Method for Diagnosing Autoimmune Gastritis
20200191785 ยท 2020-06-18
Assignee
Inventors
- Cornelia Daehnrich (Gross Groenau, DE)
- Christian PROBST (Ratzeburg, DE)
- Lars Komorowski (Ratzeburg, DE)
Cpc classification
International classification
Abstract
A method is useful for diagnosing AIG, which includes the step of detecting whether autoantibodies against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase are present or not in a sample comprising antibodies. The method utilizes a diagnostically useful carrier that contains a solid phase on which an agent for the specific capture of the autoantibody is immobilized. Furthermore, the diagnostically useful carrier includes a solid phase on which an agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is immobilized.
Claims
1. A method for diagnosing autoimmune gastritis, comprising: detecting whether an autoantibody against a beta-subunit of gastric H.sup.+/K.sup.+-ATPase is present or not in a sample comprising antibodies, wherein the detecting is with use of a diagnostically useful carrier comprising a solid phase on which an agent for specific capture of the autoantibody is immobilized.
2. The method according to claim 1, wherein the carrier is at least one selected from the group consisting of a microtitre plate, a bead, a blot, an immunofluorescence assay carrier comprising fixed cells, a lateral flow device, a cellulose-based polymer, a biochip, a microarray, and a chromatography column material.
3. The method according to claim 2, wherein the diagnostically useful carrier is an ELISA microtitre plate.
4. The method according to claim 1, wherein the sample is at least one selected from the group consisting of serum, whole blood, plasma and cerebrospinal fluid.
5. The method according to claim 1, further comprising detecting whether an autoantibody against intrinsic factor is present or not in the sample.
6. The method according to claim 1, wherein the autoantibody is a class IgG antibody.
7. A diagnostically useful carrier, comprising: a solid phase on which an agent for specific capture of an autoantibody against a beta-subunit of gastric H.sup.+/K.sup.+-ATPase is immobilized.
8. The diagnostically useful carrier according to claim 7, which is at least one member selected from the group consisting of a microtitre plate, a bead, a blot, an immunofluorescence assay carrier comprising fixed cells, a lateral flow device, a cellulose-based polymer, a biochip, a microarray and a chromatography column material.
9. The diagnostically useful carrier according to claim 8, which is an ELISA microtitre plate.
10. A monoclonal antibody or isolated autoantibody which binds specifically against a beta-subunit of gastric H.sup.+/K.sup.+-ATPase.
11. A method for calibration or for quality-control of a medical device, said method comprising: contacting the carrier according to claim 7 with a liquid comprising a monoclonal antibody or isolated autoantibody which binds specifically against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase in a predetermined concentration, and detecting whether the antibody is present or not in the liquid.
12. A kit, comprising: the diagnostically useful carrier according to claim 7, and at least one reagent selected from the group consisting of a wash solution, a calibrator solution, an antibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, and an agent for the detection of the autoantibody.
13. The kit according to claim 12, wherein the autoantibody is a secondary antibody having a detectable label.
14. A method of specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, the method comprising: contacting the autoantibody with an agent for the specific capture, the carrier according to claim 7, a monoclonal antibody or isolated autoantibody which binds specifically against the beta-subunit of gastric H.sup.+/K.sup.+-ATPase, or a polypeptide comprising the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, a variant thereof, or a nucleic acid coding therefor.
15. A method of producing a kit for diagnosing autoimmune gastritis, the method comprising: combining an agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, a carrier comprising the agent, or the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, a variant thereof, or a nucleic acid coding therefor, with at least one reagent.
16. The method according to claim 2, wherein the carrier is at least one blot selected from the group consisting of western blot, line blot and dot blot, or the immunofluorescence assay carrier comprising fixed cells for a microscopic analysis.
17. The diagnostically useful carrier according to claim 8, wherein the carrier is at least one blot selected from the group consisting of western blot, line blot and dot blot, or the immunofluorescence assay carrier comprising fixed cells for a microscopic analysis.
18. The kit according to claim 12, wherein the kit comprises all the reagents from the group, and wherein the autoantibody is a secondary antibody, a secondary antibody against IgG antibodies, or the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase or a variant thereof, and wherein said autoantibody has a detectable label.
19. The kit according to claim 13, wherein the secondary antibody has at least one detectable label selected from the group consisting of a label capable of chemiluminescence, a label which is radioactive or comprises a detectable isotope, an enzymatically active label, a label capable of fluorescence, a compound detectable by NMR spectroscopy, and a spin label.
20. The method according to claim 15, wherein the kit is prepared with an extracellular domain of the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, a variant thereof, or a nucleic acid coding therefor.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0038]
[0039]
DETAILED DESCRIPTION OF THE INVENTION
[0040] In a first aspect, the object underlying the invention is achieved by a method for diagnosing AIG, optionally and/or PA, comprising the step of detecting whether an autoantibody or autoantibodies against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is or are present or not in a sample comprising antibodies, with use of a diagnostically useful carrier comprising a solid phase on which an agent for the specific capture of the autoantibody is immobilized.
[0041] In a preferred embodiment, the carrier is selected from the group comprising a microtitre plate, a bead, a blot, preferably western blot, line blot or dot blot, an immunofluorescence assay carrier comprising fixed cells, preferably for a microscopic analysis, a lateral flow device, a cellulose-based polymer, a biochip, a microarray and a chromatography column material.
[0042] In a preferred embodiment, the diagnostically useful carrier is an ELISA microtitre plate.
[0043] In a preferred embodiment, the sample is selected from the group comprising serum, whole blood, plasma and CSF.
[0044] In a preferred embodiment, the method further comprises detecting whether an autoantibody or autoantibodies against intrinsic factor is or are present or not in a sample.
[0045] In a preferred embodiment, the autoantibody is a class IgG antibody.
[0046] In a second aspect, the object underlying the invention is achieved by a diagnostically useful carrier comprising a solid phase on which an agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is immobilized.
[0047] In a third aspect, the object underlying the invention is achieved by a monoclonal antibody or isolated autoantibody which binds specifically against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, particularly preferably in purified form, but preferably not against the alpha-subunit.
[0048] In a fourth aspect, the object underlying the invention is achieved by a method for the calibration or for the quality-control of a medical device, comprising the step of contacting the inventive carrier with a liquid comprising the inventive antibody, preferably in known concentration, followed by the step of detecting whether the antibody is present or not in the liquid, particularly preferably with at least semi-quantitative determination of the antibody in the liquid.
[0049] In a fifth aspect, the object underlying the invention is achieved by a kit comprising the inventive diagnostically useful carrier, the kit comprising one reagent or more than one reagent, preferably all the reagents, from the group comprising a wash solution, a calibrator solution, an antibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, and an agent for the detection of the autoantibody, preferably a secondary antibody, even more preferably a secondary antibody against IgG antibodies.
[0050] In a preferred embodiment, the secondary antibody has a detectable label. The detectable label is preferably selected from the group comprising a label which is capable of chemiluminescence, is radioactive or comprises a detectable isotope, an enzymatically active label, a label capable of fluorescence, a compound detectable by NMR spectroscopy and a spin label, preferably a label capable of chemiluminescence, most preferably a label capable of chemiluminescence that generates a chemiluminescent signal upon incubation in a suitable chemiluminescence trigger solution.
[0051] In a sixth aspect, the object underlying the invention is achieved by use of an agent for the detection of whether an autoantibody or autoantibodies against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is or are present or not in a sample or of the inventive carrier or of the inventive antibody for the highly specific diagnosis of AIG and/or PA.
[0052] In a seventh aspect, the object underlying the invention is achieved by the use of an agent for the detection of whether an autoantibody or autoantibodies against the beta-subunit of the gastric H/K-ATPase is or are present or not in a sample or of a carrier comprising the agent for the production of a kit or a composition for the highly specific diagnosis of AIG and/or PA.
[0053] In an eighth aspect, the object underlying the invention is achieved by the use of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase for the diagnosis, preferably the highly specific diagnosis, of AIG. Particularly preferably, the autoantibody of the beta-subunit serves in this connection as sole biomarker, preferably as sole autoimmune biomarker in a test run, even more preferably as sole autoimmune biomarker derived from the gastric H.sup.+/K.sup.+-ATPase. This can mean that no other autoantibody is detected in parallel in the same sample, particularly no other autoantibody against the gastric H.sup.+/K.sup.+-ATPase, particularly the alpha-subunit.
[0054] The present invention is based on the surprising finding by the inventors that the detection of autoantibodies with optimized diagnostic reliability, especially specificity and sensitivity, can contribute to the diagnosis of AIG when what is detected is whether an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, and not for instance against the alpha-subunit or the heterodimer, is present. This also holds true when a diagnostically useful carrier comprising a solid phase is used, i.e. assay formats which are described as diagnostically unreliable in the related art.
[0055] The present invention is further based on the surprising finding by the inventors that the detection of autoantibodies against the extracellular domain of the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase allows a particularly specific diagnosis. As a result, the number of false-positive diagnoses or findings can be reduced at a high level.
[0056] In a preferred embodiment, the assay is carried out using a diagnostically useful carrier comprising a solid phase on which an agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is immobilized. In a more preferred embodiment, the agent is a polypeptide comprising the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase or a variant thereof. However, molecules derived therefrom or imitating the backbone of the beta-subunit, such as peptidomimetics, peptoids, beta-peptides and peptides comprising unnatural amino acids, are also usable. A person skilled in the art is familiar with such molecules and their design (Pelay Gimeno, M., Glas, A., Koch, O., Grossmann, T. N. (2015) Structure-based design of inhibitors of protein-protein interactions: Mimicking peptide binding epitopes. Angewandte Chemie International Edition. 54(31): 8896-8927). It is equally possible for the beta-subunit to be detected indirectly by, firstly, detecting whether an autoantibody or autoantibodies against the heterodimer comprising alpha-subunit and beta-subunit is or are present or not and, secondly, detecting whether an autoantibody or autoantibodies against the alpha-subunit is or are present or not.
[0057] In a preferred embodiment, the term immobilized, as used herein, means that the agent for the detection of whether an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is present or not is bound to the solid phase of the carrier, preferably via a covalent bond, electrostatic interaction or via a hydrophobic interaction, the agent remaining exposed to the environment such that it is accessible for autoantibodies in a liquid sample. Various suitable carriers, for example paper, polystyrene, metal, silicone or glass surfaces, microfluidic channels, membranes, beads such as magnetic beads, chromatography column media, biochips, polyacrylamide gels and the like, are described in the literature, for example in Kim, D. and Herr, A. E. (2013), Protein immobilization techniques for microfluidic assays, Biomicrofluidics 7(4), 041501. In this way, the immobilized agent together with the insoluble carrier can be easily separated from an aqueous solution, for example by filtration, centrifugation or decanting. An immobilized agent can be reversibly or irreversibly immobilized. For example, the immobilization is reversible when the agent interacts with the carrier via an ionic interaction, which can be masked by addition of a high concentration of a salt, or when the agent is bound via a cleavable covalent bond such as a disulfide bridge, which can be cleaved by addition of thiol-comprising reagents. In contrast, the immobilization is irreversible when the agent is attached to the carrier via a covalent bond which cannot be cleaved in aqueous solution, for example a bond which is formed by reaction of an epoxy group and an amino group, as is frequently used for binding lysine side chains to affinity columns. The agent, preferably a polypeptide, can be immobilized indirectly, for example by immobilization of an antibody or some other entity having affinity for the agent, followed by the formation of a complex with the effect that the agent-antibody complex is immobilized. Said agent can also be immobilized directly, i.e. for coating the carrier in direct contact. Various options for immobilization are described in the literature, for example in Kim. D. and Herr, A. E. (2013), Protein immobilization techniques for microfluidic assays, Biomicrofluidics 7(4), 041501.
[0058] The beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is preferably the amino acid sequence represented with the UniProtKB sequence entry P51164 or in SEQ ID NO7, more preferably the amino acid sequence represented by SEQ ID NO3, the latter representing the extracellular domain which does not comprise the transmembrane domain, even more preferably the fragment represented in SEQ ID NO5. According to the invention, variants thereof can be used. In this application, all the cited database codes stand for the Uniprot database or other databases, more precisely for the version thereof on the filing date of said application or its earliest priority application. It is particularly preferred that SEQ ID NO3 or a variant thereof is used in the absence of at least one epitope from the transmembrane domain of the beta-subunit having the sequence SEQ ID NO4 and/or at least any epitope of the alpha-subunit, which epitope is reactive towards an autoantibody from the serum of an AIG patient, preferably any epitope of the alpha-subunit.
[0059] The alpha-subunit of the gastric H.sup.+/K.sup.+-ATPase is preferably the amino acid sequence represented by UniProtKB access number P20648 or in SEQ ID NO9.
[0060] Intrinsic factor is preferably the amino acid sequence represented by the NCBI GenBank entry NP_005133.2 or in SEQ ID NO10.
[0061] In a preferred embodiment, detecting whether an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is present or not in a sample is understood to mean that what is detected is whether the sample contains an autoantibody which is directed against the beta-subunit, but not against the alpha-subunit of the same protein. Preferably, an antibody which is directed only against the complex comprising alpha-subunit and beta-subunit is also not detected. In this connection, particular preference is given to generating a first signal indicating that the autoantibody against the beta-subunit has bound and can be distinguished from a signal which arises from a different autoantibody binding to a different autoantigen such as the alpha-subunit or to an autoantigen consisting of amino acids of the alpha- and the beta-subunits. Thus, what can be distinguished is whether an antibody specific for the beta-subunit is binding to the beta-subunit, or whether a different event has taken place, particularly the binding of an autoantibody which binds against the alpha-subunit or the complex composed of alpha-subunit and beta-subunit, but not the beta-subunit alone. In a preferred embodiment, the invention uses, instead of an agent for specific capture, an agent for the specific detection of whether an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is present or not in a sample, preference being given to an agent allowing the detection of whether an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is present or not in a sample. The agent for detection or the agent for specific capture can be a polypeptide or a reagent or a composition for detection or specific capture.
[0062] The detection of the autoantibody can be qualitative or quantitative. In a preferred embodiment, the term qualitative is understood to mean that what is merely detected is whether the antibody is present or not, but not in what concentration. In particular, there is no establishment of whether the concentration of the antibody exceeds a certain value, which yields further information about the disease in question, for example about the severity of the disease, about the development, about the success of therapy or about certain symptoms. In a preferred embodiment, the term quantitative is understood to mean that information going beyond that about being able to detect the antibody is provided. In particular, it is possible to determine an absolute or relative value, or at least an assignment to one of multiple defined concentration ranges.
[0063] This can be achieved by the beta-subunit or a variant thereof being used spatially separated from other antigens, preferably autoantigens or epitopes of such autoantigens, which epitopes are reactive towards autoantibodies from samples from AIG patients, especially the alpha-subunit or variants thereof. Alternatively, it is possible to detect whether an autoantibody which binds against the complex comprising alpha-subunit and beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is present in the sample, and additionally whether an antibody which binds specifically against the alpha-subunit is not present in the sample. If this is namely the case, it can be concluded that an autoantibody which binds specifically against the beta-subunit is present, even though neither the beta-subunit nor a variant thereof is used for the assay. Lastly, there is also the option of immobilizing all the antibodies of the searched class, preferably IgG, that are present in the sample, followed by contacting with the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, which either is itself labelled or can be detected via a labelled ligand, preferably a labelled antibody.
[0064] For the assessment of whether a patient has an increased risk of suffering from or contracting AIG and/or PA, preference is given to using solely the presence or absence of autoantibodies against the beta-subunit to indicate whether this is the case. By contrast, no attention is paid to the detection of autoantibodies against the alpha-subunit, because it does not indicate such an increased risk.
[0065] In a preferred embodiment, the agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is understood to mean an agent which can capture an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, but can capture other antibodies, preferably autoantibodies, particularly against the alpha-subunit, less efficiently, most preferably not at all or to a non-detectable extent, with the result that they remain uncaptured in the sample in a detection method according to the invention when contacting the agent or agent-comprising carrier with the sample. Preferably, the agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase binds specifically to an autoantibody against the beta-subunit from a sample from an AIG patient. In a preferred embodiment, among all autoantibodies again the H.sup.+/K.sup.+-ATPase only those binding against the beta subunit, preferably in particular not those binding against the alpha subunit, are used or used as Marker for diagnosing AIG. This autoantibody or these autoantibodies serve as the only autoantibody marker for the diagnosis in line with the present invention. Preferably, epitopes from or derived from the alpha subunit, to which autoantibodies against the alpha subunit, but not autoantibodies against the beta subunit bind, are absent.
[0066] In a particularly preferred embodiment, the term bind specifically, as used herein, in the case of an antibody means that said antibody binds against the relevant antigen in a binding reaction characterized by a dissociation constant which is 110.sup.5 M, more preferably 110.sup.7 M, more preferably 110.sup.8 M, more preferably 110.sup.5 M, more preferably 110.sup.10 M, more preferably 110.sup.11 M, more preferably 110.sup.12 M or a stronger binding reaction. Preferably, the dissociation constant is, in this connection, measured by surface plasmon resonance using a Biacore instrument at 25 C. and in PBS buffer at pH 7 and calculated using the software provided by the manufacturer.
[0067] In a preferred embodiment, the term diagnosis, as used herein, is understood to mean a procedure which yields information which supports the assessment, or allows it in the first place, of whether a subject is suffering from a disease or has a higher probability of suffering from a disease than an average person or suffered in the past or will suffer in the future, or whether a disease is progressing or how it will develop in the future, or for assessing whether a certain treatment is taking effect. Preferably prior to the diagnosis it is unknown whether or not the subject to be diagnosed suffers from the disease.
[0068] Preferably, for the diagnosis or to support the diagnosis, it is sufficient to merely detect whether the antibody is present, it being possible to determine whether detectable concentrations of the antibody are present in the sample. In a preferred embodiment, what is determined is whether the relative concentration of the antibody is higher in a patient to be diagnosed than in an average healthy person. What can be determined is whether the concentration is higher by a factor of 1.1, more preferably 1.2, 1.5, 1, 2, 5, 10, 20, 25, 50, 100, 200, 500, 1000, 10 000 or 100 000, than in a sample from an average healthy person. The higher concentration supports the diagnosis that a patient from whom the sample originates is suffering from AIG or indicates that the patient has an increased probability of suffering from AIG.
[0069] The method according to the invention or the use according to the invention is preferably effected in vitro.
[0070] A person skilled in the art understands that such a diagnosis generally does not by itself allow a comprehensive diagnosis, but that further aspects must be taken into consideration, for example further parameters to be determined in a sample, medical history, clinical symptoms, anamnesis or the results of imaging methods. Said person further understands that the value of the method according to the invention can consist in it being possible to carry out an indirect diagnosis or differential diagnosis in which the exclusion of a disease indicates that the patient is suffering from a different disease with similar symptoms. In a preferred embodiment, products according to the invention, such as carriers or kits, or methods according to the invention serve for the differentiation between a gastritis caused by autoimmunity and a gastritis caused by bacteria or by medicaments or for the diagnosis of a disease from the group comprising AIG, pernicious anaemia, atrophic body gastritis or vitamin B12 deficiency.
[0071] In the event of antibodies being detected, the sample to be investigated is a sample comprising a representative set of antibodies from the patient, who is preferably a mammal, even more preferably a human. Preferably, said sample is selected from the group comprising serum, plasma, serum and CSF.
[0072] It is possible to carry out the teaching according to the invention not only by using the wild-type sequences of the specified polypeptides or the reference sequences, as specified here in the form of SEQ ID NOs, collectively referred to henceforth as full-length polypeptide, or database codes or in some other way, possibly implicitly, but also by using variants of said sequences.
[0073] In a particularly preferred embodiment, the term variant, as used herein, means, in this connection, at least one fragment of the full-length polypeptide which is truncated at the C-terminal and/or N-terminal end by one or more than one amino acid compared to the full-length polypeptide. Such a fragment can contain a length of 5, 6, 7, 8, 10, 12, 15, 20, 25, 50, 75, 100, 150 or 200 successive amino acids from the sequence of the full-length polypeptide, preferably 10 or more.
[0074] In a further preferred embodiment, the term variant, as used herein, encompasses not only a fragment, but also a polypeptide having amino acid sequences with, in the order of increasing preference, at least 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity in relation to the full-length polypeptide or in relation to the fragment thereof, with no deletion or non-conservative substitution of an amino acid essential for biological activity, i.e. the ability of an antigen to bind to an antibody specific for the full-length polypeptide antigen. The related art discloses methods for establishing the sequence identity of amino acid sequences, for example in Arthur Lesk (2008). Introduction to bioinformatics, Oxford University Press, 2008, third edition. In a preferred embodiment, the ClustalW software (Larkin, M. A., Blackshields, G., Brown, N. P., Chenna, R., McGettigan, P. A., McWilliam, H., Valentin, F., Wallace, I. M., Wilm, A., Lopez, R., Thompson, J. D., Gibson, T. J., Higgins, D. G. (2007). Clustal W and Clustal X version 2.0. Bioinformatics, 23, 2947-2948) is used to this end with use of the standard settings.
[0075] In addition, a polypeptide used according to the invention or a variant thereof can have chemical modifications, for example isotope label, covalent modifications such as glycosylation, phosphorylation, acetylation, decarboxylation, citrullination, methylation, hydroxylation, etc. In a particularly preferred embodiment, a polypeptide which is used for the detection of an autoantibody against the beta-subunit or used some other way according to the invention and which comprises the beta-subunit or a variant thereof is glycosylated. The glycosylation is preferably accomplished by expression in a cell capable of glycosylation, preferably a mammalian or insect cell, more preferably a mammalian cell.
[0076] Variants can also be fusion proteins with amino acids or other known polypeptides or variants thereof, preferably with a purification tag, even more preferably from the group comprising His tag, thioredoxin, maltose-binding protein, streptavidin, glutathione S-transferase or a variant thereof, and be or comprise active parts or domains, preferably with a sequence identity of at least 70%, 75%, 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98% or 99% in relation to the full-length polypeptide. In a preferred embodiment, the term active parts or domains is understood to mean a fragment of the full-length polypeptide or a variant which, in both cases, retains at least some of the biological activity of the full-length polypeptide.
[0077] It is essential that the variant of the full-length polypeptide has biological activity. In a preferred embodiment, biological activity is the capability of an agent, preferably polypeptide, to capture an autoantibody against the beta-subunit or to bind thereto, preferably bind specifically, which autoantibody occurs in samples from patients who have contracted AIG. The autoantibody from such samples can be obtained as reference for tests. Variants of a secondary antibody serving for the detection of a specifically captured antibody are all molecules which have the same binding specificity as the secondary antibody, preferably the capability of binding against all antibodies of human class IgG. For example, they encompass fragments and derivatives of the secondary antibody.
[0078] When producing variants or assessing whether they may exhibit biological activity, a person skilled in the art can orientate himself-herself to the work by da Silva el al. (da Silva, H. D., Gleeson, P. A., Toh, B. H., Van Driel, I. R. and Carbone, F. R. (1999) Identification of a gastritogenic epitope of the H/K ATPase beta-subunit, Immunology 1999, 96, 145-151). They identified SEQ ID NO6 as the peptide comprising the immunodominant epitope. This means that the homologous sequence from the human protein represented in SEQ ID NO5 contains the human epitope. By means of sequence alignments with further mammalian homologues, for example from pig, cattle, primates, goat and others, a person skilled in the art can easily predict reactive variants. By means of mutations and further truncations, a person skilled in the art can generate further variants. Carried out by means of ELISA, as in the examples, said person can confirm that biological activity is preserved.
[0079] At the same time, a polypeptide or a variant thereof does not bind, or only binds to a slight extent, against antibodies against the alpha-subunit, preferably the immunodominant epitope thereof, as described in SEQ ID NO8. Homologous epitopes from further homologous mammalian enzymes can be gathered from Nishio et al. and taken into consideration for the design of variants by a person skilled in the art (Nishio, A., Hosono, M., Watanabe, Y., Sakai, M., Okuma, M. and Masuda, T. (1994) Gastroenterology 107, 1408-1414). Preferably, the binding constant of autoantibodies against the beta-subunit, as occur in a sample from a patient, is at least 10, preferably 100, more preferably 1000, more preferably 10 000, more preferably 100 000, even more preferably 1 000 000, even more preferably 10 000 000, times lowerand the strength of the binding reaction accordingly higherthan the binding constant of autoantibodies against the alpha-subunit, as occur in a sample from a patient. The binding constant characterizes, then, the strength of binding of the particular autoantibody against the variant, more precisely a mixture of autoantibodies, as occur in a sample. The binding constant is, in this connection, preferably measured by means of Biacore in PBS buffer at 25 C. For example, the binding constant can be 10.sup.10 M in the case of the binding of autoantibodies against the beta-subunit from a sample, whereas the binding constant of the same autoantibodies against the alpha-subunit from the sample is 10.sup.6 M. The first binding constant is thus 10 000 times lower than the second one. This means that autoantibodies against the beta-subunit bind distinctly more strongly to the polypeptide or the variant than autoantibodies against the alpha-subunit. If the polypeptide or the variant is used according to the invention, only autoantibodies against the beta-subunit are thus bound and detected, but not antibodies against the alpha-subunit.
[0080] In a preferred embodiment, the term autoantibody, as used herein, is understood to mean an antibody which binds specifically to a structure, preferably an autoantigen, from the organism which produces said antibody. Such an autoantibody has a constant region, as is had by other antibodies of the same class from the same organism. Particularly preferably, the autoantibody is a mammalian autoantibody, even more preferably a human autoantibody, even more preferably a human autoantibody of class IgG. The variable domain is capable of binding specifically against the autoantigen. Preferably, the autoantigen is an epitope derived from or contained in the beta-subunit, preferably SEQ ID NO5 or a variant thereof.
[0081] In a preferred embodiment, the agent for capture is an isolated and/or purified polypeptide, which is particularly preferably recombinant. In this connection, an isolated polypeptide can be understood to mean that the polypeptide has been removed from its natural environment or the environment in which it had been expressed. In a preferred embodiment, a purified polypeptide is understood to mean a polypeptide which has been enriched with respect to the concentration and/or purity in its natural environment by using chromatographic methods, preferably selected from the group comprising affinity chromatography, gel-filtration chromatography and ion-exchange chromatography. In a particularly preferred embodiment, a polypeptide is purified when it has a purity of at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 990/or 99.5%, which can be estimated visually or, preferably, by measurement of band intensities on an SDS-PAGE gel after Coomassie staining.
[0082] A polypeptide can be provided in the form of a tissue or a cell, preferably a recombinant tissue or a recombinant cell. The cell is preferably a eukaryotic cell, more preferably an insect, plant or mammalian cell, even more preferably a mammalian cell such as a human cell, most preferably an HEK293 cell.
[0083] A polypeptide as agent can be provided in folded form or in unfolded form and is preferably folded. Preferably, folding is measured by means of CD spectroscopy in a buffer which allows the measurement and in which the protein can assume its three-dimensional folding (see, for example, Banaszak, L. J. (2008), Foundations of Structural Biology, Academics Press, or Teng, Q. (2013), Structural Biology: Practical Applications, Springer), for example in 10 mM sodium phosphate buffer at pH 7. Preferably, the protein assumes folding recognized by an antibody to be detected.
[0084] In a preferred embodiment, an antibody is, after capture, detected by a method from the group comprising the measurement of immunodiffusion, immunoelectrophoresis, light scattering, agglutination, radioactivity, enzymatic activity, (electro)chemiluminescence and immunofluorescence. In the case of a detection by radioactivity, enzymatic activity, (electro)chemiluminescence and immunofluorescence, it is possible to use a detectable label. Said label is preferably attached to a secondary antibody which binds to the antibody to be detected. Detection methods are, for example, described in Zane, H. D. (2001), ImmunologyTheoretical & Practical Concepts in Laboratory Medicine, W. B. Saunders Company, particularly in chapter 14.
[0085] The invention provides a kit comprising the carrier according to the invention, the kit comprising one reagent or more than one reagent, preferably all the reagents, from the group comprising a wash solution, at least one calibrator solution, an antibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase, and an agent for the detection of the autoantibody, preferably a secondary antibody, even more preferably a secondary antibody against IgG antibodies, or the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase or a variant thereof, preferably having a detectable label, a dilution buffer for the dilution of the sample, a positive control, a chemiluminescence trigger solution and a substrate capable of chemiluminescence. Instead of the chemiluminescence trigger solution and the substrate capable of chemiluminescence, a chromogenic solution e.g. for an ELISA can also be contained.
[0086] The autoantibody detection can be quantitative or semi-quantitative, preferably semi-quantitative. In a preferred embodiment, it is understood that semi-quantitative means that what is determined is whether the measurement result lies above a certain threshold value, for example 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 RU/ml. The value in RU/ml is, in this connection, preferably measured by means of ELISA (EA 1361-9601 G) from EUROIMMUN Medizinische Labordiagnostika AG.
[0087] A calibrator solution, as used in the method according to the invention, is understood to mean a solution comprising a defined amount of an antibody which binds against the same antigen as the autoantibody to be detected and preferably belongs to the same IgG class as the antibody to be detected, the antigen preferably being the beta-subunit. The calibrator may comprise an amount of the antibody which is known in absolute or relative terms. For example, one calibrator solution may comprise ten times as much antibody as another one. The antibody present in a defined amount can be an autoantibody from a sample or a recombinant monoclonal antibody. Preferably, more than two, preferably 3, 4, 5 or 6, calibrator solutions having to different concentrations of the antibody are placed into the kit or used according to the invention, in particular investigated in parallel to a sample, with the result that a calibration curve for the semi-quantitative or quantitative determination of the autoantibody against the beta-subunit can be plotted. In a preferred embodiment, the calibrator comprises an autoantibody or antibody against the beta subunit of the gastric H.sup.+/K.sup.+-ATPase, preferably less or no detectable amounts of or no autoantibody or antibody against the alpha subunit.
[0088] According to the invention, a monoclonal antibody or isolated autoantibody which binds specifically against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is used particularly preferably in recombinant, isolated and/or purified form, most preferably against SEQ ID NO5. Such an antibody can serve as positive control for methods according to the invention and also as reagent for the immobilization of the beta-subunit or as reagent for competitive assay formats, for which it can optionally have a detectable label.
[0089] In a preferred embodiment, the captured autoantibody is detected by means of chemiluminescence. For this purpose, the autoantibody can be contacted with a ligand which is capable of chemiluminescence and which binds to the autoantibody. A ligand capable of chemiluminescence can be a secondary antibody which binds to the constant domain of the autoantibody or can be the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase or a variant thereof which binds to the variable domain. The ligand capable of chemiluminescence can be an enzyme capable of chemiluminescence, for example luciferase, peroxidase, alkaline phosphatase and -galactosidase, which can convert a substrate capable of chemiluminescence without being consumed at the same time (Kricka, L. J. (2003). Clinical applications of chemiluminescence. Analytica chimica act, 500(1): 279-286). The ligand capable of chemiluminescence can, however, also comprise an organic compound capable of chemiluminescence and without enzymatic activity, which compound emits a chemiluminescent signal in the presence of a chemiluminescence trigger solution, for example an acridinium ester (Weeks, I., Beheshti, I., McCapra, F., Campbell, A. K., Woodhead, J. S., Acridinium esters as high specific activity labels in immunoassay. Clin Chem 29: 1474-1479 (1983)) or luminol or a derivative thereof capable of chemiluminescence. This compound is consumed in the reaction.
[0090] In the case of an acridinium ester, the trigger solution used is a mixture of hydrogen peroxide and hydroxide, for example in the form of sodium hydroxide. The acridinium ester compound is, then, oxidized under alkaline conditions, and this generates light-emitting acridone. The signal is released in the form of a light flash (flash luminescence) which typically lasts 1-5 s. The short duration of the emission requires that the reaction be initiated and measured directly at the detector.
[0091] Preferably, chemiluminescence as detection method is used with a carrier which is a bead.
[0092] In a further preferred embodiment, the captured autoantibody is detected by means of ELISA. For this purpose, the agent for specific capture is immobilized in at least one well, preferably multiple wells, preferably at least 2, 4, 6, 8, 10, 12, 16, 20 or 24 wells, of an ELISA microtitre plate. A sample to be analysed is added to at least one well, and 2, 3, 4, 5 or more calibrator solutions are added to other wells. The captured antibody is then preferably detected via a secondary antibody having an enzymatically active label.
[0093] According to the invention, use is made of an agent for the specific capture of an autoantibody against the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase for the calibration or for the quality-control of a medical device. In a preferred embodiment, calibration is understood to mean that calibrator solutions are used to obtain measurement values which confirm that the instrument is providing reliable measurement values within a required concentration range or is allowing a reliable differentiation between the presence or absence of the autoantibody in a sample. In a further preferred embodiment, control can mean that what is verified is that the instrument is working reliably in the sense that a sample comprising the autoantibody is actually measured as positive and a sample without the autoantibody is actually measured as negative. In a further embodiment, control means that what is checked is whether a batch of the agent or an instrument under given conditions has the capability, preferably still sufficient capacity, to bind the autoantibody. The medical device can be a diagnostic product such as the inventive carrier. Alternatively, it can be a therapeutic device, for example for apheresis, which likewise comprises an agent for the specific capture or detection of the autoantibody.
[0094] In a preferred embodiment, the invention provides for use of a reagent or agent or polypeptide for the detection of an autoantibody against the beta-subunit or use of a nucleic acid encoding the beta-subunit or a variant thereof or a nucleic acid which hybridizes to said nucleic acid under stringent conditions or a vector or a cell comprising the nucleic acid or the vector for the production of a kit for the diagnosis of a disease. In a preferred embodiment, a cell comprising the vector, and preferably not comprising a vector encoding the alpha-subunit or an epitope or a variant thereof, is provided and cultured under conditions allowing the expression of the nucleic acid, followed by isolation and/or purification of the expression product, followed by use of the expression product as agent for the specific capture of an antibody in a method or product according to the present invention.
[0095] In a preferred embodiment, the present invention provides an apparatus for the analysis of a sample from a patient for the detection of an autoantibody against the beta-subunit, the detection indicating an increased probability of a disease, preferably AIG and/or PAG, the apparatus comprising: [0096] a. a carrier comprising an agent for the specific capture of the autoantibody when a sample is contacted with the carrier, [0097] b. a detectable agent capable of binding to the antibody when said antibody has been captured upon contacting of carrier and sample as per a., the agent being especially a labelled secondary antibody which binds to the captured antibody, [0098] c. a detection device for the detection of the presence of the detectable agent and for the conversion of the result obtained in this connection into a signal, preferably an electrical signal, and [0099] d. optionally a means for the receiving of the signal from the detection device and for the determination of whether the level of the signal indicates an increased probability of the disease, more precisely by comparison of the level of the signal with the level of a background or threshold signal or an inputted signal value which was generated using samples from healthy persons.
[0100] The present patent application lists novel polypeptides and/or nucleic acids. They have the following sequences:
TABLE-US-00001 SEQIDNO1:spGh*-H6-ATP4B(ec) MKHLWFFLLLVAAPRWVLSGPMHHHHHHMSQTVDPYTPDYQDQLRSPG VTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINC TSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKM NRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYG KKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVE FKLKIEK SEQIDNO2:H6-ATP4B(ec);sequencewhichisactuallypresentinthecelland waspurifiedfortheexamples,i.e.extracellulardomain,withN-terminalHis tag GPMHHHHHHMSQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVS DNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSC KFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAF LDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIP RNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK SEQIDNO3:ExtracellulardomainoftheATP4B-subunit QTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTL HAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSG LADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQV KYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVM AEHVTFNNPHDPYEGKVEFKLKIEK SEQIDNO4:TransmembranedomainoftheATP4B-subunit SLYYVAFYVVMTGLFALCLYVLM SEQIDNO5:ImmunodominantepitopeofthehumanATP4B-subunit homologoustothatfromdaSilvaetal. LLNIPRNAEVAIVCKVMAEHVTFNN SEQIDNO6:ImmunodominantepitopeofthemurineATP4B-subunitasper daSilvaetal. LLNVPKNMQVSIVCKILADHVTFNN SEQIDNO7:TheATP4B-subunitaminoacidsequencerepresentedinP51164 MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFY VVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIV YNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNH TKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRV DCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAK LLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK SEQIDNO8:ImmunodominantepitopeofthemurineATP4A-subunitasper Nishioetal. PLLCVGLRAQWEDHHLQDL SEQIDNO9:Alpha-subunitofthegastricH.sup.+/K.sup.+-ATPase,asrepresentedin UniProtKBaccessnumberP20648 MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMK KEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTP EYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLAIALIA VVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGD LVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETR NIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEHFVDI IAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSL TAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNH IHTADTTEDQSGQTFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIV IGDASETALLKFSELTLGNAMGYRDRFPKVCEIPFNSTNKFQLSIHTLEDPR DPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLGE RVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVP DAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRVPV DQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVI VESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMIL LDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGC ITILFIELCTDIFPSVSLAYEKAESDIMHLRPRNPKRDRLVNEPLAAYSYFQIG AIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQEWT FGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIV FQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRC CPGSWWDQELYY SEQIDNO10:Intrinsicfactor,asrepresentedinNCBIGenbankentry NP_005133.2 MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSS AYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTS SCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPI AVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVL KDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILN EIKQGKFHNPMSAIQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPT SASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKF ETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHI TANFTQY SEQIDNO11:cDNAencodingtheATP4A-subunitligatedintothevector pTriEx [Onlypresentinthesequencelistings] SEQIDNO12:cDNAencodingtheATP4B-subunitligatedintothevector pTriEx [Onlypresentinthesequencelistings]
[0101] The invention is elucidated below on the basis of exemplary embodiments with reference to the figures. The embodiments described are merely exemplary in every respect and not to be understood as limiting, and various combinations of the cited to features are encompassed by the scope of the invention.
[0102]
[0103]
EXAMPLES
[0104] Sensitivity was investigated by using sera from patients for whom the diagnosis of AIG was made. On the other hand, specificity was investigated by using sera from clinically normal blood donors for whom it can be assumed that they do not suffer from AIG.
Example 1: Determination of the Sensitivity of a Detection by Means of the Beta-Subunit of the Gastric H.SUP.+./K.SUP.+.-ATPase as Antigen Using Immunofluorescence and ELISA
[0105] The human cDNA described by Genbank access number BC 167780 and encoding the ATP4A-subunit was ligated into the vector pTriEx (yielding SEQ ID NO11).
[0106] The human cDNA described by Genbank access number BC029059 and encoding the ATP4B-subunit was likewise ligated into the vector pTriEx (yielding SEQ ID NO12).
[0107] Production of Substrates for Indirect Immunofluorescence HEK293 cells cultured on glass slides in D-MEM comprising an addition of 10% (v/v) foetal calf serum were transfected with the plasmid DNA encoding ATP4A or ATP4B, individually and in combination, and additionally, for the production of a negative control, with the empty pTriEx vector by means of 25 kDa linear polyethyleneimine and fixed after 48 hours. For the fixation, the glass slides with the adherent cells were first washed with PBS and then fixed alternately with 1.8% formalin solution in PBS for 5 minutes and in acetone at room temperature for 10 minutes. Finally, a wash and blocking step was carried out in PBS comprising an addition of 1% (w/v) BSA (PBS (1% w/v BSA)) at room temperature for 5 minutes.
[0108] All the incubation steps were carried out at room temperature.
[0109] Immunofluorescence Analysis
[0110] The serum or plasma samples to be analysed were incubated on the substrate in a 1:10 dilution in PBS (1% w/v BSA) for 30 minutes. Thereafter, the substrates were washed in PBS (0.2% v/v Tween 20) for 5 minutes. Bound human immunoglobulin of class IgG was detected using fluorescein-labelled anti-human IgG in a 30-minute incubation step. Excess conjugate was removed with PBS (0.2% v/v Tween 20) for 5 minutes before evaluation on an immunofluorescence microscope. Immunofluorescence was evaluated semi-quantitatively by indication of the intensity of the specific fluorescent signal in intensities of 0 (no fluorescence), trace (borderline signal), 1 (faintly positive), 2, 3 and 4 (highly positive).
[0111] Purification of the Extracellular Domain of ATP4B (SEQ ID NO2) Expressed Using Vector pTriEx-1 in HEK293 Cells:
[0112] HEK293 cells cultured in D-MEM comprising an addition of 10% (v/v) foetal calf serum were transfected with the plasmid DNA encoding spGh*-H6-ATP4B(ec) by means of 25 kDa linear polyethyleneimine. On day 5 after transfection, the cell culture supernatant was removed, clarified by centrifugation, and used for the purification of the recombinant protein by means of immobilized metal-chelate affinity chromatography (IMAC) using standard protocols. The purified protein stained with Ponceau S is shown in
[0113] ELISA Analysis:
[0114] The experiments were carried out as described in Dahnrich et al. (2013) Development of a standardized ELISA for the determination of autoantibodies against human M-type phospholipase A2 receptor in primary membranous nephropathy, Clinica Chimica Acta 421, 213-218, with the exception of the extracellular domain of ATP4B (SEQ ID NO2) being used as the antigen.
[0115] In brief, microtitre plates (Nunc, Germany) were coated overnight with 0.7 g/ml antigen in PBS at 4 C. and washed three times with wash buffer (0.05% (w/v) Tween 20 in PBS). Non-specific binding sites were blocked by means of a one-hour incubation with 0.1% casein (w/v) in PBS.
[0116] Samples of human serum were diluted 1:100 in sample buffer (0.05% (w/v) Tween 20, 1% (w/v) casein in PBS) and incubated for 30 minutes, followed by three wash steps with wash buffer. In addition to two positive samples from clinically characterized patients, seven further samples from patients were investigated.
[0117] Bound antibodies were detected by means of a 30-minute incubation with anti-human IgG HRP conjugate (EUROIMMUN, Germany) which was diluted 1:1000 in sample buffer. Thereafter, washing was carried out as described above, followed by addition of 3,3,5,5-tetramethylbenzidine (EUROIMMUN Medizinische Labordiagnostika AG) and a 15-minute incubation. All the incubation steps were carried out at room temperature.
[0118] Optical density (OD) was measured at 450 nm using an automatic spectrophotometer (Spectra Mini, Tecan, Crailsheim, Germany). The cut-off was ascertained by ROC curve analysis (maximum sum of sensitivity plus specificity).
[0119] For comparison, the assay was also carried out using the conventional anti-PCA ELISA (IgG) (EUROIMMUN Medizinische Labordiagnostika AG, order number EA 1361 G).
[0120] Results:
TABLE-US-00002 TABLE 1 Result of the investigation of sensitivity by means of ELISA and IFT ELISA Anti- ATP4B ELISA (IgG) (serum 1:101) 30% IFT Anti-PCA sucrose/ ATP- ELISA (IgG) 0.1% 4A + ATP- ATP- IFT Cut-off: casein ATP-4B 4A 4B Total 20 U/ml Normalized Formalin-fixed result Sample OD RU/ml OD* Sample dilution 1:10 AIG 01122017-27 0.842 119 0.011 0 0 0 Neg. patients 01122017-2 0.597 71 0.369 3 0 3 Pos. (n = 29) 01122017-11 0.491 50 0.468 2 0 2 Pos. 01122017-3 0.699 91 0.749 2.5 0 3 Pos. 01122017-22 0.873 125 0.821 2.5 0 2.5 Pos. 01122017-12 0.369 26 0.828 2 0 2 Pos. 01122017-20 0.411 34 0.862 3 0 3 Pos. 01122017-16 1.307 >200 0.894 2 0 2 Pos. 01122017-4 0.512 54 0.914 3 0 3 Pos. 01122017-28 0.694 90 0.970 2.5 0 1.5 Pos. 01122017-15 1.566 >200 0.986 3 1 3 Pos. 01122017-6 1.545 >200 0.988 3 0 3 Pos. 01122017-1 0.923 135 0.994 2.5 0 2.5 Pos. 01122017-25 0.989 148 1.126 3 0 3 Pos. 01122017-19 0.792 109 1.139 2.5 0.5 3 Pos. 01122017-29 1.004 151 1.145 2.5 0 3 Pos. 01122017-24 0.795 110 1.171 3 0 3 Pos. 01122017-13 1.622 >200 1.193 2 0 2 Pos. 01122017-9 1.386 >200 1.195 2 0 2 Pos. 01122017-5 0.855 121 1.221 3 0 3 Pos. 01122017-26 1.512 >200 1.228 2.5 0.5 3 Pos. 01122017-8 1.195 188 1.259 3 0 3 Pos. 01122017-10 1.229 195 1.269 3 0 3 Pos. 01122017-7 1.132 176 1.346 3 0 3 Pos. 01122017-21 1.506 >200 1.378 3 0 3 Pos. 01122017-17 1.840 >200 1.391 2 0 2 Pos. 01122017-14 1.259 >200 1.449 3 0 3 Pos. 01122017-18 1.889 >200 1.488 2.5 1 3 Pos. 01122017-23 1.535 >200 1.551 2 0 2 Pos. *Normalized to functional controls, qualitative evaluation via cut-off from ROC analysis (0.284)
Example 2: Determination of the Specificity of a Detection by Means of the Beta-Subunit of the Gastric H.SUP.+./K.SUP.+.-ATPase as Antigen Using ELISA in Comparison with the Conventional Assay (Related Art)
[0121] The experiments were carried out as described in Example 1, with the exception of use of sera from clinically normal blood donors.
[0122] Result:
TABLE-US-00003 TABLE 2 Result of the investigation of specificity by means of ELISA with comparison of a conventional anti-PCA ELISA and the inventive method using samples from blood donors Inventive:anti- Conventional ATP4B(ec) ELISA assay:anti-PCA 1:101 ELISA 1:201 PB of 15.11.2018 E170731AD U/ml Sample Age Sex OD U/ml OD (simulated) Blood BS 2014-II-2 21 M 0.054 3 0.015 <Min donor BS 2014-II-15 29 M 0.029 <Min 0.025 <Min 2014-II BS 2014-II-16 24 F 0.018 <Min 0.015 <Min BS 2014-II-18 23 M 0.069 4 0.017 <Min BS 2014-II-19 24 M 0.021 <Min 0.014 <Min BS 2014-II-20 20 F 0.027 <Min 0.021 <Min BS 2014-II-21 62 M 0.022 <Min 0.012 <Min BS 2014-II-25 28 F 0.456 50 0.585 85 BS 2014-II-27 27 M 0.103 6 0.008 <Min BS 2014-II-31 42 M 0.018 <Min 0.016 <Min BS 2014-II-34 51 M 0.022 <Min 0.017 <Min BS 2014-II-35 24 M 0.047 2 0.009 <Min BS 2014-II-36 28 M 0.052 3 0.014 <Min BS 2014-II-37 52 M 0.072 4 0.016 <Min BS 2014-II-38 26 F 0.013 <Min 0.022 <Min BS 2014-II-39 25 M 0.015 <Min 0.014 <Min BS 2014-II-40 35 M 0.022 <Min 0.015 <Min BS 2014-II-41 44 M 0.169 11 0.020 <Min BS 2014-II-42 45 M 0.197 13 0.013 <Min BS 2014-II-44 29 F 0.245 16 0.020 <Min BS 2014-II-45 53 M 0.011 <Min 0.010 <Min BS 2014-II-46 23 M 0.010 <Min 0.033 <Min BS 2014-II-47 24 M 0.044 2 0.009 <Min BS 2014-II-48 21 M 0.031 <Min 0.018 <Min BS 2014-II-50 21 M 0.122 7 0.008 <Min BS 2014-II-52 29 F 0.082 5 0.016 <Min BS 2014-II-54 59 M 0.009 <Min 0.009 <Min BS 2014-II-55 43 F 0.026 <Min 0.006 <Min BS 2014-II-57 20 M 0.064 3 0.019 <Min BS 2014-II-58 44 F 0.046 2 0.012 <Min BS 2014-II-59 26 M 0.080 5 0.011 <Min BS 2014-II-61 66 M 0.018 <Min 0.014 <Min BS 2014-II-63 21 F 0.036 <Min 0.013 <Min BS 2014-II-64 21 F 0.124 8 0.015 <Min BS 2014-II-65 46 M 0.037 <Min 0.008 <Min BS 2014-II-66 28 M 0.133 8 0.014 <Min BS 2014-II-67 37 M 0.010 <Min 0.010 <Min BS 2014-II-68 25 M 0.037 <Min 0.011 <Min BS 2014-II-69 19 M 0.145 9 0.007 <Min BS 2014-II-70 36 M 0.022 <Min 0.008 <Min BS 2014-II-71 34 M 0.153 10 0.016 <Min BS 2014-II-72 35 F 0.055 3 0.015 <Min BS 2014-II-73 24 F 0.060 3 0.013 <Min BS 2014-II-74 41 F 0.070 4 0.008 <Min BS 2014-II-75 44 M 0.016 <Min 0.038 <Min BS 2014-II-76 50 M 0.092 5 0.042 <Min BS 2014-II-77 44 M 0.037 <Min 0.023 <Min BS 2014-II-78 46 M 0.618 81 0.013 <Min BS 2014-II-79 20 M 0.361 31 0.027 <Min BS 2014-II-80 26 M 0.038 <Min 0.012 <Min BS 2014-II-201 49 M 0.115 7 0.049 2 BS 2014-II-204 64 M 0.029 <Min 0.020 <Min BS 2014-II-205 55 F 0.066 4 0.029 <Min BS 2014-II-206 58 F 0.050 2 0.013 <Min BS 2014-II-207 45 M 0.040 <Min 0.126 8 BS 2014-II-209 29 M 0.066 4 0.010 <Min BS 2014-II-210 45 M 0.053 3 0.017 <Min BS 2014-II-211 23 M 0.012 <Min 0.009 <Min BS 2014-II-214 41 M 0.405 40 0.271 18 BS 2014-II-215 45 M 0.013 <Min 0.015 <Min BS 2014-II-216 42 M 0.066 4 0.024 <Min BS 2014-II-218 52 F 0.828 122 0.014 <Min BS 2014-II-220 58 M 0.026 <Min 0.018 <Min BS 2014-II-221 25 M 0.049 2 0.013 <Min BS 2014-II-222 50 M 0.038 <Min 0.010 <Min BS 2014-II-224 24 M 0.042 <Min 0.013 <Min BS 2014-II-225 48 M 0.019 <Min 0.017 <Min BS 2014-II-228 63 M 0.163 10 0.012 <Min BS 2014-II-229 40 M 0.052 3 0.014 <Min BS 2014-II-230 21 F 0.098 6 0.018 <Min BS 2014-II-232 56 M 0.071 4 0.009 <Min BS 2014-II-234 32 F 0.038 <Min 0.012 <Min BS 2014-II-237 25 M 0.035 <Min 0.009 <Min BS 2014-II-238 23 M 0.175 11 0.008 <Min BS 2014-II-239 25 M 0.015 <Min 0.013 <Min BS 2014-II-240 45 M 0.007 <Min 0.011 <Min BS 2014-II-241 19 M 0.029 <Min 0.009 <Min BS 2014-II-242 47 M 0.312 22 0.016 <Min BS 2014-II-243 44 M 0.099 6 0.028 <Min BS 2014-II-244 26 F 0.016 <Min 0.009 <Min BS 2014-II-247 52 M 0.391 37 0.019 <Min BS 2014-II-248 51 M 0.020 <Min 0.011 <Min BS 2014-II-249 69 M 0.183 12 0.007 <Min BS 2014-II-251 31 M 0.030 <Min 0.025 <Min BS 2014-II-252 51 M 0.236 15 0.007 <Min BS 2014-II-254 21 M 0.036 <Min 0.019 <Min Blood BS 2014-II-255 21 M 0.033 <Min 0.021 <Min donor BS 2014-II-256 42 M 0.192 12 0.014 <Min 2014-II BS 2014-II-257 30 F 0.033 <Min 0.021 <Min BS 2014-II-259 27 F 0.136 8 0.016 <Min BS 2014-II-262 44 M 0.049 2 0.015 <Min BS 2014-II-263 22 M 0.106 6 0.018 <Min BS 2014-II-264 24 M 0.026 <Min 0.017 <Min BS 2014-II-266 26 M 0.025 <Min 0.015 <Min BS 2014-II-268 64 M 0.019 <Min 0.014 <Min BS 2014-II-269 59 M 0.093 6 0.021 <Min BS 2014-II-270 20 F 0.026 <Min 0.009 <Min BS 2014-II-274 21 M 0.044 2 0.035 <Min BS 2014-II-275 54 M 0.043 2 0.015 <Min BS 2014-II-276 33 F 0.067 4 0.032 <Min Specificity: 93% 99% New development: Reference: anti-ATP4B(ec) anti-PCA ELISA ELISA Sens. check (cut-off E170731AD PB of 15.11.2018 determination) MTP 1 OD U/ml Rule card OD OD Factor MW factor Functional 081031-151 0.565 71 65 0.922 0.863 1.068366 controls (2) 011126-10 (6) 0.913 139 158 1.113 1.113 1 1.03418308 Calibrators PCA: E170731AD Actual Nominal ATP4B(ec) OD OD normalized K1 1.228 1.307 KI (defined) 1.100 1.100 K2 0.303 0.321 KII (ROC) 0.284 0.294 K3 0.044 0.05 KIII (MW BS*1.5) 0.047 pK 101 107 New development: Reference: anti-ATP4B(ec) anti-PCA ELISA ELISA Sens. check (cut-off E170731AD PB of 15.11.2018 determination) MTP 2 OD U/ml Rule card OD OD Factor MW factor Functional 081031-151 0.545 67 65 0.879 0.863 1.01854 controls (2) 011126-10 0.859 127 158 1.123 1.113 1.008985 1.01376235 (6) Calibrators PCA: E170731AD Actual Nominal ATP4B(ec) OD OD normalized K1 1.242 1.307 KI (defined) 1.100 1.100 K2 0.302 0.321 KII (ROC) 0.284 0.288 K3 0.043 0.05 KIII (MW BS*1.5) 0.045 0.046 pK 101 107
Conclusion:
[0123] The results show that, with the exception of the sample from the first-mentioned patient, it is also possible to detect the autoantibody against the gastric H.sup.+/K.sup.+-ATPase in the samples from patients suffering from AIG when only the extracellular domain of the beta-subunit of the gastric H.sup.+/K.sup.+-ATPase is used as antigen.
[0124] Thus, there is consequently practically no loss of sensitivity compared to the conventional ELISA.
[0125] Using the alpha-subunit of the gastric H.sup.+/K.sup.+-ATPase, practically all the samples appear, by contrast, as false-negative.
[0126] The results of Example 2 show that it is possible to achieve a considerable specificity gain of 6% compared to the conventional assay.
[0127] It should be emphasized that the conventional ELISA already exhibits a considerable specificity of 93%. Achieving a further increase in specificity to this high level is technically challenging in diagnostics and a considerable contribution over the related art.
[0128] Specificity and diagnostic reliability as a whole are increased when the method according to the invention is used.
Example 3: Determination of the Sensitivity and Specificity of a Chemiluminescence-Based Assay for the Diagnosis of AIG by Means of Determination of Autoantibody Against ATP4B
[0129] Unless otherwise described, the experiment was carried out using the same reagents as described in Example 1.
[0130] In the present ChLIA, antigen-coated magnetic beads are used as solid phase for the specific detection of autoantibodies of immunoglobulin class IgG against ATP4B. The magnetic beads were produced using tosyl-activated M-280 Dynabeads (Invitrogen, catalogue number 14203, 14204) in accordance with the instructions from the manufacturer.
[0131] The assay is carried out in an automated manner in a random access analyser (RA Analyzer 10, product no. YG 0710-0101, EUROIMMUN Medizinische Labordiagnostika AG). In the first analysis step, coated magnetic beads are incubated with diluted patient samples in sample buffer (catalogue number LL9012, EUROIMMUN Medizinische Labordiagnostika AG). If the samples are anti-ATP4B-positive, specific antibodies bind to the antigen under these conditions.
[0132] In a second analysis step, acridinium ester-labelled anti-human IgG (catalogue number LK0711-G, EUROIMMUN Medizinische Labordiagnostika AG) conjugate is added, which binds to the specific antibodies.
[0133] Thereafter, the reaction mixture is admixed with trigger solutions (catalogue numbers LL0713-1 (A) and LL0713-2 (B), EUROIMMUN), which induce a chemiluminescence reaction.
[0134] The resultant light signal is outputted in relative light units (RLU). The intensity of the light signal is proportional to the quantity of the bound antibodies.
[0135] The results are shown in Table 3. A check with 20 sera from blood donors showed a specificity of 100%; with the conventional assay, it was only 95%. Data relating to sensitivity are shown in Table 4 and
TABLE-US-00004 TABLE 3 Specificity of the inventive assay (anti-ATP4B ELISA and anti-ATP4B ChLIA) in comparison with the conventional assay (anti-PCA ELISA): Anti-ATP4B ELISA (IgG) (serum Anti-ATP4B Anti-PCA 1:101) ChLIA ELISA Cut-off: (IgG) (IgG) 0.284 OD Cut-off: Cut-off: Normalized 15 203 RLU 20 U/ml OD RLU U/ml BS 2014-II-247 52 M 0.018 4148 37 BS 2014-II-248 51 M 0.011 3146 <2 BS 2014-II-249 69 M 0.007 3821 12 BS 2014-II-251 31 M 0.024 2579 <2 BS 2014-II-252 51 M 0.007 3712 15 BS 2014-II-254 21 M 0.018 3080 <2 BS 2014-II-255 21 M 0.021 2997 <2 BS 2014-II-256 42 M 0.014 4835 12 BS 2014-II-257 30 F 0.021 4098 <2 BS 2014-II-259 27 F 0.016 4306 8 BS 2014-II-262 44 M 0.015 4165 2 BS 2014-II-263 22 M 0.018 3922 6 BS 2014-II-264 24 M 0.017 3305 <2 BS 2014-II-266 26 M 0.015 2285 <2 BS 2014-II-268 64 M 0.014 4419 <2 BS 2014-II-269 59 M 0.021 4057 6 BS 2014-II-270 20 F 0.009 2941 <2 BS 2014-II-274 21 M 0.035 9391 2 BS 2014-II-275 54 M 0.015 5130 2 BS 2014-II-276 33 F 0.032 4446 4
TABLE-US-00005 TABLE 4 Results for the investigation of the sensitivity of the inventive assay by means of chemiluminescence (ChLIA) Sample RLU AIG patients 01122017-1 63 152 (n = 29) 01122017-2 21 014 01122017-3 47 948 01122017-4 64 709 01122017-5 76 510 01122017-6 57 101 01122017-7 107 771 01122017-8 96 252 01122017-9 88 773 01122017-10 101 609 01122017-11 31 900 01122017-12 53 679 01122017-13 82 617 01122017-14 136 471 01122017-15 61 015 01122017-16 50 633 01122017-17 114 152 01122017-18 143 291 01122017-19 78 018 01122017-20 56 620 01122017-21 112 762 01122017-22 56 937 01122017-23 153 585 01122017-24 87 705 01122017-25 82 279 01122017-26 89 876 01122017-27 2712 01122017-28 69 662 01122017-29 84 330