the manufacturer's instructions. The purified plasmids were named pLVH.shRNActrl1, pLVTHM.shRNActr12, pLVTHM.shRNA1, pLVTHM.shRNA2 or pLVTHM.shRNA3, respectively (common name as a group: pLVTHM.shRNA). The transfer plasmids were analysed for shRNA oligonucleotide insertion by restriction digest analysis and by sequencing using sequencing primers 100 and 101 upstream and downstream of the MluI/ClaI insertion site. Sequencing was performed using the Mix2Seq sequencing services of Eurofins Genomics.
[0174] Design of Synthetic Alpha-1-Antitrypsin (sAAT)
[0175] There were several prerequisites for the recombinant synthetic alpha-1-antitrypsin. First, the recombinant synthetic alpha-1-antitrypsin should easily be cloned into a well-known lentiviral expression vector. Second, the newly designed sAAT should also be resistant to all shRNA/siRNA directed against naturally occurring alpha-1-antitrypsin (M-AAT and all MZ, ZZ isoforms) tested in this application. Third, it was required that the lentiviral expression vector had a high expressional activity in human hepatocytes in order to ensure sufficient rescue expression of the recombinant sAAT and to maintain therapeutical levels of alpha-1-antitrypsin in the blood stream.
[0176] In order to meet these prerequisites, a total of 39 nucleotides of the wild-type M-AAT (NM_000295.4) were manually identified as candidates for silent point mutations, thereby protecting the wild-type amino acid sequence and protein folding as seen in M-AAT. While 38 point mutations were introduced to render sAAT resistant to shRNA/siRNA knock-down, one single silent point mutation (G75A) was introduced to delete one BamHI restriction site within the open reading frame of M-AAT (Table 1). The deletion of the in-frame BamHI restriction site made it possible to flank the recombinant sAAT with BamHI restriction sites and to digest the recombinant sAAT gene with BamHI without interrupting the ORF. This way it was possible to easily introduce the full-length sAAT into the lentiviral expression vector pSFFV.IRES.dTom that uses BamHI restriction sites for insertion of recombinant genes. pSFFV.sAAT.IRES.dTom was a gift from Axel Schambach (Medizinische Hochschule Hannover, Germany).
[0177] Cloning of sAAT
[0178] Synthesis and cloning of sAAT into pSFFV.IRES.dTom was performed by GeneArt gene synthesis and cloning services from ThermoFisher Scientific. The product was named pSFFV.sAAT.IRES.dTom (
[0179] Design of Transfer Vector Containing Multiple shRNAs
[0180] Expression of shRNA is dependent on the promotional activity regulating the RNA Polymerases. In pLVTHM.shRNA, expression of the single shRNA is dependent of the H1 promoter (5398-5612) located upstream of the MluI/ClaI cloning site (5611-5681) for shRNA-oligonucleotides. One approach to maximize sRNA knockdown of native alpha-1-antitrypsin was to multiply the numbers of shRNA elements in the pLVTHM.shRNA vector. This could be achieved by insertion of additional shRNAs, each individually regulated by the promotional activity of specific RNA polymerase promoters such as the RNA polymerase III 7SK promoter and RNA polymerase II U1 promoter. An EcoRI restriction site (5392) was located upstream of the H1 promoter allowing insertion of such additional elements into pLVTHM.sRNA.
[0181] The design of the insert (SEQ ID NO: 37) containing additional RNA polymerase promoters and shRNAs included a 5' GCGC overhang, an EcoRI site (GAATTC) followed by a BsiWI site (CGTACG), the 7SK promoter sequence CTGCAGTATTTAGCATGCCCCACCCATCTGC AAGGCATTCTGGATAGTGTCAAAACAGCCGGAAATCAAGTCCGTTTATCTCAAAC TTTAGCATTTTGGGAATAAATGATATTTGCTATGCTGGTTAAATTAGATTTTAGTT AAATTTCCTGCTGAAGCTCTAGTACGATAAGTAACTTGACCTAAGTGTAAAGTTG AGATTTCCTTCAGGTTTATATAGCTTGTGCGCCGCCTGGGTACCTC, the shRNA sense-loop-antisense sequence CGCGTCCCCGGTCTGCCAGCTTACATTTACACTCGAGA GTAAATGTAAGCTGGCAGACC (for shRNA 1; sense and anti-sense in italique, hairpin loop underlined), a GGTCTTCACCTGAGG spacer, the 7SK terminations sequence TTTTT, a GCGCGCGC spacer, the U1 promoter sequence CTAAGGACCAGCTTCTTTGGGAGAGAACAGACGCAGGGGCGGGAGGGAAAAAG GGAGAGGCAGACGTCACTTCCCCTTGGCGGCTCTGGCAGCAGATTGGTCGGTTGA GTGGCAGAAAGGCAGACGGGGACTGGGCAAGGCACTGTCGGTGACATCACGGAC AGGGCGACTTCTATGTAGATGAGGCAGCGCAGAGGCTGCTGCTTCGCCACTTGCT GCTTCACCACGAAGGAGTTCCCGTGCCCTGGGAGCGGGTTCAGGACCGCTGATCG GAAGTGAGAATCCCAGCTGTGTGTCAGGGCTGGAAAGGGCTCGGGAGTGCGCGG GGCAAGTGACCGTGTGTGTAAAGAGTGAGGCGTATGAGGCTGTGTCGGGGCAGA GGCCCAAGATCTC, a second shRNA sense-loop-antisense sequence CGCGTCCCC GGTCTGCCAGCTTACATTTACACTCGAGAGTAAATGTAAGCTGGCAGACC (for shRNA 1; sense and anti-sense in italique, hairpin loop underlined), a GCAGTCTGGAG spacer, the U1 termination sequence TTTCAAAAGTA GACTG, an 3 EcoRI site and a 3 GCGC overhang.
[0182] Synthesis of the newly designed insert and cloning into pLVTHM.shRNA was performed by GeneArt gene synthesis and cloning services from ThermoFisher Scientific. The newly generated plasmids were purified as described earlier. Insertion was validated by sequencing and restriction analysis. The plasmids were named pLVTHM.shRNAYx3 (Y representing the character of the shRNA=shRNA1 shRNA2 or shRNA3) and allowed expression of triple shRNA controlled by three individual RNA polymerase promoters.
[0183] Design of Transfer Vector Containing Combined Expression of a Rescue Synthetic Alpha-1-Anitrypsin 2 (sAAT2) and Multiple shRNAs
[0184] One major goal was to acquire simultaneous expression of multiple shRNA and recombinant synthetic alpha-1-antitrypsin resistant to shRNA from transduction with one lentiviral specimen. To achieve this, expressional elements needed for the rescue expression of a synthetic alpha-1-antitrypsin 2 (sAAT2) were integrated into one cloning oligonucleotide insert along with additional RNA polymerase promoters and shRNAs. The expressional elements were spleen focus forming virus (SFFV) promoter, a spacer and the ORF of sAAT2 and were flanked by a BsiWI restriction site. The SFFV promoter is characterized by high expressional activity in hepatocytes. sAAT2 (SEQ ID NO:3) was modified compared to sAAT by removing the silent point mutations causing resistance against shRNA ctrl 1 and shRNA ctrl2. The sequence of the entire insert containing sAAT2 expressional elements and multiple shRNAs1 can be viewed in sequences as SEQ ID NO: 38.
[0185] The insert was synthesized as a whole and cloned into pLVTHM.shRNA by GeneArt gene synthesis and cloning services from ThermoFisher Scientific. The newly generated plasmids were purified as described earlier. Insertion was validated by sequencing and restriction analysis.
[0186] Lentivirus Production Using the Calcium Chloride Transfection Method
[0187] The procedures for lentiviral production were based on the calcium chloride transfection method described earlier (Dull et al., 1998). The following stock solutions were prepared in advance:
[0188] HBS (2): 50 mM HEPES, 280 mM NaCl (16.36 g/L), 1.5 mM Na.sub.2HPO.sub.4 (0.21 g/L), adjust pH to 7.12 with 5 M NaOH.
[0189] Calcium Chloride (2.5 M): 27.75 g anhydrous CaCl.sub.2 (Sigma #C5670) are dissolved in 100 ml dH.sub.2O, sterile-filtered through a 0.22 m filter and aliquoted into 1 ml aliquots.
[0190] Chloroquine (25 mM): 0.129 g chloroquine diphosphate salt (Sigma #C6628) were dissolved in 10 ml distilled water, sterile-filtered through a 0.22 m filter and aliquoted into 500 l aliquots.
[0191] Protamine sulfate (8 mg/ml): 80 mg protamine sulfate (Sigma # P4020) were dissolved in 10 ml distilled water, sterile-filtered through a 0.22 m filter and aliquoted into 500 l aliquots.
[0192] 10-14 days before lentiviral production HEK293T were propagated frequently every 2-3 days in T175 cm.sup.2 flasks. 24 hours before transfection, cells were harvested and 4.5*10.sup.6 HEK293T cells were seeded into 10 cm Petri dishes containing DMEM+supplements. Two hours before transfection, cell confluency was determined and should have reached approximately 70%-80%. The cell medium was exchanged to DMEM containing Penicillin/Streptomycin, 1 mM L-glutamine, 1 mM sodium pyruvate 10% FCS, 10 mM chloroquine (Sigma #6628) and 10 mM HEPES (Gibco #15630-080).
[0193] Preparation of the transfection plasmids were started one hour before transfection. For a large-scale batch of lentiviral production of one specific lentivirus, ten Petri dishes were treated with transfection plasmids. The following numbers are stated as the required amounts for each Petri dish. For a medium-scale lentiviral production using ten Petri dishes the numbers have to be multiplied by ten. The plasmids pMD2.G, and psPax2 and were a gift from Didier Trono (Addgene plasmid #12259, and 12260, respectively).
[0194] 10 g of lentiviral transfer plasmid, 12 g of psPax2 plasmid (containing the Gag-pol-rev genes) and 1.5 g of the vesicular stomatitis virus (VSV) envelope expression plasmid pMD2.G plasmid were mixed in a 50 ml conical tube. The plasmids were diluted with sterile distilled water to a volume of 450 l and 50 l2.5 M CaCl.sub.2 were added. The mixture was transferred into 500 l room temperature HBS (making it a total volume of 1000 l), incubated at room temperature for 20 minutes. One ml of the mixture was added dropwise moving in circles above the Petri dish to cover the entire dish area. The transfected cells were incubated for 12 hours at 37 C. at 5% CO.sub.2. The medium was exchanged 12 and 24 hours after transfection with DMEM containing supplements without chloroquine. The cell culture supernatant containing the lentiviral particles was collected 36 hours after transfection and sterile filtered through 0.22 m Millex-GP filters (Millipore # SLGP033RS). The sterile filtered supernatant, approximately 70 ml in total volume, was transferred into the Centricon Plus-70 Centrifugal Filter Units.
[0195] Concentration of the Lentivirus by Ultrafiltration
[0196] A 15-20-fold concentration of the lentivirus supernatant was achieved by ultrafiltration with the Centricon Plus-70 Centrifugal Filter Units (Millipore #UFC710008). A total of 70 ml sterile filtered supernatant was transferred into the Centricon Plus-70 Centrifugal Filter Unit container and placed into a refrigerated centrifuge. The supernatant was filtered by centrifugation at 3500 g at 4 C. for approximately 17-20 minutes until the retained supernatant reached a volume of about 3-4 ml. The container was placed into the collection cup and centrifuged at 1500 g, 4 C. for 2 min. The concentrated lentivirus was aliquoted into 1.5 ml centrifugation tubes and stored at 80 C.
[0197] Determination of Lentivirus Titers Using FACS
[0198] Titration of the lentivirus was performed using flow cytometry associated sorting (FACS)-based calculations of multiplicity of infection (MOI) and infective particles per volume. The concentrated lentiviral was diluted 1:10 with RPMI 1640+supplements. 1*10.sup.5 HepG2 cells were seeded into each well of a 24-well dish and maintained in RPMI 1640+supplements containing 4 g/ml protamine sulphate. For transduction, rising volumes (i.e. 1 l, 2 l, 5 l, 10 l, 20 l and 40 l) of the diluted lentivirus were added to the HepG2 cells and incubated at 37 C. 5% CO.sub.2 for 24 hours. Medium was exchanged every two to three days. The HepG2 cells were harvested on day five for flow cytometry analysis. Cells were washed with PBS (GE, #) once and treated with 100 l0.05% trypsin acid (EDTA, GE, #) for 5 minutes at 37 C. Cells were detached by soft shaking of the wells and resuspended with 400 l RPMI+supplements. The cells were centrifuged at 300 rcf for 5 min and resuspended with 300 l FACS buffer (PBS+1% BSA+2 mM EDTA). The percentage of fluorescent cells was detected by flow cytometry and used to calculate the viral.
[0199] Lentivirus Infection of Target Cells
[0200] Concentrated lentivirus was thawed shortly before transduction of cells. HepG2 cells were seeded at a density of 0.45*10.sup.5 or 1*10.sup.6 cells into the wells of 12-well dishes or 6-well dishes, respectively, prior to transduction and maintained in RPMI 1640+supplements+protamine sulfate. Target HepG2 cells were transduced with a calculated amount of infective lentiviral particles equaling the desired MOI. Transduction was performed for 24 hours at 37 C, 5% CO.sub.2. Medium was exchanged 24 hours after transduction and cells were maintained with RPMI supplemented with 10% FCS and Penicillin/Streptomycin. Medium was exchanged every two to three days. Cells were prepared for Western Blot, FACS or quantitative real-time PCR at least three days after transduction.
[0201] FACS and Sub-Cultivation
[0202] HepG2 cells were prepared and pelleted as mentioned in the protocol for determination of lentiviral titers by FACS. The cells were resuspended in PBS (+5 mM EDTA) and filtered through a cell strainer with 40 m pores (Falcon 352340). The cells were sorted for eGFP fluorescent cells and sub-cultured in 6 well plates for analysis with FACS, qPCR and Western Blot once recovered.
[0203] mRNA Isolation
[0204] Total RNA from transduced and non-transduced cells was isolated using the RNA isolation kit from Macherey & Nagel (reference number 740955.250). All steps were performed on ice. In detail, cell medium was discarded, 250 l Lysis Buffer RA1 supplemented with 1% (v/v) -mercaptoethanol was added to the cells and incubated for 1 minute. The entire cell layer was repeatedly aspirated with a 3 ml syringe to disrupt the cell membrane and release RNA. The cell suspension was transferred into the NucleoSpin filter units accompanying the RNA isolation kit. RNA isolation was performed using the manufacturer's instructions. RNA was eluted with 60 l RNAse-free water. DNAse digestion of the RNA samples was repeated with the QIAGEN DNAse digestion kit to ensure minimal background DNA signals during qPCR.
[0205] Additional Digestion of RNA with DNAse and RNA Precipitation
[0206] Isolated mRNA was once again digested with QIAGEN RNAse-free DNAse set (50) (Qiagen #79254) following the manufacturer's instructions to ensure efficient removal of residual genomic DNA. In detail, 30 l of isolated mRNA was treated with 10 l Rx buffer RDD, 2.5 l DNAse and 57.5 l water and incubated for 30 min at room temperature. RNA was precipitated using the sodium acetate ethanol precipitation assay. For this, 10 l (1/10 volume) of 3 M sodium acetate was added to the mRNA mixture treated with DNAse along with 2.5 times volume 100% Ethanol. The mixture was incubated at 20 for at least two hours and centrifuged at 4 C. for 60 min at 11000 g. The RNA pellet was washed with 200 l 70% ethanol and air-dried for 15 min. The RNA pellet was resuspended with 50 l RNAse-free water. The RNA concentration was determined using the Nanodrop 2000.
[0207] Reverse Transcription
[0208] Reverse transcription was performed with High Capacity cDNA Reverse Transcription Kit (ThermoFisher Scientific #4368814) following the manufacturer's instructions. In short, 500 ng RNA were mixed with 2 l reverse transcriptase (RT) buffer, 0.8 l dNTPs, 2 l random primer, 1 l RT (50 u) and distilled water was added up to a total volume of 20 The reverse transcription reaction was performed at 25 C. for 10 min, at 37 C. for 120 min, at 85 C. for 5 min and kept on hold at 4 C. until further treatment.
[0209] qPCR
[0210] cDNA samples were diluted 1:10 with distilled water. qPCR reactions were performed using iQ SYBR Green Supermix (BioRad #170-8886) following the manufacturer's instructions. In short, 5 l diluted cDNA was mixed with 0.5 l forward qPCR primer, 0.5 l reverse qPCR primer, 10 l of SYBR Green mix and 4 l distilled water per sample. qPCR cycles were one denaturation cycle at 95 C. for 2 min, then 39 cycles of 5 seconds denaturation at 95 C. and elongation at 60 C. for 30 seconds. At the end, a melting curve was determined. Gene expression analysis was performed using the AACT method (Livak and Schmittgen, 2001).
[0211] Western Blot
[0212] Medium supernatant of transduced and non-transduced HepG2 cells was collected in 1.5 ml 1.5 ml centrifugation tubes and protein was precipitated by trichloroacetic (Sigma # T6399) acid protein protocol.
[0213] The cell medium supernatant was treated with 100% trichloroacetic acid to a final volume of 20% trichloroacetic acid. The mixture was centrifuged at 4 C. for 30 minutes and the precipitate was resuspended in 300 l treated with
[0214] 10 mls T-PER Tissue Protein Extraction Reagent (Thermo #78510) containing one tablet Complete protease inhibitor (Sigma #000000011697498001) and one tablet Phosstop (Sigma #000000004906845001).
[0215] The protein concentration of the resuspended precipitate and the cell lysate was determined by Pierce 660 nm Protein Assay Reagent (Thermo #22860) following the manufacturer's instructions.
[0216] Each sample was treated with 2SDS PAGE buffer and heated to 95 C. for 5 min Equal amounts of protein (for lysate and cell medium supernatant, respectively) were loaded on SDS-PAGE 10% and electrophoresed at 120 V for 1.5-2 hours. The proteins were transferred by wet blotting onto a nitrocellulose membrane at 100 mA for one hour. The membranes were washed three times with PBS-T (PBS containing 0.2% (v/v) Tween-20) and incubated with 5% skim milk (w/v in PBS-T). The membranes were washed three times with PBS-T, incubated with primary antibodies goat-anti-AAT (Bethyl # A80-122A, dilution 1:200) or rabbit anti-actin (Abcam ab8227, dilution 1:1000) overnight. The membranes were washed three times with PBS-T and incubated with secondary antibodies rabbit-anti-goat (Daco # P0160, dilution 1:2000) and donkey-anti-rabbit (GE # NA934V, dilution 1:2000), respectively, for one hour. The membranes were washed three times with PBS-T and prepared for chemolumiscence using Immobilon Western Chemiluminescent HRP Substrate (Millipore # WKBLS0500). HRP activity was measured by chemiluminescent detection.
[0217] Results
[0218] Lentiviral transfer plasmids pSFFV.dTom.sAAT, pLVTHM.shRNA1/2/3, pLVTHM.shRNA13 and pLVTHM.shRNA1x3.sAAT2 were generated by molecular cloning. Insertion of the shRNA oligonucleotides and transgenic synthetic alpha-l-antitrysin was confirmed by restriction analysis and sequencing. Lentivirus were produced by HEK293T cells using the calcium transfection method. Lentivirus titers for the SFFV-driven lentivirus ranged from 1.05*10.sup.6 to 6.75*10.sup.6 infectious particles/ml. Titers for the pLVTHM-based lentiviruses ranged from 1.5*10.sup.6 to 3.44 10.sup.7 infectious particles/ml. Lentiviral titers for LVTHM-based lentiviruses containing multicistronic expression of shRNAs and sAAT2 were determined to 2.09*10.sup.6infectious particles/ml for LV-shRNA13 and 7.16*10.sup.5 infectious particles/ml for LV-shRNA 1x3.sAAT2.
[0219] For overexpression and RNAi knock-down experiments, HepG2 cells were transduced with a specified multiplicity of infection. RNA from transduced cells was isolated and gene expression was determined by the means of qPCR.
[0220] Knock-Down of Native AAT by Single shRNA Expression
[0221] HepG2 cells were transduced with LV-shRNA1/2/3, LV-shRNA ctrl 1/2 and LV-scramble with a MOI of 1. Expression of native AAT (M-AAT, Z-AAT and other native AAT isoforms) was determined after six days by the means of qPCR (
[0222] In a second attempt, HepG2 cells were treated with LV-shRNA1/2/3, LV-shRNA ctrl 1/2 and LV-scramble with a MOI of 0.5. Transduced eGFP positive cells underwent FACS processing to acquire pure cell cultures. Sorted cell cultures were cultured for three weeks until determination of MAAT expression by the means of qPCR (
[0223] Overexpression of Synthetic AAT
[0224] HepG2 cells were transduced with LV-sAAT or LV-shRNA1x3.sAAT2 with a MOI of 1. Expression of AAT/sAAT in the cell lysate and of secreted AAT/sAAT accumulated in the cell culture medium was determined by the means of Western blot. Proteins in the supernatant cell medium was precipitated by trichloroacetic acid precipitation and protein concentrations were determined using Pierce protein assay. In cell lysates, expression of AAT/sAAT is slightly elevated in treated cells compared to control cells. Levels of secreted AAT/sAAT is highly elevated in the cell medium of treated cells compared to untreated cells indicating a highly efficient production and secretion of synthetic sAAT from treated HepG2 cells (
[0225] In addition, expression of synthetic AAT (sAAT or sAAT2) was determined by the means of qPCR. For this reason, primers specifically detecting the synthetic variants used in this application were designed based on the distinct point mutations integrated in sAAT and sAAT2. HepG2 cells were transduced with LV-sAAT or LV-shRNA1x3.sAAT2 and RNA was isolated after six days. qPCR was performed to detect expression of sAAT and sAAT2 and expression levels were expressed as absolute quantities (copy number of sAAT/sAAT2).
[0226] The results demonstrate that synthetic AAT (sAAT/sAAT2) are strongly expressed compared to non-treated control samples. HepG2 cells transduced with LV-sAAT contain 3191 (+/689.6) copies of sAAT in the analysed sample while HepG2 cells transduced with LV-shRNA1.sAAT2 contain 2687 (+/500) copies of sAAT2 (
[0227] Knock-Down of Native AAT by Expression of Multiple shRNAs
[0228] Knock-down of native AAT by multicistronic shRNA expression was achieved by transduction of HepG2 cells with LV-shRNA13 or LV-shRNA1x3.sAAT2. RNA was isolated six days after transduction and AAT expression was analysed by M-AAT specific primers. The results demonstrate that native AAT is knocked-down significantly by LV-shRNA13 and LV-shRNA1x3.sAAT2 (p.sub.LV-shRNA1x3 1 MOI=0.0057; p.sub.LV-shRNA1x3 2 MOI=0.0263; p.sub.LV-shRNA1x3.sAAT2=0.0446). Native AAT is knock-downed by 55% (11%) in cells treated with LV-shRNA1 at a MOI of 1, by 51% (5%) at a MOI of 2 and 44% (12%) in cells treated with LV-shRNA1x3.sAAT2 (
[0229] The primers specifically amplify native AAT as expression levels of M-AAT remain within range in HepG2 cells transduced with LV-shRNA1x3.sAAT2 despite strong expression of sAAT2 (
REFERENCES
[0230] Barnett V T, Sekosan M, Khurshid A. Wegener's granulomatosis and alphal-antitrypsin-deficiency emphysema: proteinase-related diseases. Chest. 1999 July; 116(1):253-5. [0231] Brummelkamp T R, Bernards R, Agami R. A system for stable expression of short interfering RNAs in mammalian cells. Science. 2002 Apr. 19; 296(5567):550-3 [0232] Cox D W. Alpha-1-Antitrypsin: a guardian of vascular tissue. Mayo Clinic Proc. 1994; 69:1123-4 [0233] Cox D W, Smyth S. Risk for liver disease in adults with alpha 1-antitrypsin deficiency. Am J Med. 1983 February; 74(2):221-7. [0234] Dull T, Zufferey R, Kelly M, Mandel R J, Nguyen M, Trono D, Naldini L. A third-generation lentivirus vector with a conditional packaging system. J Virol. 1998 November; 72(11):8463-71. [0235] Fearnley I R, Spalton D J, Ward A M, Slavin B, Muncey F. Alpha 1-antitrypsin phenotypes in acute anterior uveitis. Br J Ophthalmol. 1988 August; 72(8):636-9. [0236] Mazodier P, Elzouki A N, Segelmark M, Eriksson S. Systemic necrotizing vasculitides in severe alphal-antitrypsin deficiency. QJM. 1996 August; 89(8):599-611. [0237] McBean J, Sable A, Maude J, Robinson-Bostom L. Alphal-antitrypsin deficiency panniculitis. Cutis. 2003 March; 71(3):205-9. [0238] Baum, C., Kustikova, O., Modlich, U., Li, Z. & Fehse, B. Mutagenesis and oncogenesis by chromosomal insertion of gene transfer vectors. Hum. Gene Ther. 17, 253-263 (2006). [0239] Bessis, N., GarciaCozar, F. J. & Boissier, M. C. Immune responses to gene therapy vectors: influence on vector function and effector mechanisms. Gene Ther. 11 (Suppl. 1), S10-S17 (2004). [0240] Burrows J A, Willis L K, Perlmutter D H. Chemical Chaperones mediate increased secretion of mutant alpha-1-antitrypsin (alpha-1-AT) Z: A potential pharmacological strategy for prevention of liver injury and emphysema in alpha 1-AT deficiency. Proc Natl Acad Sci USA. 2000; 97:1796-1801 [0241] Carrell R W, Lomas D A, Sidhar S, Foreman R Al-Antitrypsin Deficiency. Chest 1996, 110; 6,243S-247S. [0242] Cruz P E, Mueller C, Cossette T L, Golant A, Tang Q, Beattie S G, Brantly M, Campbell-Thompson M, Blomenkamp K S, Teckman J H, Flotte T R. In vivo post-transcriptional gene silencing of alpha-1 antitrypsin by adeno-associated virus vectors expressing siRNA. Lab Invest. 2007 September; 87(9):893-902. [0243] Eriksson S. Studies in alpha 1-antitrypsin deficiency. Acta Med Scand Suppl. 1965; 432:1-85. [0244] Hidvegi T, Ewing M, Hale P, Dippold C, Beckett C, Kemp C, Maurice N, Mukherjee A, Goldbach C, Watkins S, Michalopoulos G, Perlmutter D H. An autophagy-enhancing drug promotes degradation of mutant alphal-antitrypsin Z and reduces hepatic fibrosis. Science. 2010; 329(5988):229-32. [0245] Hidvegi T, Schmidt B Z, Hale P, Perlmutter D H. Accumulation of mutant alphal-antitrypsin Z in the endoplasmic reticulum activates caspases-4 and -12, NFkappaB, and BAP31 but not the unfolded protein response. J Biol Chem. 2005 Nov. 25; 280(47):39002-15. [0246] Hubbard R C, Crystal R G. Strategies for aerosol therapy of alpha-1-antitrypsin deficiency by the aerosol route. Lung 1990; 168 Suppl:567-578. [0247] Karnaukhova E, Ophir Y, Golding B. Recombinant human alpha-1 proteinase inhibitor: towards therapeutic use. Amino Acids. 2006; 30(4):317-32. [0248] Kramps J A, Bakker W, Dijkman J H: A matched-pair study of the leukocyte elastase-like activity in normal persons and in emphysematous patients with and without alphal-antitrypsin deficiency. Am Rev Respir Dis 1980, 121:253-261. [0249] Lawless M W, Greene C M, Mulgrew A, Taggart C C, O'Neill S J, McElvaney N G. Activation of endoplasmic reticulum-specific stress responses associated with the conformational disease Z alpha 1-antitrypsin deficiency. J Immunol. 2004 May 1; 172(9):5722-6. [0250] Li Cl, Xiao P, Gray S J, Weinberg M S, Samulski R J. Combination therapy utilizing shRNA knockdown and an optimized resistant transgene for rescue of diseases caused by misfolded proteins. Proc Natl Acad Sci USA. 2011 Aug. 23; 108(34):14258-63 [0251] Livak K J, Schmittgen T D. Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta Delta C(T)) Method. Methods. 2001 December; 25(4):402-8. [0252] Mahadeva R, Dafforn T R, Carrell R W, Lomas D A. 6-mer peptide selectively anneals to a pathogenic serpin conformation and blocks polymerization. Implications for the prevention of Z alpha(1)-antitrypsin-related cirrhosis. J Biol Chem. 2002 Mar. 1; 277(9):6771-4. Epub 2001 Dec. 28. [0253] Pack D W, Hoffman A S, Pun S, Stayton P S. Design and development of polymers for gene delivery. Nat Rev Drug Discov. 2005 July; 4(7):581-93. [0254] Parfrey H, Dafforn T R, Belorgey D, Lomas D A, Mahadeva R. Inhibiting polymerization: new therapeutic strategies for Z alphal-antitrypsin-related emphysema. Am J Respir Cell Mol Biol. 2004 August; 31(2):133-9. Epub 2004 Mar. 11. [0255] Petrache I, Hajjar J, Campos M. Safety and efficiency of alpha-l-antitryspin augmentation therapy in the treatmedn of patients with alpha-l-antitryspin deficiency. Biologics 2009; 3:193-204. [0256] Putnam, D. Polymers for gene delivery across length scales. Nature Mater 2006. 5, 439-451. Ramarmooth M, Narvekar A, Non Viral Vectors in Gene TherapyAn Overview. Journal of Clinical and Diagnostic Research. 2015 January, Vol-9(1): GE01-GE06 [0257] Riedel G, Rdrich U, Fekete-Drimusz N, Manns M P, Vondran F W, Bock M. An extended ACT-method facilitating normalisation with multiple reference genes suited for quantitative RT-PCR analyses of human hepatocyte-like cells. PLoS One. 2014 Mar. 21; 9(3): [0258] Sandhaus R A. Alpha-1-Antitrypsin deficiency. 6: new and emerging treatments for alphal-antitrypsin deficiency. Thorax. 2004 October; 59(10): 904-909. [0259] Serres F, Blacno I. Role of alpha-1 antitrypsin in human health and disease. Journal of Internal Medicine, 2014, 276; 311-335 [0260] Spencer L T, Humphries J E, Brantly M L. Antibody response to aerosolized transgenic human alphal-antitrypsin. N Engl J Med. 2005; 352(19):2030-1. [0261] Stove V, Smits K, Naessens E, Plum J, Verhasselt B. Multiple gene knock-down by a single lentiviral vector expressing an array of short hairpin RNAs. Electronic Journal of Biotechnology 2006, 9(5): 572-579 [0262] Sveger T, Eriksson S. The liver in adolescents with alpha-1-antitrypsin deficiency. Hepatology 1995, 22:514-517 [0263] Ter Brake O, Hooft K, Liu Y, Centlivre M, von Eige K, Berkhout B, Lentiviral Vector Design for Multiple shRNA Expression and Durable HIV-1 Inhibition, Mol Ther 16(3):557-564 [0264] Teckman J H, Perlmutter D H. Retention of mutant alpha(1)-antitrypsin Z in endoplasmic reticulum is associated with an autophagic response. Am J Physiol Gastrointest Liver Physiol. 2000 November; 279(5):G961-74. [0265] Vannucci L, Lai M, Chiuppesi F, Ceccherini-Nelli L, Pistello M. Viral vectors: a look back and ahead on gene transfer technology. New Microbiol. 2013 January; 36(1):1-22. [0266] Wiznerowicz M, Trono D Conditional suppression of cellular genes: lentivirus vector-mediated drug-inducible RNA interference. J Virol. 2003 August 77(16):8957-61 [0267] Yin H, Kanasty R, Eltouky A, Vegas A, Darkin J R, Anderson D. Non-Viral vectors for gene based therapy Nature Rev. Genet. 2014, 15, 541-555.