ARTIFICIALLY ACTIVATED PEPTIDES
20200181212 ยท 2020-06-11
Assignee
Inventors
- Robert M. Kennedy (Dexter, MI, US)
- Lin Bao (Portage, MI, US)
- Alvar R. Carlson (Kalamazoo, MI, US)
- Catherine L. Foune (Gobles, MI, US)
- Alexandra M. Haase (Martin, MI, US)
- Bruce A. Steinbaugh (Portage, MI, US)
Cpc classification
A01N25/04
HUMAN NECESSITIES
A01N25/00
HUMAN NECESSITIES
A01N25/00
HUMAN NECESSITIES
International classification
Abstract
Described are the artificially induced conversion of certain toxic peptides to create both different forms of those peptides and new and useful derivatives of the original peptides that are both useful by themselves and useful as new compounds and new stable intermediates that may be used to make other important compounds.
Claims
1. A peptide lactone comprising a peptide having an amino acid sequence that is at least 90% identical to the amino acid sequence set forth in SEQ ID NOs: 1-171, wherein said peptide lactone has one fewer 2H+O group than SEQ ID NOs: 1-171 in their native form.
2. A process for modifying a peptide that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121, comprising the following steps: a) mixing the peptide with water to make an aqueous solution or aqueous emulsion of said peptide in a liquid or semi-liquid form, wherein the aqueous solution or aqueous emulsion comprises at least 10% water; b) measuring the pH of said peptide in the aqueous solution or aqueous emulsion; and c) adjusting the pH of said solution or emulsion to a pH of between about 1.0 and about 6.5; between about 2.0 and about 6.0; less than about 7.0; between about 2.5 and about 5.5; between about 3.0 and about 5.0; between about 3.0 and about 4.0; or: adjusted to a pH of about 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, or 3.8.
3. The process of claim 2, wherein said pH adjustment is made using a strong or weak acid; wherein the strong acid is selected from one or more of the following: chloric acid (HClO.sub.3), hydrochloric acid (HCl), hydrobromic acid (HBr), hydroiodic acid (HI), phosphoric acid (H.sub.3PO.sub.4), sulfuric acid (H.sub.2SO.sub.4), perchloric acid (HClO.sub.4), nitric acid (HNO.sub.3), or a combination thereof; and wherein weak acids are selected from acetic acid, oxalic acid, or a combination thereof.
4. The process of claim 3, wherein the strong acids are phosphoric acid (H.sub.3PO.sub.4), sulfuric acid (H.sub.2SO.sub.4), or nitric acid (HNO.sub.3).
5. The process of claim 2, wherein during the pH adjustment, the aqueous solution or aqueous emulsion is exposed to a temperature increase; wherein the temperature increase is a dry heat; heat without steam or pressure; heat with steam and without pressure; heat without steam and with pressure; or any combination thereof.
6. The process of claim 2, wherein after said pH adjustment, the peptide is dried to a dry powder or granular form.
7. The process of claim 2, wherein one or more covalently bound 2H+0 molecules are removed from the peptide while said peptide is in an aqueous solution or emulsion by the reduction of the pH of the solution or emulsion to less than 7.0.
8. An insecticidal composition comprising the peptide of claim 1 in a formulation suitable for application to the locus of an insect.
9. A process of modifying a peptide that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121 comprising the following steps: a) preparing said peptide as a Form 1 or peptide acid composition containing less than about 10% water; and b) heating the Form 1 peptide or peptide acid to a desired temperature, either with or without pressure, or with or without steam, until the desired amount of Form 1 peptide or peptide acid converts to Form 2 peptide or peptide lactone; wherein the desired temperature is from about 10 C. to about 500 C.; and wherein the pressure is about ambient atmospheric pressure, or from about 10 psi to about 40 psi above ambient atmospheric pressure.
10. The process of claim 9, wherein the peptide is heated to at least one or more of the following temperature ranges: about 10 C. to 20 C.; about 20 C. to 30 C.; about 30 C. to 40 C.; about 40 C. to 50 C.; about 50 C. to 60 C.; about 60 C. to 70 C.; about 70 C. to 80 C.; about 80 C. to 90 C.; about 90 C. to 100 C.; about 100 C. to 110 C.; about 110 C. to 120 C.; about 120 C. to 130 C.; about 130 C. to 140 C.; about 140 C. to 150 C.; about 150 C. to 160 C.; about 160 C. to 170 C.; about 170 C. to 180 C.; about 180 C. to 190 C.; about 190 C. to 200 C.; about 200 C. to 210 C.; about 210 C. to 220 C.; about 220 C. to 230 C.; about 230 C. to 240 C.; about 240 C. to 250 C.; about 250 C. to 260 C.; about 260 C. to 270 C.; about 270 C. to 280 C.; about 280 C. to 290 C.; about 290 C. to 300 C.; about 300 C. to 400 C.; or about 400 C. to 500 C.
11. The process of claim 9, wherein the pressure is selected from any of the following pressures or ranges of pressures: about 10 psi to 40 psi; about 15 psi to 35 psi; about 18 psi to 25 psi; and about 21 psi.
12. The process of claim 9, wherein the peptide is maintained at the chosen temperature and pressure range for the following periods: a) about 5 minutes to about 40 minutes; b) about 10 minutes to about 30 minutes; c) about 15 minutes to about 25 minutes; or d) about 21 minutes.
13. The process of claim 9, wherein the peptide is subjected to at least one of the following conditions: a) about 100 C. to about 140 C. at a pressure of about 10 psi to about 40 psi for about 5 minutes to about 40 minutes; b) about 110 C. to about 130 C. at a pressure of about 15 psi to about 35 psi for about 10 minutes to about 30 minutes; c) about 115 C. to about 125 C. at a pressure of about 18 psi to about 25 psi for about 15 minutes to about 25 minutes; d) about 121 C. at a pressure of about 21 psi for about 20 minutes.
14. The process of claim 9, wherein the pressure is no greater than about atmospheric pressure, and the temperature is selected from the temperatures of from about 50 C. to about 60 C. or greater.
15. The process of claim 9, wherein the process comprises at least one of the following temperatures ranges: 50 C. to about 60 C.; about 60 C. to about 70 C.; about 70 C. to about 80 C.; about 80 C. to about 90 C.; about 90 C. to about 100 C.; about 100 C. to about 110 C.; about 110 C. to about 120 C.; about 120 C. to about 130 C.; about 130 C. to about 140 C.; about 140 C. to about 150 C.; about 150 C. to about 160 C.; about 160 C. to about 170 C.; about 170 C. to about 180 C.; about 180 C. to about 190 C.; about 190 C. to about 200 C.; about 200 C. to about 210 C.; about 210 C. to about 220 C.; about 220 C. to about 230 C.; about 230 C. to about 240 C.; about 240 C. to about 250 C.; about 250 C. to about 260 C.; about 260 C. to about 270 C.; about 270 C. to about 280 C.; about 280 C. to about 290 C.; about 290 C. to about 300 C.; about 300 C. to about 400 C.; or about 400 C. to about 500 C.
16. The process of claim 9, wherein said peptide is treated according to one of the following conditions: a) heating and maintaining the peptide at a temperature of more than about 100 C. for at least about 1 hour; b) heating and maintaining the peptide at a temperature of between from about 80 C. to about 120 C. for at least about 2 hours; c) heating and maintaining the peptide at a temperature of between from about 50 C. to about 80 C. for at least about 3 hours; d) heating and maintaining the peptide at a temperature of more than about 180 C., and a pressure of at least about 5 psi for at least about 5 minutes; e) heating and maintaining the peptide at a temperature of more than about 100 C., and a pressure of at least about 10 psi for at least about 10 minutes; f) heating and maintaining the peptide at a temperature of between from about 80 C. to about 120 C., and a pressure of at least about 10 psi, for at least about 30 minutes; g) heating and maintaining the peptide at a temperature of between from about 50 C. to about 80 C. for at least about 1 hour; h) heating and maintaining the peptide at a temperature of between about 200 C. to about 300 C., and a pressure between about 5 psi to about 10 psi for between about 5 minutes to about 10 minutes; i) heating and maintaining the peptide at a temperature of between about 150 C. to about 200 C., and a pressure between about 10 psi to about 30 psi for between about 5 minutes to about 30 minutes; j) heating and maintaining the peptide at a temperature of between about 80 C. to about 150 C., and a pressure between about 10 psi to about 20 psi for between about 20 minutes to about 60 minutes; k) heating and maintaining the peptide at a temperature between about 50 C. to about 80 C., and a pressure between about 10 psi to about 40 psi for between about 30 minutes to about 60 minutes; l) heating and maintaining the peptide at a temperature between about 110 C. to about 130 C., and a pressure between about 10 psi to about 20 psi for between about 10 minutes to about 20 minutes; or m) heating and maintaining the peptide at a temperature of about 121 C., and a pressure of about 21 psi for about 20 minutes.
17. The process of claim 9, wherein one or more covalently bound 2H+0 molecules are removed from the peptide.
18. The process of claim 9, wherein the peptide has the amino acid sequence of SEQ ID NO: 119, SEQ ID NO: 121, or a variant thereof.
19. A peptide that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121, treated according to the following steps: a) mixing said peptide with water to make an aqueous solution or aqueous emulsion of said peptide in a liquid or semi-liquid form, wherein the aqueous solution or aqueous emulsion comprises at least 10% water, b) measuring the pH of said peptide in the aqueous solution or aqueous emulsion, c) adjusting the pH of said solution or emulsion to a pH of less than about 7.0; between about 1.0 and about 6.5; between about 2.0 and about 6.0; between about 2.5 and about 5.5; between about 3.0 and about 5.0; between about 3.0 and about 4.0; or adjusted to a pH of 3.2, 3.4, 3.5, 3.6, or 3.8.
20. The peptide of claim 19, wherein said pH adjustment is made using a strong or weak acid; wherein the strong acid is: chloric acid (HClO.sub.3), hydrochloric acid (HCl), hydrobromic acid (HBr), hydroiodic acid (HI), phosphoric acid (H.sub.3PO.sub.4), sulfuric acid (H.sub.2SO.sub.4), perchloric acid (HClO.sub.4), nitric acid (HNO.sub.3), or a combination thereof; and wherein the weak acid is selected from acetic acid, oxalic acid, or a combination thereof.
21. The peptide of claim 19, wherein during the pH adjustment, the aqueous solution or aqueous emulsion is exposed to a temperature increase; wherein the temperature increase is a dry heat; heat without steam or pressure; heat with steam and without pressure; heat without steam and with pressure; or any combination thereof.
22. The peptide of claim 19, wherein after said pH adjustment, the peptide is dried to a dry powder or granular form.
23. The peptide of claim 19, wherein one or more covalently bound 2H+O molecules are removed.
24. The peptide of claim 19, wherein the peptide has the amino acid sequence of SEQ ID NO: 119, SEQ ID NO: 121, or a variant thereof.
25. A peptide that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121, modified according to the following steps: a) preparing said peptide as a Form 1 or peptide acid or composition containing less than about 10% water; and b) heating the Form 1 peptide or peptide acid to a desired temperature, either with or without pressure, or with or without steam; until the desired amount of Form 1 peptide or peptide acid converts to Form 2 peptide or peptide lactone; wherein the desired temperature is from about 10 C. to about 500 C.; and wherein the pressure is about ambient atmospheric pressure, or from about 10 psi to about 40 psi above ambient atmospheric pressure.
26. The peptide of claim 25, wherein the peptide is heated to at least one or more of the following temperature ranges: about 10 C. to about 20 C.; about 20 C. to about 30 C.; about 30 C. to about 40 C.; about 40 C. to about 50 C.; about 50 C. to about 60 C.; about 60 C. to about 70 C.; about 70 C. to about 80 C.; about 80 C. to about 90 C.; about 90 C. to about 100 C.; about 100 C. to about 110 C.; about 110 C. to about 120 C.; about 120 C. to about 130 C.; about 130 C. to about 140 C.; about 140 C. to about 150 C.; about 150 C. to about 160 C.; about 160 C. to about 170 C.; about 170 C. to about 180 C.; about 180 C. to about 190 C.; about 190 C. to about 200 C.; about 200 C. to about 210 C.; about 210 C. to about 220 C.; about 220 C. to about 230 C.; about 230 C. to about 240 C.; about 240 C. to about 250 C.; about 250 C. to about 260 C.; about 260 C. to about 270 C.; about 270 C. to about 280 C.; about 280 C. to about 290 C.; about 290 C. to about 300 C.; about 300 C. to about 400 C. or 400 C. to about 500 C.
27. The peptide of claim 25, wherein the pressure is selected from any of the following pressures or ranges of pressures: about 10 psi to about 40 psi; about 15 psi to about 35 psi; about 18 psi to about 25 psi; and about 21 psi.
28. The peptide of claim 25, wherein the peptide is maintained at the chosen temperature and pressure range for the following periods: a) about 5 minutes to about 40 minutes; b) about 10 minutes to about 30 minutes; c) about 15 minutes to about 25 minutes; or d) about 21 minutes.
29. The peptide of claim 25, wherein the peptide is subjected to at least one of the following conditions: a) about 100 C. to about 140 C.; at a pressure of about 10 psi to about 40 psi; for about 5 minutes to about 40 minutes; b) about 110 C. to about 130 C.; at a pressure of about 15 psi to about 35 psi; for about 10 minutes to about 30 minutes; c) about 115 C. to about 125 C.; at a pressure of about 18 psi to about 25 psi; for about 15 minutes to about 25 minutes; d) about 121 C., at a pressure of about 21 psi, for 2 about 0 minutes.
30. The peptide of claim 25, wherein the pressure is no greater than about atmospheric pressure, and the temperature is selected from the temperatures of at least about 50 C. to about 60 C. or greater.
31. The peptide of claim 25, wherein the process comprises at least one of the following temperatures ranges: about 50 C. to about 60 C.; about 60 C. to about 70 C.; about 70 C. to about 80 C.; about 80 C. to about 90 C.; about 90 C. to about 100 C.; about 100 C. to about 110 C.; about 110 C. to about 120 C.; about 120 C. to about 130 C.; about 130 C. to about 140 C.; about 140 C. to about 150 C.; about 150 C. to about 160 C.; about 160 C. to about 170 C.; about 170 C. to about 180 C.; about 180 C. to about 190 C.; about 190 C. to about 200 C.; about 200 C. to about 210 C.; about 210 C. to about 220 C.; about 220 C. to about 230 C.; about 230 C. to about 240 C.; about 240 C. to about 250 C.; about 250 C. to about 260 C.; about 260 C. to about 270 C.; about 270 C. to about 280 C.; about 280 C. to about 290 C.; about 290 C. to about 300 C.; about 300 C. to about 400 C.; or about 400 C. to about 500 C.
32. The peptide of claim 25, wherein said peptide is treated according to one of the following conditions: a) heating and maintaining the peptide at a temperature of more than about 100 C. for at least about 1 hour; b) heating and maintaining the peptide at a temperature of between about 80 C. to about 120 C. for at least about 2 hours; c) heating and maintaining the peptide at a temperature of between about 50 C. to about 80 C. for at least about 3 hours; d) heating and maintaining the peptide at a temperature of more than about 180 C., and a pressure of at least about 5 psi for at least about 5 minutes; e) heating and maintaining the peptide at a temperature of more than about 100 C., and a pressure of at least about 10 psi for at least about 10 minutes; f) heating and maintaining the peptide at a temperature of between about 80 C. to about 120 C., and a pressure of at least about 10 psi, for at least about 30 minutes; g) heating and maintaining the peptide at a temperature of between about 50 C. to about 80 C. for at least about 1 hour; h) heating and maintaining the peptide at a temperature of between about 200 C. to about 300 C., and a pressure between about 5 psi to about 10 psi for about between about 5 minutes to about 10 minutes; i) heating and maintaining the peptide at a temperature of between about 150 C. to about 200 C., and a pressure between about 10 psi to about 30 psi for about between about 5 minutes to about 30 minutes; j) heating and maintaining the peptide at a temperature of between about 80 C. to about 150 C., and a pressure between about 10 psi to about 20 psi for about between about 20 minutes to about 60 minutes; k) heating and maintaining the peptide at a temperature between about 50 C. to about 80 C., and a pressure between about 10 psi to about 40 psi for about between about 30 minutes to about 60 minutes; l) heating and maintaining the peptide at a temperature between about 110 C. to about 130 C., and a pressure between about 10 psi to about 20 psi for about between about 10 minutes to about 20 minutes; or m) heating and maintaining the peptide at a temperature of about 121 C., and a pressure of about 21 psi for about 20 minutes.
33. A peptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121, wherein the peptide has a covalently bound 2H+O removed.
34. An insecticidal peptide lactone, comprising a peptide that is at least 90% identical to the amino acid sequence set forth in SEQ ID NOs: 119 or 121, wherein said insecticidal peptide lactone has 2 fewer hydrogen atoms and one fewer oxygen atom than SEQ ID NOs: 119 or 121 in their native form.
35. The insecticidal peptide lactone of claim 34, wherein the insecticidal peptide lactone having at least 90% similarity to the amino acid sequence set forth in SEQ ID NO: 119 has disulfide bond connectivity covalently linking cysteine amino acids at the positions together: Cys5 to Cys20; Cys12 to Cys25; and Cys19 to Cys39; and wherein said peptide has 2 fewer hydrogens and one less oxygen molecule than in SEQ ID NO: 119 in its native form.
36. An insecticidal peptide lactone of claim 34, wherein acidification of a native peptide having at least 90% similarity to the amino acid sequence set forth in SEQ ID NOs: 119 or 121 results in the loss of 2 hydrogen atoms and one oxygen atom from the native peptide, resulting in the peptide lactone form.
37. An insecticidal peptide lactone of claim 34, wherein acidification and heating of a native peptide having at least 90% similarity to the amino acid sequence set forth in SEQ ID NOs: 119 or 121 results in the loss of 2 hydrogen atoms and one oxygen atom from the native peptide, resulting in the peptide lactone form.
38. The insecticidal peptide lactone of claim 34, wherein the insecticidal peptide lactone has an oxygen atom and two hydrogen atoms removed, and wherein a hydroxyl moiety (OH) is lost from a free carboxylic acid moiety present in the amino acid sequence of the peptide in its native form.
39. A peptide hydrazide created by a process comprising mixing a peptide lactone form of a peptide having an amino acid sequence as set forth in any one of SEQ ID NOs: 1-171, or a variation thereof, with hydrazine; and wherein the peptide lactone is converted from the peptide lactone form to a peptide hydrazide form.
40. The peptide hydrazide of claim 39, wherein the peptide lactone form is converted to the peptide hydrazide form according to the following steps: a) preparing the peptide lactone form is prepared in water; b) adding hydrazine monohydrate; and c) stirring.
41. The peptide hydrazide of claim 39, wherein the peptide lactone form is converted from a peptide acid form via a process comprising: a) preparing said peptide acid in an aqueous solution or aqueous emulsion containing less than about 10% water; and b) heating the peptide acid to a desired temperature, either with or without pressure, or with or without steam; until the desired amount of peptide acid converts to peptide lactone; wherein the desired temperature is from about 10 C. to about 500 C.; and wherein the pressure is about ambient atmospheric pressure, or from about 10 psi to about 40 psi above ambient atmospheric pressure.
42. The peptide hydrazide of claim 41, wherein the process to convert the peptide acid form to the peptide lactone form results in the removal of a covalently bound 2H+O molecule from the peptide lactone form.
43. The peptide hydrazide of claim 39, wherein the peptide has an amino acid sequence that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121.
44. A peptide hydrazone (II) created via the conversion of a peptide hydrazide form of a peptide to a peptide hydrazone (II) form comprising the steps of: a) creating a hydrazone (II) mixture by mixing the peptide hydrazide form with water, and hexanal in ethanol; b) treating the hydrazone (II) mixture with a solution of hexanal, acetic acid, and ethanol; and c) allowing the hydrazone (II) mixture to incubate, with or without the application of heat.
45. The peptide hydrazone (II) of claim 44, wherein the peptide hydrazone (II) has an amino acid sequence of SEQ ID NO: 119, SEQ ID NO: 121, or a variant thereof.
46. A peptide hydrazone (III) created via the conversion of a peptide hydrazide form of a peptide to a peptide hydrazone (III) form, comprising the steps of: a) creating a hydrazone (III) mixture by mixing a peptide hydrazide form of an insect predator peptide with a complex glycol solution and an acid in water; and b) allowing the hydrazone (III) mixture to incubate, with or without the application of heat.
47. The peptide hydrazone (III) of claim 46, wherein the complex glycol solution is O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (IV) in ethanol; and the acid is acetic acid.
48. The peptide hydrazone (III) of claim 46, wherein the peptide hydrazone (III) has an amino acid sequence of SEQ ID NO: 119, SEQ ID NO: 121, or a variant thereof.
49. A peptide hydrazone (VI) created via the conversion of a peptide hydrazide form of a peptide to a peptide hydrazone (VI), comprising the steps of mixing the peptide hydrazide with a solution of acrylic ketone in ethanol, and water.
50. The peptide hydrazone (VI) of claim 49, wherein the peptide hydrazone (VI) has an amino acid sequence of SEQ ID NO: 119, SEQ ID NO: 121, or a variant thereof.
51. A peptide hydrazone (IX) created via the conversion of a peptide hydrazide form of a peptide to a peptide hydrazone (IX) form, comprising the steps of mixing the peptide hydrazide form with a solution of a PEG4 Ketone in water.
52. The peptide hydrazone (IX) of claim 51, wherein the peptide hydrazone (IX) has an amino acid sequence of SEQ ID NO: 119, SEQ ID NO: 121, or a variant thereof.
53. An insecticidal composition comprising at least one peptide having one or more of the following forms: (a) peptide lactone; (b) peptide hydrazide; (c) a peptide hydrazone (II); (d) peptide hydrazone (III); or (e) peptide hydrazone (IX); wherein the peptide has an amino acid sequence selected from the group of amino acid sequences set forth in SEQ ID NO: 1-171, or a variation thereof; and wherein the peptide is combined with a formulation suitable for application to the locus of an insect.
54. The insecticidal composition of claim 53, wherein the peptide comprises an amino acid sequence that is at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 119 or SEQ ID NO: 121.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0058] The definitions should be read and understood in view of the application as a whole, its descriptions, examples and claims.
[0059] AI means active ingredient.
[0060] Autoclave means a device, with a pressure vessel that can be closed or locked and that allows for the addition of steam and or heated water, typically allowing for the removal of dry air with steam, sometimes with vacuum pumps, optionally allowing for steam pulsing or cycling in order to produce higher temperatures either with dry heat and/or with high pressure and optionally steam, if desired. It usually powered from an attached electric cord, a power cord, that carries current from a wall outlet to the device to power the heat and pressure made by the device, but it can refer to a simple pressure vessel that could be heated on a stove top.
[0061] Carbonyl means an aldehyde or ketone.
[0062] Chamber means an enclosed vessel or space.
[0063] Centigrade is a unit of temperature, usually as degree, it may be abbreviated C as in 40 C or C. as in 40 C.
[0064] Convert and Conversion means the transformation of a peptide from what is described as Form 1 to Form 2, using the methods described herein of heat, heat and steam and/or pressure or acid conditions either alone or in combination with other factors. Conversion is more fully described and exemplified herein.
[0065] DI means deionized water.
[0066] Form 1 or Form 1 peptide, refers to the form of a peptide, form suggesting the way it is folded or presents its active sites and its number or degree of internal bonding, and specifically Form I or Form 1 means a peptide as it exists when it is first formed and without the loss of 2H plus 0 or 18 daltons from its molecular weight. Form 1 is also known as the acid form of the peptide sometimes called here the peptide acid.
[0067] Form 2 or Form 2 peptide, refers to the form of a peptide, form suggesting the way it is folded or presents its active sites and its number or degree of internal bonding, and specifically Form II or Form 2 means a peptide that began as Form 1 peptide but was transformed through the application of any one of a combination of treatments described herein such as: heat, temperatures, pressure, steam, acid, low pH conditions resulting in the loss of a 18 daltons equivalent to a water molecule, when measured before and after it Converts from Form 1 to Form 2. When a peptide begins in one form and then looses 2H plus 0 or 18 daltons from its molecular weight it then exists as a Form 2 peptide. Form 2 is also known as the lactone form of the peptide or peptide lactone. See the first paragraph in Part 2 for the definition of lactone, as it is used in this document.
[0068] Formulation means a mixture of ingredients usually including the active ingredient, here typically a toxic peptide with other ingredients to increase the solubility, stability, spreadability, effectiveness, safety or other desired properties usually associated with storing or delivering the active ingredient.
[0069] Insect and Insect to be treated means an insect that a person having knowledge of the insect would like the insect controlled in some fashion such as limiting its food consumption, limiting its growth or shortening its life because it is perceived to consume or destroy food or materials or by its nature and presence it is undesirable.
[0070] Locus of an insect means the place where an insect normally lives, eats, sleeps or travels to or from.
[0071] Physiologically active peptide means a toxic peptide that is biologically active.
[0072] Pressure vessel means an enclosed container capable of holding a high pressure, with dry or wet pressured device that can, with the addition of water, produce heated steam and high temperatures. A pressure vessel needs to receive power from an external source, such as from a stove top heating ring, or as part of a autoclaved device.
[0073] Strong acid means an acid that ionizes completely in a solution of water. It has a low pH, usually between 1 and 3. Examples include: hydrochloric acidHCl, hydrobromic acidHBr, hydroiodic acidHI, sulfuric acidH.sub.2SO.sub.4, phosphoric acid (H.sub.3PO.sub.4), perchloric acid HClO.sub.4, nitric acid HNO.sub.3 and chloric acid HClO.sub.3.
[0074] Toxic peptide means a peptide, natural, artificial or synthetic, composed of amino acids, natural or artificial that produces harmful effect on insects when they are exposed to the peptides. Toxic peptides includes venomous peptides which are peptides from or related to venomous creatures like spiders, snakes, molluscs and snails. Toxic peptides includes the peptides identified and described in U.S. Pat. Nos. 8,217,003 and 8,501,684.
[0075] Water about 10% or a least about 10% or 10% or more or less means any formulation or mixture than has at least about 10% of its total weight or amount, available as water, that is water molecules not covalently bound as part of a larger molecule and capable of ionization of the H.sub.2O molecules, that is capable of maintaining a pH.
[0076] Weak acid means an acid that does not dissociate completely when in a water solution. They usually have a pH between 3 and 6. Examples include: acetic acid and oxalic acid. Weak acids exist in equilibrium between molecules that are ionized and those that are not.
[0077] General Descriptions and Procedures
[0078] Described herein are various treatments including heat alone, heat in combination with heated water, steam, heat and pressure and/or independently acid treatments that can modify a peptide . . .
[0079] These peptides undergo what is essentially a dehydration by rearrangement process. We call this transformation Conversion. Conversion happens when a normally toxic peptide is transformed into a much more active and more toxic peptide using elevated temperature, or heat, with or without steam and pressure, or acid, or heat with acid, or acid with heat plus steam and/or pressure or various combinations of temperature, heat, heat with pressure, heat with steam and pressure, acidity or low pH, acid or low pH with heat, acid or low pH with heat and pressure, acid or low pH with heat, steam and pressure. Conversion can be made to occur relatively quickly when heat is applied or if the peptides are in water, when low pH is applied to an aqueous solution of peptides. A temperature increase, that is heat, with or without an increase in pressure; with or without steam; or a decrease in pH, that is by applying an acid or acidic conditions to liquid formulation; or a combination of both temperature and acid results in a modification of certain toxin peptides that are described herein. Further observations, measurements and analysis of various embodiments related to this discovery are disclosed and claimed.
[0080] In some embodiments, peptides, toxic to insects, are treated with the following conditions: heat alone or heat in combination with steam and pressure, such as in a typical autoclave, operating at about 100 C. to 150 C. If steam and pressure are used with a pressure of about 100 kPa or 15 psi. for anywhere from 3, 5, 10, 20, 30, 40, 50, 60, 70, 75, 80 or 90 minutes depending on the variables of temperature, pressure and acidity then Conversion will result in a relatively short period of time. Suitable conditions for conversion are to heat the peptide and maintain it at a temperature of about 121 C., and a pressure about 21 psi for about 20 minutes. Some of the procedures described herein, in some embodiments, are similar to standard procedures used when autoclaving biological samples for reuse or safe disposal.
[0081] If lower temperatures and pressures than those described above are used, then Conversion takes longer than the times suggested above. The process can be used on dry powder or crystal forms of peptides or the peptides can be put into solution and then Converted. When peptides are put into aqueous solutions then pH becomes an important factor to monitor, adjust and control. In general, lower the pH solutions convert faster than higher pH solutions and Conversion just about stops above pH 7.0.
[0082] Typical autoclave operating conditions suitable for the methods described herein are: steam heated to about 120 C. to 135 C. for about 15 minutes, or about 10 to 20 minutes, at a pressure of about 100 kPa or 15 psi, or about 10 to 20 psi, will be enough to make the Conversion in a reasonable period of time. One skilled in the art will be able to change and vary the conditions to monitor and control the rates of Conversion, by using measurements and assays as described herein.
[0083] The method of modifying a peptide requires some heat over and above room temperature. Heat by itself or heat in the presence of steam and or heat in the presence of pressure can be used. The time it takes to convert depends on how much heat, and or steam and pressure and if relevant the acidity of the solution the peptides are in. Heat plus time is sufficient to make the make the changes or Conversion identified herein. How much time is required depends on how much heat is used and whether or not steam and pressure are used with the heat. Similarly, how much heat is required depends on how much time the peptides are heated and whether or not steam and pressure is used.
[0084] A few examples of possible heat options, with and without, steam; as well as various pressures that can be used to modify peptides are disclosed. One skilled in the art would be able to use these teachings and examples to determine many other possible temperatures, pressures, pH conditions and combinations thereof.
[0085] Examples of temperatures, times and pressures, with and without steam.
[0086] With steam: a) 110 C., 30 psi, 20 min.; b) 120 C., 15 psi, 15 min.; c) 130 C., 30 psi, 3 min., 8 min., 10 min. to 15 min. depending on container and whether covered or not.
[0087] Without steam (dry normal pressure): a) 120 C., 0 psi, 12 hrs; b) 130 C., 0 psi, 6 hrs.; c) 140 C., 0 psi, 3 hrs.; d) 150 C., 0 psi, 2.5 hrs.; e) 160 C., 0 psi, 2 hrs.; f) 170 C., 0 psi, 1 hr.
[0088] It should be noted and understood that even moderate increases in temperature can effectuate the desired changes in the peptide, provided enough time is given for the reaction to proceed. For example, room temperature is typically in the range of about 20 to 25 C. When the temperature of the preparations is raised to as little as 40 C., the reaction can take place in a number of hours or days; however, the reaction at 40 C., with no steam and no pressure will proceed very slowly and could take as long as 2 years to complete. The reaction at 100 C., with no steam and no pressure could take as long as 6 months to complete. But if the reaction is run at 120 C., 15 psi, Conversion could be completed in 15 minutes.
[0089] The examples of heat, time, steam, and pressure, provided above can be used with wet or dry preparations. Dry preparation activity is important because in the commercial preparations of the peptide toxin, a dry preparation is easy to measure, transport, sell and use. The method of exposing dry powder to steam heat is especially preferred because the steam heat can also be used to disable and deactivate most living materials such as yeast hybrids that may be undesirable left over contaminates from the manufacture of the toxic peptides.
[0090] Another independent factor, in addition to heat, steam and pressure that can be used to modify peptides is pH or acidity. Low pH, i.e. below 7, or acidity, can be used when the peptides are in solution and either at room temperature or in combination with the time, temperatures, pressure and steam factors discussed above.
[0091] Acidity and Acid conditions is believed to be an important factor that can influence the rate of Conversion. First it should be appreciated that the processes described above can take place when the peptides are in a dry form without water, but they can also be converted to their more active form when mixed with water, or when hydrated with sufficient water to form a measurable pH. Low pH or acid conditions, 7.0 or less has been found to be an independent factor that can be used to increase the rate and speed of Conversion. The optimal pH appears to be between about 1.5 and about 6, preferably between about 2 and about 5, more preferably between about 3 and about 4, more preferably about 3.5 but any acid conditions, 7.0 or lower, will increase the rate of reaction when the peptides are in solution. This is essentially an equilibrium reaction driven by pH. At a pH above 7.0 the reaction will be slow, the higher the pH the slower until it becomes so slow as to be essentially ineffective, when using aqueous reaction conditions. There will be some conversion at a pH slightly above pH 7.0 to about 7.5. At higher pH conditions the Conversion will be so slow as to effective and is generally considered to be of little commercial value.
[0092] In one embodiment the peptides are mixed with water, put in solution at a pH of 6.0 or less and Converted under steam and pressure at a temperature of between about 120 C. to about 150 C. for a rapid Conversion in less than about 10 minutes.
[0093] The Reaction. Without wishing to be bound by theory, and the procedures described do not require it, but to further advance the disclosure of the discovery, and to improve the teaching herein, we think the following reactions may take place during Conversion. When certain peptides are processed according the heat, pressure, steam, and acid regimes described herein they appear to lose the equivalent of a water molecule and so we sometimes call the process on of dehydration.
[0094] For purposes of illustration, we provide data for 2 sequences, SEQ ID NO:119 (also called Hybrid +2) and SEQ ID NO:121, both are provided in the examples and the sequence listing. These are two toxic peptides that differ only their N-terminal amino acids. SEQ ID NO:119 has an N-terminal GS. SEQ ID NO:121 does not have an N-terminal GS. SEQ ID NO:121 has 39 amino acids and they are the same 39 C-terminal amino acids found in SEQ ID NO:119. These toxic peptides are useful to demonstrate and explain Conversion.
[0095] We begin by explaining what Conversion is not. Conversion is not when a peptide with an N-terminal having an amino acid like glutamine, or Q, as in SEQ ID NO:121, spontaneously forms a cyclic compound like pyroglutamic acid. For example the N-terminal glutamic acid of SEQ ID NO:121 can form pyroglutamic acid. Here we call the spontaneous cyclization of either an N-terminal or internal amino acid having a free NH.sub.3 group, the NH.sub.3 reaction. The NH.sub.3 reaction is not Conversion and it is not comparable to Conversion. We call Conversion the 2H+O reaction or H.sub.2O reaction or dehydration reaction, and it is completely different than the NH.sub.3 reaction. Both can occur with the same peptide as we prove in Example 5. The existence of two forms of a single peptide and the controlled ability to change one form into the other or at least the form having 2H+O into a form not having it is demonstrated with these two peptides and is characterized and explained below in the examples.
[0096] Optimal peptides for Conversion.
[0097] We believe many peptides are suitable for Conversion, including those described in detail below. Toxic insect peptides or insect predator peptides have 2, 3 or 4 cystine bonds, which means they have 4, 6, or 8 cysteines. They are peptides of greater than about 10 amino acid residues and less than about 300 amino acid residues. More preferably they range in amino acid or aa size from about 20 aa to about 50 amino acids. They range in molecular weight from about 550 Da to about 350,000 Da. They show surprising stability when exposed to high heat and low pH. Toxic insect peptides have some type of insecticidal activity. Typically they show activity when injected into insects but most do not have significant activity when applied to an insect topically. The insecticidal activity of toxic insect peptides is measured in a variety of ways. Common methods of measurement are widely known to those skilled in the art. Such methods include, but are not limited to determination of median response doses (e.g., LD50, PD50, LC50, ED50) by fitting of dose-response plots based on scoring various parameters such as: paralysis, mortality, failure to gain weight, etc. Measurements can be made for cohorts of insects exposed to various doses of the insecticidal formulation in question. Analysis of the data can be made by creating curves defined by probit analysis and/or the Hill Equation, etc. In such cases, doses would be administered by hypodermic injection, by hyperbaric infusion, by presentation of the insecticidal formulation as part of a sample of food or bait, etc.
[0098] Toxic insect peptides are defined here as all peptides shown to be insecticidal upon delivery to insects either by hypodermic injection, hyperbaric infusion, or upon per os delivery to an insect (i.e., by ingestion as part of a sample of food presented to the insect). This class of peptides thus comprises, but is not limited to, many peptides produced naturally as components of the venoms of spiders, mites, scorpions, snakes, snails, etc. This class also comprises, but is not limited to, various peptides produced by plants (e.g., various lectins, ribosome inactivating proteins, and cystine proteases), and various peptides produced by entomopathogenic microbes (e.g. the Cryl/delta endotoxin family of proteins produced by various Bacillus species.)
[0099] The following documents are incorporated by reference in the US in their entirely, in other jurisdictions where allowed and they are of common knowledge given their publication. In addition they are incorporated by reference and known specifically for their sequence listings to the extent they describe peptide sequences. See the following:
[0100] U.S. Pat. No. 7,354,993 B2, issued Apr. 8, 2008 specifically the peptide sequences listed in the sequence listing, and those numbered 1-39, and those named U-ACTX polypeptides, toxins that can form 2-4 intrachain disulphide bridges, and variants thereof, and the peptides appearing on columns 4-9 of the specification and in
[0101] Described and incorporated by reference to the peptides identified herein are homologous variants of sequences mentioned, have homology to such sequences or referred to herein which are also identified and claimed as suitable for Conversion according to the processes described herein including but not limited to all homologous sequences including homologous sequences having at least any of the following percent identities to any of the sequences disclosed her or to any sequence incorporated by reference: 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% or greater identity to any and all sequences identified in the patents noted above, and to any other sequence identified herein, including each and every sequence in the sequence listing of this application. When the term homologous or homology is used herein with a number such as 30% or greater then what is meant is percent identity or percent similarity between the two peptides. When homologous or homology is used without a numeric percent then it refers to two peptide sequences that are closely related in the evolutionary or developmental aspect in that they share common physical and functional aspects like topical toxicity and similar size within 100% greater length or 50% shorter length or peptide.
[0102] Described and incorporated by reference to the peptides identified herein that are derived from any source mentioned in the US and EP patent documents referred to above, including but not limited to the following: Toxins isolated from plants and insects, especially toxins from spiders, scorpions and plants that prey on or defend themselves from insects, such as, funnel web spiders and especially Australian funnel web spiders, including toxins found in, isolated from or derived from the genus Atrax or Hadronyche, including the genus species, Hadronyche versuta, or the Blue Mountain funnel web spider, Atrax robustus, Atrax formidabilis, Atrax infensus including toxins known as atracotoxins, co-atracotoxins, kappa atracotoxins, omega atracotoxins also known as w-atracotoxin, U-ACTX polypetides, U-ACTX-Hv1a, rU-ACTX-Hv1a, rU-ACTX-Hv1b, or mutants or variants, especially peptides of any of these types and especially those less than about 200 amino acids but greater than about 10 amino acids, and especially peptides less than about 150 amino acids but greater than about 20 amino acids, especially peptides less than about 100 amino acids but greater than about 25 amino acids, especially peptides less than about 65 amino acids but greater than about 25 amino acids, especially peptides less than about 55 amino acids but greater than about 25 amino acids, especially peptides of about 37 or 39 or about 36 to 42 amino acids, especially peptides with less than about 55 amino acids but greater than about 25 amino acids, especially peptides with less than about 45 amino acids but greater than about 35 amino acids, especially peptides with less than about 115 amino acids but greater than about 75 amino acids, especially peptides with less than about 105 amino acids but greater than about 85 amino acids, especially peptides with less than about 100 amino acids but greater than about 90 amino acids, including peptide toxins of any of the lengths mentioned here that can form 2, 3 and or 4 or more intrachain disulphide bridges, including toxins that disrupt calcium channel currents, including toxins that disrupt potassium channel currents, especially insect calcium channels or hybrids thereof, especially toxins or variants thereof of any of these types, and any combination of any of the types of toxins described herein that have topical insecticidal activity, can be Converted by the processes described herein.
[0103] It should be understood that the same or other peptides can be conjugated to the peptides described herein. The conversion from Form 1 to Form is an internal conversion, the N and C terminal peptides are not affected and thus the N and C terminal amino acids can have covalent binding partners, be they long or short. We describe in detail binding partners that at up to 1000 amino acids in size, in addition to 900, 800, 700, 600, 500, 400, 300, 200, 100, 50 or fewer amino acids peptide conjugates are described.
[0104] Venomous peptides from the Australian Funnel Web Spider, genus Atrax and Hadronyche are particularly suitable and work well when treated by the methods, procedures or processes described by this invention. These spider peptides, like many other toxic peptides, including especially toxic scorpion and toxic plant peptides, become topically active or toxic when treated by the processes described by this invention. Examples of suitable peptides tested and with data are provided herein. In addition to the organisms mentioned above, the following species may also carry toxins suitable for Conversion by the process of this invention. The following species are named: Agelenopsis aperta, Androctonus australis Hector, Antrax formidabillis, Antrax infensus, Atrax robustus, Bacillus thuringiensis, Bothus martensii Karsch, Bothus occitanus tunetanus, Buthacus arenicola, Buthotus judaicus, Buthus occitanus mardochei, Centruroides noxius, Centruroides suffusus, Hadronyche infensa, Hadronyche versuta, Hadronyche versutus, Hololena curta, Hottentotta judaica, Leiurus quinquestriatus, Leiurus quinquestriatus hebraeus, Leiurus quinquestriatus, Oldenlandia affinis, Scorpio maurus palmatus, Tityus serrulatus, Tityus zulianu. Any peptidic toxins from any of the genus listed above could be considered for Conversion according to the process in this invention.
[0105] The Examples in this specification are not intended to, and should not be used to limit the invention, they are provided only to illustrate the invention.
[0106] As noted above, many peptides are suitable candidates for conversion. The sequences noted above, below and in the sequence listing are especially suitable peptides that can be converted. Some of these peptides have been converted according to the procedures described herein as is described in the examples below.
TABLE-US-00001 SEQIDNO:60 (onelettercode) SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD 1510152025303537 SEQIDNO:60 (threelettercode) SerProThrCysIleProSerGlyGlnProCysProTyrAsnGluAsn 151015 CysCysSerGlnSerCysThrPheLysGluAsnGluAsnGlyAsnThr 202530 ValLysArgCysAsp 3537
[0107] SEQ ID NO:60 is named -ACTX-Hv1a it has disulfide bridges at positions: 4-18, 11-22 and 17-36. The molecular weight is 4096.
TABLE-US-00002 SEQIDNO:117 (onelettercode) GSSPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD 1510152025303539 SEQIDNO:117 (threelettercode) GlySerSerProThrCysIleProSerGlyGlnProCysProTyrAsn 151015 GluAsnCysSerGlnSerCysThrPheLysGluAsnGluAsnGly 202530 AsnThrValLysArgCysAsp 3539
[0108] SEQ ID NO:117 is named -ACTX-Hv1a+2 it has disulfide bridges at positions: 6-20, 13-24 and 19-38. The molecular weight is 4199.
TABLE-US-00003 SEQIDNO:118 (onelettercode) GSAICTGADRPCAACCPCCPGTSCKAESNGVSYCRKDEP 1510152025303539 SEQIDNO:118 (threelettercode) GlySerAlaIleCysThrGlyAlaAspArgProCysAlaCys 151015 ProCysProGlyThrSerCysLysAlaGluSerAsnGlyValSer 202530 TyrCysArgLysAspGluPro 3539
[0109] SEQ ID NO:118 is named -ACTX-Hv1c it has disulfide bridges at positions: 5-19, 12-24, 15-16, 18-34. The molecular weight is 3912.15.
TABLE-US-00004 SEQIDNO:119 (onelettercode) GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA 151015202530354041 SEQIDNO:119 (threelettercode) GlySerGlnTyrCysValProValAspGlnProCysSerLeuAsnThr 151015 GlnProCysAspAlaThrCysThrGlnGluArgAsnGluAsn 202530 GlyHisThrValTyrCysArgAla 354041
[0110] SEQ ID NO:119 is named rU-ACTX-Hv1a (Hybrid)+2 it has disulfide bridges at positions: 5-20, 12-25, 19-39. The molecular weight is 4570.51.
[0111] The examples below are intended to illustrate and provide further written description and support to this disclosure. They are not intended to limit the disclosure or the claims.
EXAMPLES
General Information about the Examples
[0112] SEQ ID NO:119 is GSQYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA.
[0113] SEQ ID NO:119 has 41 amino acids. When properly folded, it has 3 disulfide bonds. It has the elemental composition of C.sub.185H.sub.276N.sub.56O.sub.68S.sub.6. SEQ ID NO:119 may be called the +2 hybrid, Hybrid +2, or the plus 2 hybrid.
[0114] SEQ ID NO:121 is QYCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYYCRA. SEQ ID NO:121 has 39 amino acids and they are the same as the 39 C terminal amino acids in SEQ ID NO:119. SEQ ID NO:121 may be called, native or native hybrid OR native hybrid peptide.
[0115] The N-terminal amino acid of SEQ ID NO:119 is G, glycine or Gly. The 2 N-terminal amino acids in SEQ ID NO:119 are GS these amino acids are not part of the N-terminal of SEQ ID NO:121. The N-terminal of SEQ ID NO:121 is Q or glutamine.
[0116] It is possible for a sequence ending in glutamine, Q or Gln, like SEQ ID NO:121 to spontaneously undergo cyclization, from glutamine to pyroglutamic acid. The reaction can be quick, can be spontaneous and does not require the addition of heat or acid. This amino group, sometimes N-terminal cyclization, is known to occur in peptides and it results in the peptide losing 17 mass units, atomic units or daltons, correlating with the 17 daltons of NH.sub.3 lost upon the cyclization. We refer to this reaction as the NH.sub.3 reaction, it is not what we call Conversion. We explain this reaction in more detail in Example 5, below.
[0117] We think a very different reaction occurs when heat is applied to a toxic peptide like SEQ ID NO:121, and we refer to this reaction as Conversion or the 2H+0 reaction. Conversion results in a modificatio in the peptide which is an altogether different reaction, with the peptide having different properties as compared to what happens to a peptide that experiences the NH.sub.3 reaction.
[0118] When a toxic peptide is exposed to any of the Conversion conditions we describe herein, i.e. heat, pressure, steam, acid conditions for aqueous solutions, then we believe the 2H+O reaction results.
[0119] The Conversion, or 2H+O reaction, results in a compound having one less water molecule than before the reaction starts. Below, we provide data showing that the peptide that results from Conversion results in a peptide with one less H.sub.2O, or 18 dalton and is essentially dehydrated but is also much more robust and toxic a peptide, than the peptide was before it was Converted. That is the form of the peptide changes, such that the original form, herein called form 1 or Peak 1, has 18 more daltons as compared to the Converted Form 2 peptide.
[0120] Mass spec. evidence that shows the 2H+O reaction is not the same as the NH.sub.3 reaction, rather, the 2H+O reaction results in the loss of 18 Daltons correlating with 18 Daltons of H.sub.2O, rather than 17 Daltons of NH.sub.3. We show the daltons of H.sub.2O lost in the 2H+O reaction in Example 1; and the 17 Daltons of NH.sub.3 lost is provided in Example 5.
Example 1
[0121] Mass Spectrograph Peak 1/Form 1 and Peak 2/Form 2. In
[0122]
[0123]
[0124]
[0125]
[0126]
[0127] When the two mass values from
[0128] The peptides and their forms, indicated by Peaks 1 and 2, were isolated and compared. The examples below provide comparisons of the activity of the original form, called any of the following: Peak 1, Form 1, native, acid form, peptide acid, original, preConverted, unconverted, or not Converted form of the peptide. Form 1 is the form or acid form that heated or acidified in order to turn it into Form 2 or the lactone form or peptide lactone as lactone is defined in Part 2. In some of these examples the heat treatment is an autoclave treatment, at about 121 C. for 20 minutes at 21 psi., or if the peptide is in liquid form it means lowering the pH to under 7.0 in order to Convert the peptide to what is called any of the following: Peak 2, Form 2, the lactone form, the peptide lactone, (as lactone is defined in Part 2.) the dehydrated form of the peptide, or the Converted form of the peptide.
Example 2
[0129] Diet Incorporation Study. The graph in
[0130] Four days after the insects were fed, the difference in the percent mortality between the traditional 618 (before Conversion) and the autoclaved 618 (after Conversion) becomes pronounced. The autoclave treatment lead to a quicker speedier death following the caterpillars eating treated food. The number of insects dying that were treated with Form 2, is about 95%, compared to the 618 dry powder Form 1, native peptide or peptide not Converted, Form 1, is about 22%. Autoclaving the normal peptide did not deactivate the hybrid protein as expected.
[0131] Methods: Insects: SCR are purchased from Crop Characteristics (Farmington, Minn.). Insects were received as ready to hatch on filter paper. The insects were hatched at room temperature (26 C) and left in the plastic bag they were shipped in. The insects were hatched after 1-2 days and were used the day of hatch for the assay.
[0132] Media: SCR larval diet was purchased from Bioserve (Product # F9800B, Frenchtown, N.J.). To make 100 mL of diet, 100 mL of DI water is boiled with 1.44 g of the provided agar. Solution is boiled until the agar is fully dissolved. Then 13.28 g of diet and 460 ul of KOH are added and media is mixed on warm stir plate until homogeneous. Media is then aliquoted into 20 mL portions and cooled to 65 C in a water bath.
[0133] Treatments: The 618 treatments were prepared using the calculation of 25% AI. A 10 ppt solution was made (10 mg/mL) by mixing 260 mg of powder with 6.5 mL of water. The solution is mixed thoroughly and sonicated if necessary to dissolve all the powder completely. 200 mg of 618 powder was put in a glass jar with a screw on top. The powder was then autoclaved on the 20 minute Dry cycle with the cap loosened. After the autoclave cycle, the powder had absorbed some liquid. 5 ml of water was then added to the powder and mixed well to dissolve. 5 mL of either water or treatment is then added to the 20 mL of 65 C food and mixed well and 1 mL of DI is then transferred to each well of the bug condos (Bioserve Product # BAW128) using a repeat pipetter and allowed to cool.
[0134] Insects are then applied once media has cooled and set (20 min), one per well, using a paint brush to transfer SCR. Wells are then sealed with perforated lids (Bioserve Product # BACV16) and left on the light cart in the insect lab.
Example 3
[0135] Bioassay comparison. Results of a bioassay comparison are shown in
[0136]
[0137]
[0138] The results of the Bioassay comparisons as lethal dose 50 are provided in Table 1, below.
TABLE-US-00005 TABLE 1 Bioassay comparisons as lethal dose 50 Solution LD50 (pmol/g) Hybrid + 2 Peak 1 127 Hybrid + 2 Peak 2 92
Example 4
[0139] Stability pH Study. Example 4 shows the effect of heat and/or acid on conversion trends for both Form 1 and Form 2. This was both a stability and a pH study. It compares pre Conversion or Form 1, to post Conversion or Form 2 peptides. The study used the peptide of SEQ ID NO:119 and shows that, in addition to heat, a decrease in pH, that is the lowering of the pH of a solution of peptide, with acid or any means to lower the pH to make it 7.0 or below, will result in increased Conversion of the peptide from Form 1 to Form 2.
[0140] The Stability pH Study results are shown in
[0141]
TABLE-US-00006 TABLE 2 Sample 1 at pH 3.9 and 8.3 Sample Peak 1 Height Peak 2 Height LC pH 5.6 2360 2225 LC pH 3.9 2948 1630 LC pH 8.3 2000 1526
[0142] Observation: Slight decrease in peak 2 height in both pH solutions.
TABLE-US-00007 TABLE 3 Sample 2 at 25 C. for 24 hrs at pH 3.9 and 8.3 Sample Peak 1 Height Peak 2 Height LC pH 5.6 2359 2215 LC pH 3.9 2001 1670 LC pH 8.3 2023 1527
[0143] Observation. Slight decrease in peak 2 height in both pH solutions
TABLE-US-00008 TABLE 4 Sample 3 at 25 C. for 96 hrs at pH 4.0 and 7.8 Sample Peak 1 Height Peak 2 Height LC pH 5.6 2341 2198 LC pH 4.0 1887 1795 LC pH 7.8 2038 1355
[0144] Observation. Larger decrease in peak 2 height in higher pH solution
TABLE-US-00009 TABLE 5 Sample 4 at 40 C. for 72 hrs at pH 3.9 and 8.3 Sample Peak 1 Height Peak 2 Height LC pH 5.6 2325 2275 LC pH 3.9 1365 2104 LC pH 8.3 2082 782
[0145] Observation. Decrease in peak 1 height in lower pH solution. Decrease in peak 2 in higher pH solution.
TABLE-US-00010 TABLE 6 Sample 5 at 75 C. for 1 hr. at pH 3.9 and 8.3 Sample Peak 1 Height Peak 2 Height LC pH 5.6 2359 2272 LC pH 3.9 1807 1869 LC pH 8.3 2008 1493
[0146] Observation. Slight decrease in peak 2 height in higher pH solutions
TABLE-US-00011 TABLE 7 Sample 6 at 75 C. for 3 hr at pH 3.9 and 8.3 Sample Peak 1 Height Peak 2 Height LC pH 5.6 2117 2111 LC pH 1.6 855 800 LC pH 3.9* 1038 1716 LC pH 7.5 1630 798 LC pH 9.4* 689 *1:3 Dilution with buffer to get proper pH
[0147] Observation. Decrease in peak 1 height in pH 3.9 solution. Decrease in peak 2 height in pH 7.5 solution. Loss of peak 2 in pH 9.4 solution.
[0148] The results of the study undertaken in Example 4 demonstrates the rate of conversion from Peak 1 (i.e., the pre Conversion peptide Form 1) to Peak 2 (i.e., the Converted peptide Form 2), after they are taken up in aqueous solution and adjusted to different pH or acidity levels. Here, the results demonstrate that conversion from Form 1 to Form 2 requires the application of heat and/or acidity to influence conversion rations in a sample of Super Liquid Concentrate (i.e., a solution comprising a mixture of Form 1, the peptide acid, and Form 2, the peptide lactone). Thus, in addition to heat, the conversion ratios observed in Tables 2-7 illustrate that conversion from the peptide form (i.e., Form 1 or Peak 1) to the peptide lactone form (i.e., Form 2 or Peak 2) requires a pH of 7.0 or less (e.g., a pH of 5.0, 4.5, 4.0, 3.5, 3.0. 2.5, 2.0 or less), with the most drastic conversion occurring at pH values ranging between 3 and 4.
[0149] Additionally, Example 4 shows that increasing the temperature and/or the length of time at a higher temperature will support a conversion trend that favors Form 2. Accordingly, this phenomenon can be observed by examining the ratio of Form 1, which is seen to shift from 1.8 to 1.2 to 1.05, as temperature, and time-at-temperature increases; this conversion trend clearly shows that conversion of Form 1 and temperature are inversely proportional. Indeed, as shown in Table 5, when the temperature is increased to 40 C., the ratio of Form 1 to Form 2 at pH 3.9 flips, resulting in a ratio of 0.6. In summary, Example 4 demonstrates that treating a mixture of the two forms to a higher temperature, and a lower pH, would yield a greater rate of conversion.
Example 5
[0150] Non Converting isoforms. We have shown that SEQ ID NO:119 can form an isoform with the loss of 18 Daltons in M.W. at higher temperature. In Example 2 we showed Conversion does not affect insecticidal potency when the original form of SEQ ID NO:119, Form 1, as a powder, was autoclaved to make it Convert to Form 2 and then it was tested by adding to the diet of the Southern Corn Rootworm, larva set. However, this transformation in SEQ ID NO:119, a hybrid peptide, has not been noticed in a peptide like SEQ ID NO:121, a native peptide. In contrast to SEQ ID NO:119, in SEQ ID NO:121 there is a an N-terminal Gln, which may cyclized itself to N-Pyr with loss of a NH.sub.3, i.e. loss of 17 daltons in M.W. These two chemical modifications, loss of H.sub.2O and loss of NH.sub.3, are difficult to differentiate because the loss of M.W. in these two processes is so close. We used analytical HPLC and sensitive TOF LC/MS methods to evaluate whether both of these chemical modifications can happen to a sequence like SEQ ID NO:121, which we also call the native hybrid peptide. The data below shows the Conversion can be induced in a native hybrid peptide when it is subjected to appropriate conditions as we describe herein for this process.
[0151] Materials and Methods. SEQ ID NO:121 was made from Hybrid-ACTX-Hvla K. lactis strain, pLB12D-YCT-24-1. Agilent HPLC system with Onyx 100 monolithic C18 HPLC column was used to analyze the SEQ ID NO:121 peptide production and isoform formation.
[0152] The LC-MS system is located at Launch MI Lab in SMIC, and consists of a Waters/Micromass quadrupole time-of-flight (Q-Tof Premier) mass spectrometer on-line with a Waters NanoAcquity UPLC system. Sample was diluted 1:50 in 0.1% formic acid in water.
[0153] Method A.
[0154] Five L of sample was injected onto a Waters BEH130 C-18 Symmetry column (0.3 mm ID15 cm) at a flow rate of 5 uL/min. Reverse-phase separation was achieved using a linear gradient from 0.1% mobile phase B (water with 0.1% formic acid) to 40% mobile phase B (100% acetonitrile with 0.1% formic acid) over 25 minutes, 85% B at 25.5 minutes, 85% B at 27.5 minutes, and 0.1% B at 28 minutes.
[0155] Method B.
[0156] Ten to 30 uL L of sample was injected onto a Waters C-18 X-Bridge Column (4.6 mm ID50 mm) at a flow rate of 1 mL/min. Reverse-phase separation was achieved over 15 minutes using a linear gradient of 99% mobile phase A (water with 0.1% formic acid) to 95% mobile phase B (100% acetonitrile with 0.1% formic acid) over 6 minutes, 95% B at 11 minutes, and 1% B at 11.2 minutes for a total run time of 18 minutes.
[0157] Column effluent was sampled by the mass spectrometer via an electrospray ionization source. Waters Masslynx 4.1 software was used for instrument control and MS and MS/MS data acquisition. Within Masslynx the MaxEnt 3 algorithm was used for deconvolution of multiply charged ions to a calculated monoisotopic M+H mass value.
[0158] Method C.
[0159] The LC-MS system consisted of a Waters/Micromass ZQ spectrometer with an electrospray ionization source. The sample was injected onto a Zorbax SB-C18 column (2.130 mm) at a flow rate of 1 mL/min. Reverse-phase separation was achieved over 3.1 minutes using a linear gradient of 96% mobile phase A (water with 0.1% formic acid) to 98% mobile phase B (100% acetonitrile with 0.07% formic acid) using a diode array detector (210 to 300 nm).
[0160] Results and Discussion.
[0161] Production of SEQ ID NO:121, aka native hybrid peptide, production strain, pLB24-YCT-24-1, was cultured in Defined Medium with 2% sorbitol as carbon source at 23.5 C for 6 days. The OD600 reached 30 at the time when the condition medium was collected after removal of cells. 300 L of the conditioned medium was injected into Agilent HPLC analytic system and a yield of native hybrid peptide was determined as 164 mg/L.
[0162] Agilent HPLC evaluation of native hybrid isoforms. The collected native hybrid conditioned medium was treated at 4 C, room temperature (23 C) and 50 C for 24 hours before analysis by Agilent analytic HPLC with loading of 300 L of each. The HPLC chromatographs of native hybrid peptide samples treated at different temperature are shown in
[0163] Peak 1, indicating Form 1, was the most abundant isoform initially, but Peak 1/Form 1 can transformed into isoforms Peak 2 and Peak 3 with time and higher temperature. We demonstrate that a 50 C. treatment for 24 hr. will almost make Peak 1 disappear (to only 5.6%). Conversely, Peak 2 and Peak 3 isoforms increase with temperature and increase faster with higher temperature.
[0164]
[0165] One isoform detected by TOF MS was the one with M.W. of 4417.6826, which represents the native native hybrid peptide, i.e. unmodified native hybrid, it is labeled as Peak 1 in
[0166] A second isoform detected had a M.W of 4399.6455. This isoform has 18 dalton loss in M.W. from the native isoform, indicating loss of a water molecule. This isoform, with a loss of H.sub.2O, is not labeled in
[0167] A third isoform detected had a M.W. of 4400.6660. This isoform had 17 dalton loss in M.W. from the native isoform and likely a loss of NH.sub.3. This isoform with a loss of NH.sub.3 is labeled as Peak 2 in
[0168] A fourth isoform is the combination of loss of both a H.sub.2O and a NH.sub.3 molecule, resulting in an isoform with M.W. of 4382.6313. The isoform with a loss of both H.sub.2O and NH.sub.3 is labeled as Peak 3 in
[0169] These results show there are at least two chemical modifications possible in the native hybrid peptide molecule, both N-terminal glutamine cyclization to pyroglutamic acid, and a dehydration reaction. From the TOF MS based peak intensity chromatograph, the isoform with only a H.sub.2O loss was barely detectable. This is consistent with the HPLC evaluation in which only 3 peaks have been detected. Loss of a H.sub.2O molecule can make the peptide more hydrophobic and further loss of a NH.sub.3 can make the peptide even more hydrophobic. We can predict that loss of H.sub.2O will shift the native hybrid peak to a later retention time in HPLC chromatograph. Loss of both H.sub.2O and NH.sub.3 will further shift the peak to an even later retention time.
Part 2
[0170] In Part 1 we describe how it is possible to artificially manipulate a toxic peptide with mechanical or chemical means such as temperature, pressure, strong and/or weak acids, in order to transform a peptide from its native state or what we call Form 1 into the useful state we call Form 2. The Form 2 composition may be referred to herein as the carbonyl, activated carbonyl, lactone, lactone like, and/or lactone like form. In this document we usually refer to this Form 2 composition simply as a lactone or peptide lactone. The structure of these compounds has no dictionary definition in this document, here they are defined by the characteristics we describe here. Here a lactone has the properties we attribute to the Form 2 compound. We use the word lactone and peptide lactone because these compounds react like a lactone. We describe how to make them, how to identify them, how to isolate them and how to use them. We provide data to show these peptide lactones are more biologically active than the native peptides and that they are very useful and versatile. They are stable intermediates that can be used to make other valuable compounds. In Part 2 we show how the peptide lactone can be made into two different and stable active compounds, useful as stable intermediates to make a variety of other compounds.
[0171] In Part 2 we describe peptide hydrazides, peptide hydrazones and we teach how to make and use them. A hydrazide or peptide hydrazide results from the reaction of the Part I peptide lactone with hydrazine. The other stable intermediate compound we describe we call a hydrazone or peptide hydrazone. A peptide hydrazone results from the reaction of a peptide hydrazide with a carbonyl compound. What is especially useful about peptide hydrazones is that they can be covalently bonded with other useful moieties such as alkyl chains and or pegylated products and then used for a variety of purposes, some of which we describe here. The ability to create an alkylated protein, in the manner we describe, is very useful. The ability to easily produce a pegylated protein, in the manner we describe is, perhaps, even more useful. Pegylated proteins have been used to reduce the immunogenicity of proteins, to decrease the metabolism of proteins and to increase the bioavailability of proteins. We believe our techniques, disclosed here for the first time, can be used to create pegylated proteins with exceptional value. These techniques can be used to make alkylated and pegylated proteins, and other types of proteins, more easily, quicker and at a lower cost than previously possible. One protein enhanced by pegylation is insulin.
[0172] We are able to demonstrate that the peptide lactone, the peptide hydrazide, and the peptide hydrazone, these can be either peptide intermediates, novel, chemically stable, chemically useful compounds used to react with other compounds, like PEG4Ketone (VIII) in Example 11. The peptide lactone and peptide hydrazide provide a single discrete site on these peptides or peptide acids where functional groups are added. The peptide and toxic peptide products and intermediates provide a single discrete chemical handle with unique chemistry synthetic or biological molecules more useful and functional. For example, this chemistry allows one to mono functionalize with a pegylation chain at a single site of the polypeptide. Another example is that it could allow one to mono attach molecules at one discrete site on the peptide or peptide acid such as a periodated digested glycosylated peptide or other carbohydrate. These peptide intermediates can be used to produce a wide range of products. We show that these toxic peptide intermediates are useful and provide more reaction options than the typical toxic peptide. We understand that pegylated toxic petides are even more active than unpegylated peptides.
[0173] PEGylation or pegylation is the linking of a peptide to polyethylene glycol and/or polypropropylene glycol or (PEG). Once linked to a peptide, each PEG subunit becomes tightly associated with two or three water molecules, which have the dual function of rendering the peptide more soluble in water and making its molecular structure larger. In a first generation protein pegylation the PEG attaches to one or more of several potential sites on the protein, such as to lysine and N-terminal amines. A problem with this approach is that a population of modified peptides can contain a mixture of molecules with PEG attached to different lysines, as well as molecules with different numbers of linked PEGs. This variability in modification diminishes the purity of the finished product and impedes reproducibility.
[0174] There have basically been two other more modern approaches used to add PEG to proteins in a more controlled manner; either A) alter the PEG to make it more reactive or B) alter the protein to provide special sites for PEG attachment.
[0175] A PEG method type A), alter the PEG, is described in U.S. Pat. No. 4,179,337, Davis et al., issued Dec. 18, 1979, incorporated herein by reference, specifically as to its descriptions of polymers suitable for pegylation. This patent describes modifying the polymer at one end either by the alteration of the terminal group or by the addition of a coupling group having activity to the peptide and reacting the activated polymer with the peptide. This method was used to pegylate insulin and other hormones. See U.S. Pat. No. 4,179,337.
[0176] A PEG method of type B), modify the peptide rather than the PEG, is to add a cysteine where desired to generate site-specific PEGylation at places chosen to minimize interference with the peptide's biological function, while decreasing the peptide's immunogenicity. PEG-maleimide, PEG-vinylsulfone, PEG-iodoacetamide, and PEG orthopyridyl disulfide are thiol reactive PEGs that have been created to PEGylate free cysteine residues. This approach has been used in a number of ways including making monoPEGylated human growth hormone analog. See Peptide PEGylation: The Next Generation, by Baosheng Liu, Pharmaceutical Technology, Volume 35.
[0177] The process described herein is a new and different method compared to anything used before and it allows for specific attachment of the PEG to a specific site on the protein. The novel method we describe provides for PEG attachment to the peptide using a PEG carbonyl reaction to a peptide hydrazide and is described in detail below. It can be used with any linear or branch polymer having a molecular weight of between about 500 to about 20,000 daltons selected from the group consisting of polyethylene glycol and polypropropylene glycol. The polymer may be unsubstituted or substituted by alkoxy or alkyl groups where the substituting groups possessing less than 5 carbon atoms. The benefits of being able to make a PEG toxic insect peptide are substantial and described above in the Summary of Invention.
[0178] General Chemical Reactions and Molecules Derived Therefrom
[0179] I. The Peptide Hydrazide.
[0180] The peptide hydrazide is made from the peptide lactone (see Part 1) and hydrazine to form a peptide hydrazide. The peptide hydrazide is essentially made in a three step procedure. The peptide lactone is mixed with hydrazine monohydrate. The mixture is stirred to solution to form the peptide hydrazide, and the peptide hydrazide is purified.
[0181] One of ordinary skill in the art would be able to produce many versions of this procedure, for example, the mixture of peptide lactone and hydrazine should be stirred well to form a solution. The peptide hydrazine formed in this solution can then be purified by a variety of methods, such as by prepative HPLC.
[0182] We teach both mixing the aqueous solution of the peptide lactone and the solution of hydrazine added as hydrazine monohydrate and then stirring well at room temperature. The peptide hydrazide can then be purified. We used HPLC for purification, other options, known to one skilled in the art are available. Procedures of this type are well known to the ordinary chemist and the procedures outlined herein may be varied considerable by one skilled in the art. Other options for collection and purification could be used. In the examples below both relatively pure and impure samples of lactone were used as the starting material and both of these resulted in high purity Peptide Hydrazide (I) and are described in Example 6. Other procedures could be used. In Example 6a and 6(b) the peptide lactone and hydrazide are mixed together and stirred. Purification steps can vary widely and various options are available and known to one skilled in the art.
[0183] II. The Peptide Hydrazone.
[0184] The peptide hydrazone and peptide hydrazide are important intermediates. Different types of peptide hydrazones can be made depending on what functional groups are desired for the peptide. Here we show various examples of different peptide hydrazones. Examples of hydrazones are shown in Examples 8-11. One skilled in the art will understand these are but representative and illustrative not limiting examples, other reagents and conditions could be used.
[0185] These examples use the peptide hydrazide with one or another type of carbonyl to create novel peptide hydrazones like the examples of Formula (II), (III), (VI) and (IX). Some examples of reactive carbonyl compounds producing novel pegylated proteins are provided.
[0186] Hexanal is added to a hydrazide to produce Hydrazone (II).
[0187] The reactions discussed above are shown in the structures below with details provided in the descriptions below and supporting data can be found in
EXAMPLES
[0188] The Examples and experiments performed for Part 2 are as follows:
[0189] Example 6, shows the peptide hydrazide, referred to as Peptide Hydrazide (I) or Hydrazide (I), can be made from the peptide lactone. Mass Spec. data is provided in
[0190] Example 7, provides data showing the peptide hydrazide is quicker acting when the normal acid form of the peptide is made into its hydrazide form. The toxic peptide used for both compounds began with Hybrid +2. After Hybrid +2 is converted to the hydrazide the two compounds (peptide acid form and peptide hydrazide form) are different compounds but they are very similar and have the same peptide backbone. The net difference essentially is that one peptide had hydrazine was added to create the Hydrazide (I) of Hybrid +2. These two samples were then tested on flies. One of the samples, either the normal acid form of the peptide or the hydrizide form of the peptide, i.e. the Hydrazide (I), were exposed to one of two groups of flies. One group of flies was exposed to the toxic peptide in hydrazide form, i.e. Hydrazide (I), the other group of flies was exposed to the toxic peptide in its native acid form. The data provided below in Example 7 shows the hydrazide kills insects faster than the native acid form of the same peptide.
[0191] Example 8, shows how hexanal can be used to make the hydrazone form of a peptide. Example 8 starts with the hydrazide (I), hexanal is added and the result is a hydrazone, referred to here as Formula (II) or Hydrazone (II). Mass spec. data is provided in
[0192] Example 9, provides for the preparation of a different hydrazone than Example 8. In Example 9 the compound O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (IV) (MW2,000) is used to make a peptide hydrazone. Mass Spec. data is provided in
[0193] Example 10, shows another way to make a hydrazone. Here it is a hydrazone made from a hydrazide and an acrylic ketone. It is the preparation of Hydrazone (VI) from Hydrazide (I) using Acrylic Ketone (V). Mass Spec. data is provided in
[0194] Example 11, describes the preparation of Hydrazone (IX) using a PEG4 Ketone (VIII). This example starts with Example 11(a) where 3-acetylacrylic acid and a carbodiimide are used to make PEG4 Ketone (VIII). Then, in Example 11(b), the PEG4 Ketone (VIII) and Hydrazide I are used to make Hydrazone (IX). Mass Spec. data is provided in
[0195] Representative formula to describe the peptide in its native acid form, the peptide lactone described in Part 1 and the peptide hydrazide of Part 2 is shown. Other hydrazides and hydrazones are described in Examples 8-11.
Example 6. Preparation of the Peptide Hydrazide (I)
[0196] This example shows two methods to prepare peptide hydrazide (I).
[0197] Example 6(a).
[0198] A solution of 100 mg of purified Form 2 peptide, the peptide lactone, in 1 mL of water was treated with 100 uL of hydrazine monohydrate and stirred at room temperature for 2 hours. The material was purified in portions on a prep HPLC (eluted with a gradient of acetonitrile/water/trifluoroacetic acid). Appropriate fractions were combined and concentrated under vacuum to a reduced volume. The liquid was frozen in a freezer at 80 C. and then freeze-dried on a lyopholizer to yield 36.94 mg of peptide hydrazide (I) as a white solid.
[0199] Example 6(b).
[0200] A solution (25 mL) of Super Liquid Concentrate (mixture of Form 1 and Form 2 peptide, aka peptide lactone, at 14 mg/mL) was stirred overnight at 75 C. After cooling, HPLC showed mostly Form 2 peptide, the peptide lactone. The solution was treated with 2 mL of hydrazine monohydrate and stirred at room temperature for 2 hours. The material was purified in portions on a prep HPLC (eluted with a gradient of acetonitrile/water/trifluoroacetic acid). Appropriate fractions were combined and concentrated under vacuum to a reduced volume. The liquid was frozen in a freezer at 80 C. and then freeze-dried on a lyopholizer to yield 252.2 mg of peptide hydrazide (I) as a white solid. Hydrazide (I) LCMS by method B ESI/MS 4578.00 (M+H), retention time 3.6-4.1 minutes. See
Example 7. Fly Injection of Peptide Hydrazide (I) Compared to Peptide Acid
[0201] In Example 7 we compare a toxic peptide in its typical acid form, Form 1 or the peptide form, with the same toxic peptide after it is converted to the peptide hydrazide, or Peptide Hydrazide (I) as it is labeled in the formula provided here. The following samples are prepared for injection:
[0202] 100 ng/uL solution of Hydrazide (I) in water. This solution was diluted with water to make 50 ng/uL and 5 ng/uL solutions
[0203] 100 ng/uL solution of Hybrid +2 in water. This solution was diluted with water to make 50 ng/uL and 5 ng/uL solutions.
[0204] Next, we performed the experiments according to the following steps:
[0205] (1) Prepare injected fly containers with proper labels, and punch air hole in the container lids with an 18-gauge needle. Choose flies. Use the flies on day 1 and day 2 after fully hatch-out and day 1 is the day of fully hatch-out. Turn on the CO.sub.2 gas line and immobilize the flies in the box by input of the CO.sub.2 gas with a needle. After flies are immobilized, transfer flies to a CO.sub.2 plate and keep them in sleep. The flies are massed and those with mass of 12-18 mg are used for the injection bioassay.
[0206] (2) Perform the injection. Load 100-200 l solution into a 1 ml syringe with a 30-gauge needle and mount the loaded syringe into the microapplicator. Remove the air bubble from the syringe by turning the pushing pole of the microapplicator. Then set injection volume to 0.5 l in the microapplicator.
[0207] (3) Inject the houseflies with 0.5 l of the prepared solutions above from the dorsal thorax by turning the pushing pole. Inject 10 flies for each prepared solution above. Put the injected flies into the prepared cups with a lid with air holes. Add 2 Whatman #4, 4.2 cm filter paper discs. Add 1 mL of sterile nanopure water.
[0208] (4) Keep all the injected flies at room temperature. At 3 hour, 5 hour, 21 hour and 24 hour post-injection, score the injected flies. If there is more than 20% mortality in the negative control, redo the fly injection as described above. At all four scoring time points, the water and anesthesia controls had 0% mortality.
[0209] At the 5 hour time point, the 100 ng/uL concentration of hydrazide had 80% mortality while Hybrid +2 at the same concentration achieved 10% mortality.
Example 8. Creating the Peptide Hydrazone (II) from Hexanal
[0210] A solution of 5 mg (0.00109 mmol) of hydrazide (I) in 100 uL of water was treated with 0.16 uL (0.00133 mmol) of hexanal in 10 uL of absolute ethanol. The mixture was stirred for 1 hour. Made a stock solution of 5 mg of hexanal and 2.86 uL of acetic acid in 490 uL of absolute ethanol. Reaction was treated with 10.9 uL of the stock solution and after mixing let stand for 2 hours. The mixture was heated at 60 C. for 1 hour. LCMS by method B ESI/MS 4661.60 (M+H, hydrazone), retention time 6.8-7.1 minutes. See
Example 9. Creating the Peptide Hydrazone (III) from O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (IV) (MW2000)
[0211] A stock solution of O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (MW-2,000) (IV)(10.9 mg) in 100 uL of absolute ethanol was treated with 1 drop of acetic acid. Note: O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (MW2000) is a mixture of compounds with a distribution around a MW of 2000 and not a single compound. A solution of 5 mg (0.00109 mmol) of hydrazide (I) in 100 uL of water was treated with 22 uL (0.0012 mmol) of the stock solution of O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (IV) (MW2,000). After mixing, the mixture was allowed to stand at room temperature. The remainder of the stock solution of O-[2-(6-Oxocaproylamino)ethyl]-O-methylpolyethylene glycol (IV)(MW2,000) was added in portions and the mixture allowed to stand overnight after mixing. LCMS by method B ESI/MS retention time 7.2-7.6 minutes. See
Example 10. Creating the Peptide Hydrazone (VI) from Peptide Hydrazide (I) Using Acrylic Ketone (V)
Example 10(a). Preparation of Acrylic Ketone (V)
[0212] A mixture of 0.5 g (4.38 mmol) of 3-Acetylacrylic acid, 0.924 g (4.82 mmol) of N-(3-Dimethylaminopropyl)-N-ethylcarbodiimide hydrochloride (EDC) and 0.651 g (4.82 mmol) of 1-Hydroxybenzotriazole hydrate (HOBt) in 4 mL of dichloromethane and 4 mL of tetrahydrofuran was stirred under nitrogen at room temperature for 10 minutes. The reaction was cooled in an ice bath and treated with a solution of 0.443 g (4.38 mmol) of hexylamine in 8 mL of dichloromethane. The reaction was stirred cold for 1 hour and overnight at room temperature. The reaction was diluted with dichloromethane and the organics were washed with a saturated sodium bicarbonate solution followed by a wash with water. The organic layer was dried over magnesium sulfate, filtered and concentrated under vacuum to yield a yellow solid. The solid was taken up in dichloromethane and purified on a column of silica gel (eluting with 50% ethyl acetate/hexanes). The appropriate fractions were combined and concentrated under vacuum to yield 537.06 mg of acrylic ketone (V) as a white solid. LCMS by method C ESI/MS 198.1 (M+H), 196.2 (MH). See
Example 10(b). Peptide Hydrazone (VI) from Acrylic Ketone (V)
[0213] A solution of 5 mg (0.00109 mmol) of hydrazide (I) in 150 uL of water was treated in portions with 0.96 mg (0.0048 mmol) of acrylic ketone (V) in 48 uL of absolute ethanol. The mixture was stirred for hour after each addition and then overnight. LCMS by method B ESI/MS 198.24 (M+H, acrylic ketone); 4760.60 (M+H, hydrazone), retention time 5.1-5.8 minutes. See
Example 11. Creating the Peptide Hydrazone (IX) Using a PEG4 Ketone (VIII) Prepared from 3-Acetylacrylic Acid
Example 11(a). Preparation of PEG4 Ketone (VIII)
[0214] A mixture of 137.6 mg (1.21 mmol) of 3-Acetylacrylic acid, 254.3 mg (1.327 mmol) of N-(3-Dimethylaminopropyl)-N-ethylcarbodiimide hydrochloride (EDC) and 179.25 mg (1.327 mmol) of 1-Hydroxybenzotriazole hydrate (HOBt) in 1 mL of dichloromethane and 1 mL of tetrahydrofuran was stirred under nitrogen at room temperature for 10 minutes. The reaction was cooled in an ice bath and treated with a solution of 250 mg (1.21 mmol) of m-PEG4-amine (VII) in 2 mL of dichloromethane. The reaction was stirred cold for 1 hour and overnight at room temperature. The reaction was diluted with dichloromethane and the organics were washed with a saturated sodium bicarbonate solution followed by a wash with water. The organic layer was dried over magnesium sulfate, filtered and concentrated under vacuum to yield 302.29 mg of PEG4 Ketone (VIII) as an oil. LCMS by method C ESI/MS 304.1 (M+H), 302.1 (MH). See
Example 11(b). Creating the Peptide Hydrazone (IX) Using PEG4 Ketone (VIII)
[0215] A solution of 5 mg (0.00109 mmol) of hydrazide (I) in 150 uL of water was treated in portions with 2.0 mg (0.0066 mmol) of PEG4 Ketone (VIII). The mixture was stirred for hour after each addition. LCMS by method B ESI/MS 304.28 (M+H, PEG4 ketone); 4867.70 (M+H, hydrazone) retention time 4.7-5.1 minutes. See
[0216] The examples are intended to illustrate and not limit the claims and the claimed invention. One ordinarily skilled in the art would be expected to be able to make numerous variations and different version of what is shown here.